Basic Information | |
---|---|
Family ID | F056621 |
Family Type | Metagenome |
Number of Sequences | 137 |
Average Sequence Length | 45 residues |
Representative Sequence | MNEKERFALAERVQKRIQEKHPHFRLIKRRDEIEKELKVKNENRRS |
Number of Associated Samples | 77 |
Number of Associated Scaffolds | 137 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 83.94 % |
% of genes near scaffold ends (potentially truncated) | 16.79 % |
% of genes from short scaffolds (< 2000 bps) | 78.10 % |
Associated GOLD sequencing projects | 65 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (65.693 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment (15.329 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.467 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) (31.387 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.05% β-sheet: 0.00% Coil/Unstructured: 45.95% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 137 Family Scaffolds |
---|---|---|
PF02010 | REJ | 2.19 |
PF13401 | AAA_22 | 2.19 |
PF04892 | VanZ | 1.46 |
PF00216 | Bac_DNA_binding | 1.46 |
PF13683 | rve_3 | 1.46 |
PF00691 | OmpA | 1.46 |
PF00071 | Ras | 1.46 |
PF07238 | PilZ | 1.46 |
PF07228 | SpoIIE | 1.46 |
PF01804 | Penicil_amidase | 1.46 |
PF07963 | N_methyl | 0.73 |
PF11074 | DUF2779 | 0.73 |
PF13743 | Thioredoxin_5 | 0.73 |
PF13599 | Pentapeptide_4 | 0.73 |
PF13424 | TPR_12 | 0.73 |
PF00498 | FHA | 0.73 |
PF13650 | Asp_protease_2 | 0.73 |
PF02622 | DUF179 | 0.73 |
PF12706 | Lactamase_B_2 | 0.73 |
PF01471 | PG_binding_1 | 0.73 |
PF12728 | HTH_17 | 0.73 |
PF00359 | PTS_EIIA_2 | 0.73 |
PF13594 | Obsolete Pfam Family | 0.73 |
PF00041 | fn3 | 0.73 |
PF14512 | TM1586_NiRdase | 0.73 |
PF14659 | Phage_int_SAM_3 | 0.73 |
PF02635 | DrsE | 0.73 |
PF07603 | DUF1566 | 0.73 |
PF00072 | Response_reg | 0.73 |
COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
---|---|---|---|
COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 1.46 |
COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.46 |
COG1678 | Putative transcriptional regulator, AlgH/UPF0301 family | Transcription [K] | 0.73 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 65.69 % |
Unclassified | root | N/A | 34.31 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001687|WOR8_10000142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 103495 | Open in IMG/M |
3300001687|WOR8_10014436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 8408 | Open in IMG/M |
3300001687|WOR8_10033540 | All Organisms → cellular organisms → Bacteria | 8793 | Open in IMG/M |
3300003454|DC05B_1113783 | Not Available | 578 | Open in IMG/M |
3300004023|Ga0055441_10006735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1819 | Open in IMG/M |
3300004023|Ga0055441_10047585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 970 | Open in IMG/M |
3300004026|Ga0055443_10168861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 669 | Open in IMG/M |
3300004029|Ga0055442_10035724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1256 | Open in IMG/M |
3300004029|Ga0055442_10225498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 624 | Open in IMG/M |
3300004051|Ga0055492_10017822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1187 | Open in IMG/M |
3300004148|Ga0055521_10079514 | Not Available | 780 | Open in IMG/M |
3300004755|Ga0068403_14201 | Not Available | 923 | Open in IMG/M |
3300005182|Ga0069000_10199442 | Not Available | 540 | Open in IMG/M |
3300005215|Ga0069001_10217653 | Not Available | 545 | Open in IMG/M |
3300005588|Ga0070728_10441475 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300005590|Ga0070727_10281250 | Not Available | 928 | Open in IMG/M |
3300005590|Ga0070727_10382895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae | 784 | Open in IMG/M |
3300005600|Ga0070726_10514861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 604 | Open in IMG/M |
3300005601|Ga0070722_10311295 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SG8_4 | 676 | Open in IMG/M |
3300005609|Ga0070724_10083455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1380 | Open in IMG/M |
3300005609|Ga0070724_10164234 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SG8_4 | 962 | Open in IMG/M |
3300005612|Ga0070723_10189315 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 933 | Open in IMG/M |
3300005612|Ga0070723_10389044 | Not Available | 673 | Open in IMG/M |
3300005920|Ga0070725_10012726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 3930 | Open in IMG/M |
3300006467|Ga0099972_12117925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 666 | Open in IMG/M |
3300007784|Ga0102955_1100446 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300008062|Ga0114372_1001908 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
3300008417|Ga0115363_10014050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 917 | Open in IMG/M |
3300008517|Ga0111034_1098161 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
3300009027|Ga0102957_1040805 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
3300009027|Ga0102957_1148636 | Not Available | 830 | Open in IMG/M |
3300009027|Ga0102957_1150947 | Not Available | 823 | Open in IMG/M |
3300009033|Ga0102956_1018786 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2103 | Open in IMG/M |
3300009033|Ga0102956_1367499 | Not Available | 507 | Open in IMG/M |
3300009138|Ga0102959_1021191 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
3300009138|Ga0102959_1128408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 774 | Open in IMG/M |
3300009145|Ga0102961_1008231 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
3300009145|Ga0102961_1242061 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300009488|Ga0114925_10171651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1423 | Open in IMG/M |
3300009506|Ga0118657_10024023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 9581 | Open in IMG/M |
3300009506|Ga0118657_10071333 | Not Available | 5626 | Open in IMG/M |
3300009506|Ga0118657_10620496 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
3300009506|Ga0118657_11298865 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300009506|Ga0118657_11898008 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300009506|Ga0118657_12018032 | Not Available | 665 | Open in IMG/M |
3300009509|Ga0123573_10814038 | Not Available | 875 | Open in IMG/M |
3300009509|Ga0123573_11251628 | Not Available | 692 | Open in IMG/M |
3300009788|Ga0114923_10031689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3606 | Open in IMG/M |
3300009788|Ga0114923_10038304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 3281 | Open in IMG/M |
3300009788|Ga0114923_10181453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1506 | Open in IMG/M |
3300010392|Ga0118731_101398064 | Not Available | 703 | Open in IMG/M |
3300010392|Ga0118731_101758728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1855 | Open in IMG/M |
3300010392|Ga0118731_107008007 | Not Available | 613 | Open in IMG/M |
3300010392|Ga0118731_108123552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfonauticaceae → Desulfonauticus → unclassified Desulfonauticus → Desulfonauticus sp. 38_4375 | 669 | Open in IMG/M |
3300010392|Ga0118731_109610585 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
3300010392|Ga0118731_109715731 | Not Available | 639 | Open in IMG/M |
3300010392|Ga0118731_110582734 | Not Available | 1096 | Open in IMG/M |
3300010392|Ga0118731_111023055 | Not Available | 1161 | Open in IMG/M |
3300010392|Ga0118731_111801142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 2593 | Open in IMG/M |
3300010392|Ga0118731_114147122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 508 | Open in IMG/M |
3300010392|Ga0118731_114163047 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
3300010412|Ga0136852_10614519 | Not Available | 1047 | Open in IMG/M |
3300010413|Ga0136851_10049917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4569 | Open in IMG/M |
3300010413|Ga0136851_10225857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1922 | Open in IMG/M |
3300010413|Ga0136851_10405508 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
3300010430|Ga0118733_102616083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfamplus → Desulfamplus magnetovallimortis | 997 | Open in IMG/M |
3300010430|Ga0118733_103911363 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300010430|Ga0118733_104564121 | Not Available | 737 | Open in IMG/M |
3300010430|Ga0118733_104883007 | Not Available | 711 | Open in IMG/M |
3300013098|Ga0164320_10184189 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300014903|Ga0164321_10019457 | Not Available | 2241 | Open in IMG/M |
3300014903|Ga0164321_10152790 | Not Available | 1017 | Open in IMG/M |
3300017971|Ga0180438_11012076 | Not Available | 602 | Open in IMG/M |
3300019703|Ga0194021_1041938 | Not Available | 539 | Open in IMG/M |
3300022201|Ga0224503_10034883 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
3300022202|Ga0224498_10016077 | Not Available | 2014 | Open in IMG/M |
3300022202|Ga0224498_10153789 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300022208|Ga0224495_10306260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 639 | Open in IMG/M |
3300022220|Ga0224513_10292552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 648 | Open in IMG/M |
(restricted) 3300022938|Ga0233409_10203726 | Not Available | 668 | Open in IMG/M |
3300024265|Ga0209976_10006608 | All Organisms → cellular organisms → Bacteria | 6271 | Open in IMG/M |
3300024265|Ga0209976_10097848 | Not Available | 1547 | Open in IMG/M |
3300024265|Ga0209976_10530551 | Not Available | 622 | Open in IMG/M |
(restricted) 3300024338|Ga0255043_10073050 | Not Available | 1091 | Open in IMG/M |
(restricted) 3300024338|Ga0255043_10079818 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
(restricted) 3300024338|Ga0255043_10170921 | Not Available | 739 | Open in IMG/M |
(restricted) 3300024340|Ga0255042_10159715 | Not Available | 679 | Open in IMG/M |
(restricted) 3300024340|Ga0255042_10182572 | Not Available | 644 | Open in IMG/M |
3300024432|Ga0209977_10115116 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
(restricted) 3300024519|Ga0255046_10024747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2170 | Open in IMG/M |
3300025895|Ga0209567_10519885 | Not Available | 577 | Open in IMG/M |
3300025974|Ga0210118_1005832 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
3300025974|Ga0210118_1006839 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
3300025991|Ga0210128_1090191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 519 | Open in IMG/M |
3300026133|Ga0209940_1031322 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300026352|Ga0210107_1021761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 958 | Open in IMG/M |
3300027758|Ga0209379_10202324 | Not Available | 684 | Open in IMG/M |
3300027814|Ga0209742_10021995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2114 | Open in IMG/M |
3300027820|Ga0209578_10365783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 662 | Open in IMG/M |
3300027845|Ga0209271_10351676 | Not Available | 586 | Open in IMG/M |
(restricted) 3300027856|Ga0255054_10000049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 53608 | Open in IMG/M |
(restricted) 3300027856|Ga0255054_10007996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5668 | Open in IMG/M |
(restricted) 3300027856|Ga0255054_10020745 | All Organisms → cellular organisms → Bacteria | 3378 | Open in IMG/M |
(restricted) 3300027856|Ga0255054_10538902 | Not Available | 565 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10405143 | Not Available | 654 | Open in IMG/M |
(restricted) 3300027865|Ga0255052_10240346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 884 | Open in IMG/M |
(restricted) 3300027868|Ga0255053_10098676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1395 | Open in IMG/M |
(restricted) 3300027868|Ga0255053_10233947 | Not Available | 885 | Open in IMG/M |
(restricted) 3300027881|Ga0255055_10009016 | All Organisms → cellular organisms → Bacteria | 6153 | Open in IMG/M |
(restricted) 3300027881|Ga0255055_10012700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 5041 | Open in IMG/M |
(restricted) 3300027881|Ga0255055_10031711 | Not Available | 2996 | Open in IMG/M |
(restricted) 3300027881|Ga0255055_10064066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2045 | Open in IMG/M |
3300027901|Ga0209427_10166675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1877 | Open in IMG/M |
3300027917|Ga0209536_100032007 | All Organisms → cellular organisms → Bacteria | 7129 | Open in IMG/M |
3300027917|Ga0209536_100115673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3405 | Open in IMG/M |
3300027917|Ga0209536_100571688 | Not Available | 1409 | Open in IMG/M |
3300027917|Ga0209536_100900844 | Not Available | 1093 | Open in IMG/M |
3300027917|Ga0209536_102639478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfamplus → Desulfamplus magnetovallimortis | 589 | Open in IMG/M |
3300027967|Ga0209272_10183276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 732 | Open in IMG/M |
3300027978|Ga0209165_10251821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 600 | Open in IMG/M |
3300028598|Ga0265306_10061657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1877 | Open in IMG/M |
3300028600|Ga0265303_10012622 | All Organisms → cellular organisms → Bacteria | 5507 | Open in IMG/M |
3300029827|Ga0134606_10078898 | Not Available | 1049 | Open in IMG/M |
3300031733|Ga0316577_10171892 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1223 | Open in IMG/M |
3300032137|Ga0316585_10144190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 786 | Open in IMG/M |
3300032231|Ga0316187_10376787 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
3300032231|Ga0316187_10659308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 777 | Open in IMG/M |
3300032252|Ga0316196_10366830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 619 | Open in IMG/M |
3300032259|Ga0316190_10325264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1051 | Open in IMG/M |
3300032259|Ga0316190_10995210 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300032262|Ga0316194_10053394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2638 | Open in IMG/M |
3300032262|Ga0316194_10167870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1410 | Open in IMG/M |
3300033429|Ga0316193_10330493 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
3300034782|Ga0373573_0001927 | Not Available | 5588 | Open in IMG/M |
3300034782|Ga0373573_0007533 | Not Available | 2782 | Open in IMG/M |
3300034782|Ga0373573_0032968 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
3300034782|Ga0373573_0276852 | Not Available | 537 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 15.33% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 9.49% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 9.49% |
Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 8.76% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 7.30% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 5.84% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.84% |
Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 4.38% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.38% |
Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 4.38% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 3.65% |
Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 2.92% |
Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 2.92% |
Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Sediment | 2.92% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 2.19% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.19% |
Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 1.46% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.46% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.73% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.73% |
Marine Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment | 0.73% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.73% |
Marine Sediment | Environmental → Aquatic → Marine → Cold Seeps → Sediment → Marine Sediment | 0.73% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.73% |
Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.73% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001687 | Deep Marine Sediments WOR-3-8_10 | Environmental | Open in IMG/M |
3300003454 | Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S5-DC05B | Environmental | Open in IMG/M |
3300004023 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordA_D2 | Environmental | Open in IMG/M |
3300004026 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2 | Environmental | Open in IMG/M |
3300004029 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 | Environmental | Open in IMG/M |
3300004051 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 | Environmental | Open in IMG/M |
3300004148 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004755 | Marine sediment microbial communities from Formosa Ridge, South China Sea - G1-2 | Environmental | Open in IMG/M |
3300005182 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordA_D2 | Environmental | Open in IMG/M |
3300005215 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordB_D2 | Environmental | Open in IMG/M |
3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
3300005609 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 | Environmental | Open in IMG/M |
3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
3300005920 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 | Environmental | Open in IMG/M |
3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
3300007784 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D1_MG | Environmental | Open in IMG/M |
3300008062 | Marine sediment microbial communities from shallow-sea hydrothermal vent, Milos, Greece - SG7 | Environmental | Open in IMG/M |
3300008417 | Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC12T | Environmental | Open in IMG/M |
3300008517 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 175 cmbsf. Combined Assembly of Gp0128389 and Gp0131431 MM4PM4 | Environmental | Open in IMG/M |
3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
3300009033 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MG | Environmental | Open in IMG/M |
3300009138 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MG | Environmental | Open in IMG/M |
3300009145 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MG | Environmental | Open in IMG/M |
3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
3300009788 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG | Environmental | Open in IMG/M |
3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
3300013098 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm | Environmental | Open in IMG/M |
3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
3300019703 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_7-8_MG | Environmental | Open in IMG/M |
3300022201 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21 | Environmental | Open in IMG/M |
3300022202 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21 | Environmental | Open in IMG/M |
3300022208 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
3300022938 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MG | Environmental | Open in IMG/M |
3300024265 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024338 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_9 | Environmental | Open in IMG/M |
3300024340 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5 | Environmental | Open in IMG/M |
3300024432 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
3300025895 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (SPAdes) | Environmental | Open in IMG/M |
3300025974 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025991 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026133 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MG (SPAdes) | Environmental | Open in IMG/M |
3300026352 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
3300027814 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-8_10 (SPAdes) | Environmental | Open in IMG/M |
3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
3300027845 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes) | Environmental | Open in IMG/M |
3300027856 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23 | Environmental | Open in IMG/M |
3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
3300027865 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21 | Environmental | Open in IMG/M |
3300027868 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22 | Environmental | Open in IMG/M |
3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
3300027901 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes) | Environmental | Open in IMG/M |
3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
3300027967 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 (SPAdes) | Environmental | Open in IMG/M |
3300027978 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes) | Environmental | Open in IMG/M |
3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
3300029827 | Marine sediment microbial communities from Barataria Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - M1047 | Environmental | Open in IMG/M |
3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Host-Associated | Open in IMG/M |
3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Host-Associated | Open in IMG/M |
3300032231 | Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1 | Environmental | Open in IMG/M |
3300032252 | Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cm | Environmental | Open in IMG/M |
3300032259 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 | Environmental | Open in IMG/M |
3300032262 | Coastal sediment microbial communities from Maine, United States - Cross River sediment 1 | Environmental | Open in IMG/M |
3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
3300034782 | Sediment microbial communities from coastal wetland in Texas, United States - D0606M02 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
WOR8_1000014263 | 3300001687 | Marine Sediment | MSNKDKLDLAERVQKRIQEKHPNFRFIKRRDEIEKEFKVKNENLRYCALNET* |
WOR8_100144361 | 3300001687 | Marine Sediment | MNNKERLALADKVQKRLEKEHPHFRLIRKRDEIEKELKAT* |
WOR8_100335407 | 3300001687 | Marine Sediment | LNDKERFTLADKIQKRVQEKLPQFQFVKRRKEIELKLKVKNENRGS* |
DC05B_11137831 | 3300003454 | Marine Sediment | VTEKERFATAERVKKRIQEKHPHFRLIKRRDEIEKKLKVKNENLYAKHEQI* |
Ga0055441_100067353 | 3300004023 | Natural And Restored Wetlands | LNDKERFALAERIQKRIQEQNPYLRLIKRRDEIEKKLKEKNENRKS* |
Ga0055441_100475852 | 3300004023 | Natural And Restored Wetlands | MSKKEKLDLAERVQKRIQEKHPHFRLIKRRDEIENELKVENENR* |
Ga0055443_101688611 | 3300004026 | Natural And Restored Wetlands | LNDKERFALAERVQKRIQERNPYLRLIKRRDEIEKKLKEKKEQ* |
Ga0055442_100357242 | 3300004029 | Natural And Restored Wetlands | MNEKERFALAERVQKRIQEKHHHYRLIKRRDEIEKKLKVKNENRRS* |
Ga0055442_102254982 | 3300004029 | Natural And Restored Wetlands | LNDKERFALAERIQKRIQKQNPYLRLIKRRDEIEKKLKEKNENRKS* |
Ga0055492_100178222 | 3300004051 | Natural And Restored Wetlands | MNDKERFALAERIQKRIQKQNPYLRLIKRRDEIEKKLKEKNENHKS* |
Ga0055521_100795141 | 3300004148 | Natural And Restored Wetlands | RRSYMNNKERLALADRVQKRLEREHPHFRLILKRDEIEKELNEKIENRGS* |
Ga0068403_142011 | 3300004755 | Marine Sediment | LNDKERATLAERIQKTVQEKHPHYQITKRKDEIEKEFEVKNENRRF* |
Ga0069000_101994422 | 3300005182 | Natural And Restored Wetlands | MNNKERLALADRVQKRLEREHPHFRLILKRDEIEKELNEKIENRGS* |
Ga0069001_102176532 | 3300005215 | Natural And Restored Wetlands | MNDKERFILADKIQKKVQENLPHFQSIKRKDEIEKQLKK* |
Ga0070728_104414751 | 3300005588 | Marine Sediment | LNDRERFDLAERIQKRVQEKHPHFRLIKRRDEIEKKLKVKNANRRS* |
Ga0070727_102812503 | 3300005590 | Marine Sediment | LNDKKMLALAERVQKRIQEKHPHFRLIKRRDEIEKELKVKNENRGS* |
Ga0070727_103828952 | 3300005590 | Marine Sediment | MSNKEKLDLAERVQKRIQEKHPHFRLIKRRDEIEKELKVINENRGS* |
Ga0070726_105148612 | 3300005600 | Marine Sediment | LNDRERFDLAERIQKRVQEKHPHFRLIKRWDEIEKKLKVKNANRRS* |
Ga0070722_103112952 | 3300005601 | Marine Sediment | LAERVQKRIQEGHPLFRLIKRRDEIEKEFKVKNEDRGKD* |
Ga0070724_100834553 | 3300005609 | Marine Sediment | MNEKERFALTEKVQKRVQEKHPHFQLIKRRDEIEKEFKVKNKDGRC* |
Ga0070724_101642342 | 3300005609 | Marine Sediment | MNEKESFALAERVQKRIQEGHPLFRLIKRRDEIEKEFKVKNENRGKD* |
Ga0070723_101893152 | 3300005612 | Marine Sediment | MNEKERFALAEKVQKRMQEKHPHFQLIKRRDEIEKEFKVKNKDGRC* |
Ga0070723_103890442 | 3300005612 | Marine Sediment | MTEKERFATAERVQKRIQERHPHFRLIKRRDEIEKKLKVKNENLYAKHEQI* |
Ga0070725_100127265 | 3300005920 | Marine Sediment | MNEKERFALAERVQKRVQEEHPHLRLIKRRDEIEKELKVKTENRGS* |
Ga0099972_121179252 | 3300006467 | Marine | EKERFALAERVQKRFQKKHHHYRLIKRRDEIEKELKVKNENRGS* |
Ga0102955_11004462 | 3300007784 | Soil | MNEKERFALTEKVQKRVQEKHPHFQLIKRRDEIEKELKVKNENRRS* |
Ga0114372_10019081 | 3300008062 | Marine Sediment | MSNKEQLDFAKRVQKRIQEKHPHFRLIKRRDEIEKEFKAENDNRKS* |
Ga0115363_100140501 | 3300008417 | Sediment | LNNKERFALAERIQKRVQEKHPHFRLIKRRDEIEKELKEKNENRGS* |
Ga0111034_10981612 | 3300008517 | Marine Sediment | LNDRERFDLAERIQKRVQEKHPHFRLIKRRDEIEKKLKVKNANRPEYAKCEP* |
Ga0102957_10408054 | 3300009027 | Pond Water | MNEKERFALAERVQKKIQEKHHHYRLIKRRDEIEKELKVKNENRRS* |
Ga0102957_11486362 | 3300009027 | Pond Water | MNDKERFALAERVQKRVQEEHPHFQLIKRKDEIEKQLKKA* |
Ga0102957_11509471 | 3300009027 | Pond Water | MSDKERFILADKIQKKVQENLPHFQSIKRKDEIEKQLKK* |
Ga0102956_10187864 | 3300009033 | Soil | MNDKERFILAEKIQKKVQENLPHFWLAKRRDEIEKQLKKEIGTIE* |
Ga0102956_13674991 | 3300009033 | Soil | MNDKERFILAEKIRKRIQEKHPRFHIIKRRDGIEKKLKMQEVDCRS* |
Ga0102959_10211912 | 3300009138 | Soil | MNDKERFALAERVQKRVQEEHPHFQLIKRKDEIEKQLKK* |
Ga0102959_11284082 | 3300009138 | Soil | EKVQKRVQEKHPHFQLIKRRDEIEKELKVKNENRRS* |
Ga0102961_10082312 | 3300009145 | Soil | MNDKERFALAEKIQKKVQENLPHFWLIKRRDDIEKQLKETVNIE* |
Ga0102961_12420611 | 3300009145 | Soil | MNEKERFALAERVQKRIQEKHPHFRLIKRRDEIEKELKVKNENRRS* |
Ga0114925_101716511 | 3300009488 | Deep Subsurface | LNDKERFALAERIKKRIQEKHPHFRLIKRRDEIEKELKVINENRGS* |
Ga0118657_100240233 | 3300009506 | Mangrove Sediment | LNNKERFALAERVQKRVQEKHPYFQLIKRRAEIEKKLEGKKRVKKA* |
Ga0118657_100713337 | 3300009506 | Mangrove Sediment | LKDEERFALAERIQKKIQENHPHFQFIKRRAEIEKQFEVKIESRRS* |
Ga0118657_106204961 | 3300009506 | Mangrove Sediment | MNDKERFALAERIQKRIRRQNPYLRLIKRRDEIEKKLKEKKENRRP* |
Ga0118657_112988651 | 3300009506 | Mangrove Sediment | LTDEERFALAERIQKKIQEKHPHFQVIKRRAEIEKQFEVKNEKRRS* |
Ga0118657_118980081 | 3300009506 | Mangrove Sediment | LNDKERFALAERVKKRIQEGQPHFWLKKRRDEIEKKLEVKRENRRF* |
Ga0118657_120180321 | 3300009506 | Mangrove Sediment | LNDKERFALAERIRKRIQENNPNFRLIKRRDEIQKEFSEKIENH |
Ga0123573_108140381 | 3300009509 | Mangrove Sediment | MNDKRRFALAEKIQKRIQEKRPYFQLIQRRNEIEKQLKKDIGTIE* |
Ga0123573_112516282 | 3300009509 | Mangrove Sediment | IQKKVQEKHRLFQLLKRRDEIEKEIRVKNENRGS* |
Ga0114923_100316892 | 3300009788 | Deep Subsurface | LNNKERFALAERIQKRVQEKHPHFRLIKRRDEIEKKLKVKNENRRS* |
Ga0114923_100383042 | 3300009788 | Deep Subsurface | LNDEERSTLAERIQKMVQEKHPHYQITKRKDEIEKEFEVKNENRRF* |
Ga0114923_101814532 | 3300009788 | Deep Subsurface | MNEKERFALAERVQKRIQEKHTHFRLIKRRDEIEQKLKVKNENRRF* |
Ga0118731_1013980642 | 3300010392 | Marine | MNEKERVALAERVQKRIQEKHPHFRLIKRRDEIGKEFKVKNETRGS* |
Ga0118731_1017587284 | 3300010392 | Marine | MLALAERVQKRIQEKHPHFRLIKRRDEIEKELKVKNENRGS* |
Ga0118731_1070080071 | 3300010392 | Marine | VNEKESLALAERVQKRIQEEHPLFRLIRRRDEIEKEFKVKNENRGS* |
Ga0118731_1081235523 | 3300010392 | Marine | LNDKERFDLAERVQKRVKEKHPLFRLIKRRDEIEKEFKVKNENRGS* |
Ga0118731_1096105852 | 3300010392 | Marine | MNEKERFALTEKVQKRVQEKHPHFQLIKRRDEIEKEFKVKNKDGRY* |
Ga0118731_1097157311 | 3300010392 | Marine | MTEKERFATAERVQKRIQERHPHFRLIKRRDEIEKKLKVKNENRGS* |
Ga0118731_1105827344 | 3300010392 | Marine | MNEKERFALAERVQKRIQKKHHHYRLIKRRDEIEKELKVKNENRGS* |
Ga0118731_1110230551 | 3300010392 | Marine | RVQKRIQEKHHNYRLIKRRAEIEKELKVINENRGS* |
Ga0118731_1118011425 | 3300010392 | Marine | MNEKERFSLAARVQKRIQEKHHNYRLIKRRAEIEKELKVINENRGS* |
Ga0118731_1141471221 | 3300010392 | Marine | MNEKERFALAEKVQKRMQEKHPHFQLIKRRDEIEKEFKVKNKDGR |
Ga0118731_1141630471 | 3300010392 | Marine | MNEKERFFLAERVQKRIQEKHHNYRLIKRRAEIEKELKVINENRGS* |
Ga0136852_106145193 | 3300010412 | Mangrove Sediment | LNDKERFDLAERIQKKVQEKHRLFQLLKRRDEIEKEIRVKNENRGS* |
Ga0136851_100499173 | 3300010413 | Mangrove Sediment | MNDKERFALAERIQKKIQNNSPYLRLIKRRDEIEKELKEKNENRRS* |
Ga0136851_102258574 | 3300010413 | Mangrove Sediment | LNNKERFALAERVQKRVQEKHPYFQLIKRRAEIEKKLEGKKRIKKA* |
Ga0136851_104055083 | 3300010413 | Mangrove Sediment | LTDEERFALAERIQKRIQEKHPHFQVIKRRAEIEKQFEVKIEKRRS* |
Ga0118733_1026160832 | 3300010430 | Marine Sediment | LNDKERFALAERVQKRVQEKHPHFRLIKRRDEIENELKVKNENRRS* |
Ga0118733_1039113631 | 3300010430 | Marine Sediment | MTEKERFALAEKVQKRIQEKHPHFQLIKRRVEIEKEFKVKNKDVRC* |
Ga0118733_1045641212 | 3300010430 | Marine Sediment | MNEKERFALAERVQKRIQEKHHHYRLIKRRDEIEKELKVKNENRGS* |
Ga0118733_1048830071 | 3300010430 | Marine Sediment | MNDIERLALADRVQKRLQKKHPYFRLIEKRDKIEKELKEKNS |
Ga0164320_101841891 | 3300013098 | Marine Sediment | LNDKERCALAERIQKRVQEKHPHFRLIKRRDEIEKEFKVKNENRGS* |
Ga0164321_100194572 | 3300014903 | Marine Sediment | LNDKERFALAERIQKRVQEKHPHSRLIKRRDEIEKKLKVKNENRRS* |
Ga0164321_101527903 | 3300014903 | Marine Sediment | LNEKERFALAERVQKRIQEKHPLFRLIKRRDEIEKEFKVKNENRGSWTKSWIS* |
Ga0180438_110120761 | 3300017971 | Hypersaline Lake Sediment | RVQKRIQEKHPHFRLIKRRDEIEKELNAENKNDRS |
Ga0194021_10419381 | 3300019703 | Sediment | MNDKERFILAEKIRKRIQEKHPRFHIIKRRDGIEKKLKMQEVDCRS |
Ga0224503_100348832 | 3300022201 | Sediment | MNDKERFALAERVQKRVQEEHPHFQLIKRKDEIEKQLKKA |
Ga0224498_100160772 | 3300022202 | Sediment | MSKKEKLDLAERVQKRIQEKHPHFRLIKRRDEIENELKVENENR |
Ga0224498_101537892 | 3300022202 | Sediment | MNEKERFALAERVQKRIQEKHHHYRLIKRRDEIEKKLKVKNENRRS |
Ga0224495_103062601 | 3300022208 | Sediment | LNDKERFALAERVQKRIQERNPYLRLIKRRDEIEKKLKEKKEQ |
Ga0224513_102925521 | 3300022220 | Sediment | LNDRERFDLAERIQKRVQEKHPHFRLIKRRDEIEKKLKVKNANRPEYAKCEP |
(restricted) Ga0233409_102037262 | 3300022938 | Seawater | MNEKERFALAERVQKRVQEEHPHLRLIKRRDEIEKELKVKTENRGS |
Ga0209976_100066083 | 3300024265 | Deep Subsurface | LNNKERFALAERIQKRVQEKHPHFRLIKRRDEIEKKLKVKNENRRS |
Ga0209976_100978482 | 3300024265 | Deep Subsurface | LNDKERATLAERIQKTVQEKHPHYQITKRKDEIEKEFEVKNENRRF |
Ga0209976_105305511 | 3300024265 | Deep Subsurface | MNEKERFALAERVQKRIQEKHTHFRLIKRRDEIEQKLKVKNENRRF |
(restricted) Ga0255043_100730503 | 3300024338 | Seawater | ERVQKGIQEKHHHYRLIKRRDEIEKELKVKNENRGS |
(restricted) Ga0255043_100798181 | 3300024338 | Seawater | MLALAERVQKRIQEKHPHFRLIKRRDEIEKELKVKNENRGS |
(restricted) Ga0255043_101709212 | 3300024338 | Seawater | LNDKDRFTLAERIQKMVAEKHPHYQIIKRKDEIEKEFEVKNENR |
(restricted) Ga0255042_101597151 | 3300024340 | Seawater | MNDIERLALADRVLKRLQKKHPHFRLIRKRDKIEKELKEKNSGFKKLSSS |
(restricted) Ga0255042_101825722 | 3300024340 | Seawater | MLALAERVQKRIQEKHPHFRLIKRRDEIEKELKVKNENR |
Ga0209977_101151163 | 3300024432 | Deep Subsurface | LNDKERVALAERVQKRVQEKHPHFRLIKRRDEIEKKLKIKNENRES |
(restricted) Ga0255046_100247473 | 3300024519 | Seawater | MSNKEKLDLAERVQKRIQEKHPHFRLIKRRDEIEKKLEVKIENRRS |
Ga0209567_105198851 | 3300025895 | Pelagic Marine | HLDDKERFALADRIRKRVQENHPHYMLIKKREEIENKLKVKNENRGS |
Ga0210118_10058322 | 3300025974 | Natural And Restored Wetlands | MNDKERFILADKIQKKVQENLPHFQSIKRKDEIEKQLKK |
Ga0210118_10068391 | 3300025974 | Natural And Restored Wetlands | MNDKERFILAEKIQKKVQENLPDFQLIKKRDDIEKQLKETGNIE |
Ga0210128_10901912 | 3300025991 | Natural And Restored Wetlands | LNDKERFALAERIQKMTQEKHAHFRLIKRRDEIENELQVKIEDRGS |
Ga0209940_10313221 | 3300026133 | Soil | MNDKERFALAERVQKRVQEEHPHFQLIKRKDEIEKQLKK |
Ga0210107_10217611 | 3300026352 | Natural And Restored Wetlands | LNDKERFALAERIQKWIQEQNPYLRLIKRRDEIEKKLKEKNENRKS |
Ga0209379_102023242 | 3300027758 | Marine Sediment | MNEKESFALAERVQKRIQEGHPLFRLIKRRDEIEKEFKVKNENRGKD |
Ga0209742_100219954 | 3300027814 | Marine Sediment | MSNKDKLDLAERVQKRIQEKHPNFRFIKRRDEIEKEFKVKNENLRYCALNET |
Ga0209578_103657832 | 3300027820 | Marine Sediment | MLALAERVQKRIQEKHHHYRLIKRRDEIEKELKVKNENRGS |
Ga0209271_103516761 | 3300027845 | Marine Sediment | MNEKERFALAEKVQKRMQEKHPHFQLIKRRDEIEKEFKVKNKDGRC |
(restricted) Ga0255054_1000004946 | 3300027856 | Seawater | LNNKERFALAERIQKRVQERRPHFRLIKRRDEIEKKFKVKNENRRS |
(restricted) Ga0255054_100079967 | 3300027856 | Seawater | LNDKERFALAERIQKRVQEKHSHFRLIKRRDEIEKKLKVKNENRGS |
(restricted) Ga0255054_100207454 | 3300027856 | Seawater | LNDEERSTLAERIQKMVQEKHPHYQITKRKDEIEKEFEVKNENRRF |
(restricted) Ga0255054_105389021 | 3300027856 | Seawater | MLVLAERVQKMIQEKHPHFRLIKRRDEIEKELKVKNENRGS |
(restricted) Ga0233415_104051431 | 3300027861 | Seawater | LNDEERSTLAEKIQKMVQEKHPHYQITKRKDEIEKEFEVKNENRRF |
(restricted) Ga0255052_102403461 | 3300027865 | Seawater | PLNDKKMLALAERVQKRIQEKHPHFRLIKRRDEIEKELKVKNENRGS |
(restricted) Ga0255053_100986761 | 3300027868 | Seawater | IFRRCHLNDKERFALAERIQKRVQEKHSHFRLIKRRDEIEKKLKVKNENRGS |
(restricted) Ga0255053_102339471 | 3300027868 | Seawater | MNEKERFALAERVQKRIQEKHTHFRLIKRRDEIEKKLKVK |
(restricted) Ga0255055_100090168 | 3300027881 | Seawater | LNDKERFALAKMIQKRVQEKHPHFQLIKRRDEIEKKLKVKNENRGS |
(restricted) Ga0255055_100127003 | 3300027881 | Seawater | MNEKERFALAERVQKRIQEKHTHFRLIKRRDEIEKKLKVKNENRRF |
(restricted) Ga0255055_100317114 | 3300027881 | Seawater | MNEKERFALAERVQKRIQEKHTHFRLIKRRDEIEQKLKVKNENRGS |
(restricted) Ga0255055_100640662 | 3300027881 | Seawater | MLVLAERVQKRIQEKHPHFRLIKRRDEIEKELKVKNENRGS |
Ga0209427_101666752 | 3300027901 | Marine Sediment | MNNKERLALADKVQKRLEKEHPHFRLIRKRDEIEKELKAT |
Ga0209536_1000320076 | 3300027917 | Marine Sediment | LNDKDVFALAEQVQKQIQEKLPYFWLIKRRDEIEKKLKVKDENRKHRIIREN |
Ga0209536_1001156734 | 3300027917 | Marine Sediment | LNDKERFALAERVQKRIQEEQPHFWLTKRRDEINKELEEEEERGNRRF |
Ga0209536_1005716883 | 3300027917 | Marine Sediment | MNDEERFALAKRVQKRIQEEHPHFLLTKRRNEIEKELEVKKENRRS |
Ga0209536_1009008443 | 3300027917 | Marine Sediment | MNDKERFILADKIQKKVQENLPHFQLIKRKDEIEKKIKS |
Ga0209536_1026394781 | 3300027917 | Marine Sediment | LNDKERFDLAERIQKKVQEKNSLFRLLKRRDEIEKKLRVKNENSGSC |
Ga0209272_101832761 | 3300027967 | Marine Sediment | LNDKKMLALAERVQKRIQEKHPHFRLIKRRDEIEKELK |
Ga0209165_102518212 | 3300027978 | Marine Sediment | NEKERFFLAERVQKRIQEKHHNYRLIKRRAEIEKELKVINENRGS |
Ga0265306_100616571 | 3300028598 | Sediment | LDDKERFALADRIRKRVQEKHPHYMLIKKREEIENKLKVKNE |
Ga0265303_100126227 | 3300028600 | Sediment | LDDKERFALADRIRKRVQEKHPHYMLIKKREEIENKLKVKNENRGS |
Ga0134606_100788983 | 3300029827 | Marine Sediment | MNNKQKLDLAERVQKRIQEQHPHFRLIKRRDEIEKELNAENKTGRS |
Ga0316577_101718921 | 3300031733 | Rhizosphere | LDLAERVQKRIQEQHPHFRLIKRRDEIEKELNAENKNGRS |
Ga0316585_101441902 | 3300032137 | Rhizosphere | MNNKQKLDLAERVQKRIQEQHPHFRLIKRRDEIEKELNAENKNGRS |
Ga0316187_103767872 | 3300032231 | Worm Burrow | MNEKERFALTEKVQKRVQEKHPHFQLIKRRDEIEKELKVKNENRRS |
Ga0316187_106593081 | 3300032231 | Worm Burrow | MNEKERFALAERVQKGIQEKHHHYRLIKRRDEIEKELKVKNENRGS |
Ga0316196_103668301 | 3300032252 | Sediment | MNEKERFALAERVQKRVQEEHPHLRLIKRRDEIEKELKVKTENRG |
Ga0316190_103252642 | 3300032259 | Worm Burrow | MNEKERFALAERVQKRIQGKHHHYRLIKRRDEIEKELKVINENRGS |
Ga0316190_109952101 | 3300032259 | Worm Burrow | MNEKERFALTEKVQKRVQEKHPHFQLIKRRDEIEKEFKVKNKDGRC |
Ga0316194_100533943 | 3300032262 | Sediment | MNEKERFALTEKVQKRVQEKHPHFQLIKRRDEIEKEFKVKNKDGRY |
Ga0316194_101678702 | 3300032262 | Sediment | HMNEKERFALAERVQKGIQEKHHHYRLIKRRDEIEKELKVKNENRGS |
Ga0316193_103304931 | 3300033429 | Sediment | MNEKERLALAERVQKGIQEKHHHYRLIKRRDEIEKELKVKNENRGS |
Ga0373573_0001927_1678_1818 | 3300034782 | Sediment | MNNKQKLNLAEKVQKRIQEKHPNFRLIKRRDEIEKELNAENKSGKS |
Ga0373573_0007533_2566_2706 | 3300034782 | Sediment | MNDKERFALAELIQKRIQEGHSHFWLAKRRDEIEKQLKVEIGNRRS |
Ga0373573_0032968_203_319 | 3300034782 | Sediment | MNDKERFILAEKIQKKVQEKLPHCQLIKRRDEIEKRLK |
Ga0373573_0276852_328_465 | 3300034782 | Sediment | MNDKERFILAEKIQKKVQENFPHFQLIKRRDEIEKQLKKDIGTIE |
⦗Top⦘ |