| Basic Information | |
|---|---|
| Family ID | F053932 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 35 residues |
| Representative Sequence | MNRWLPYVLFPRPGWFILHAAVIVLVFLLGYSVKF |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.00 % |
| % of genes near scaffold ends (potentially truncated) | 2.86 % |
| % of genes from short scaffolds (< 2000 bps) | 83.57 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.571 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (18.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (29.286 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.68% β-sheet: 0.00% Coil/Unstructured: 60.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF10120 | ThiP_synth | 10.00 |
| PF01553 | Acyltransferase | 8.57 |
| PF00266 | Aminotran_5 | 3.57 |
| PF00300 | His_Phos_1 | 1.43 |
| PF01381 | HTH_3 | 0.71 |
| PF01343 | Peptidase_S49 | 0.71 |
| PF02811 | PHP | 0.71 |
| PF01479 | S4 | 0.71 |
| PF00478 | IMPDH | 0.71 |
| PF02281 | Dimer_Tnp_Tn5 | 0.71 |
| PF04055 | Radical_SAM | 0.71 |
| PF06050 | HGD-D | 0.71 |
| PF04316 | FlgM | 0.71 |
| PF00005 | ABC_tran | 0.71 |
| PF01636 | APH | 0.71 |
| PF08245 | Mur_ligase_M | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG2747 | Negative regulator of flagellin synthesis (anti-sigma28 factor) | Transcription [K] | 2.14 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.43 |
| COG1775 | Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA dehydratase subunit, BcrC/BadD/HgdB | Amino acid transport and metabolism [E] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.57 % |
| Unclassified | root | N/A | 6.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000231|TB_LI09_4DRAFT_10184958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 686 | Open in IMG/M |
| 3300000232|TB_PC08_64DRAFT_1034302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1336 | Open in IMG/M |
| 3300000312|WSSedB2BaDRAFT_1020807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 519 | Open in IMG/M |
| 3300000734|JGI12535J11911_1008833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 877 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_100016626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1081 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_100390186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 760 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_101548664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 718 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_108487543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 510 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_109566592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1512 | Open in IMG/M |
| 3300001580|Draft_10034964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 3453 | Open in IMG/M |
| 3300005573|Ga0078972_1004449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 38310 | Open in IMG/M |
| 3300005645|Ga0077109_1115608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 709 | Open in IMG/M |
| 3300005832|Ga0074469_10085169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 543 | Open in IMG/M |
| 3300005947|Ga0066794_10081468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 964 | Open in IMG/M |
| 3300006795|Ga0075520_1361446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 590 | Open in IMG/M |
| 3300007965|Ga0100401_1023850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 3685 | Open in IMG/M |
| 3300008001|Ga0100389_1268879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 765 | Open in IMG/M |
| 3300008008|Ga0100399_1222269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 723 | Open in IMG/M |
| 3300008086|Ga0100388_10581718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 503 | Open in IMG/M |
| 3300009031|Ga0103682_10290844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 846 | Open in IMG/M |
| 3300009039|Ga0105152_10115069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1095 | Open in IMG/M |
| 3300009078|Ga0105106_11119156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 559 | Open in IMG/M |
| 3300009082|Ga0105099_10138704 | Not Available | 1363 | Open in IMG/M |
| 3300009091|Ga0102851_10976860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 919 | Open in IMG/M |
| 3300009111|Ga0115026_10886368 | Not Available | 704 | Open in IMG/M |
| 3300009111|Ga0115026_11692360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 533 | Open in IMG/M |
| 3300009131|Ga0115027_11625571 | Not Available | 535 | Open in IMG/M |
| 3300009146|Ga0105091_10190945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 972 | Open in IMG/M |
| 3300009166|Ga0105100_10666610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 640 | Open in IMG/M |
| 3300009167|Ga0113563_12166752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 667 | Open in IMG/M |
| 3300009167|Ga0113563_12752837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 595 | Open in IMG/M |
| 3300009388|Ga0103809_1031027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 736 | Open in IMG/M |
| 3300009504|Ga0114946_10091415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 1706 | Open in IMG/M |
| 3300010391|Ga0136847_11177378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 674 | Open in IMG/M |
| 3300011408|Ga0137460_1122915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 517 | Open in IMG/M |
| 3300012931|Ga0153915_12855111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 564 | Open in IMG/M |
| 3300012964|Ga0153916_10824334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1008 | Open in IMG/M |
| 3300012964|Ga0153916_11036114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 901 | Open in IMG/M |
| 3300012964|Ga0153916_11809986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 683 | Open in IMG/M |
| 3300013088|Ga0163200_1035906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1497 | Open in IMG/M |
| 3300013088|Ga0163200_1037563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1463 | Open in IMG/M |
| 3300013092|Ga0163199_1101456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1212 | Open in IMG/M |
| (restricted) 3300013122|Ga0172374_1009717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 4960 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10192085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1179 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10225248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1145 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10029525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 5902 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10041807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 4631 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10309520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → unclassified Desulfobacca → Desulfobacca sp. RBG_16_60_12 | 1139 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10554132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 753 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10945522 | Not Available | 517 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10076325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 3271 | Open in IMG/M |
| 3300014264|Ga0075308_1072973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 702 | Open in IMG/M |
| 3300014264|Ga0075308_1109602 | Not Available | 601 | Open in IMG/M |
| 3300014304|Ga0075340_1060413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 685 | Open in IMG/M |
| 3300014306|Ga0075346_1092530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 649 | Open in IMG/M |
| 3300014316|Ga0075339_1261007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 503 | Open in IMG/M |
| 3300014319|Ga0075348_1121494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 672 | Open in IMG/M |
| 3300014490|Ga0182010_10211172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1020 | Open in IMG/M |
| 3300014490|Ga0182010_10263448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 918 | Open in IMG/M |
| 3300014490|Ga0182010_10341843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 809 | Open in IMG/M |
| 3300014502|Ga0182021_11322334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 868 | Open in IMG/M |
| 3300014502|Ga0182021_11516016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 807 | Open in IMG/M |
| 3300014502|Ga0182021_11970203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 703 | Open in IMG/M |
| 3300017959|Ga0187779_11385983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 500 | Open in IMG/M |
| 3300017966|Ga0187776_11511206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 516 | Open in IMG/M |
| 3300018055|Ga0184616_10012795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2437 | Open in IMG/M |
| 3300018055|Ga0184616_10050236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1392 | Open in IMG/M |
| 3300018064|Ga0187773_10163712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1158 | Open in IMG/M |
| 3300020074|Ga0194113_10006427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 14917 | Open in IMG/M |
| 3300022553|Ga0212124_10048145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2532 | Open in IMG/M |
| 3300022653|Ga0236337_1162642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 828 | Open in IMG/M |
| 3300024056|Ga0124853_1312203 | All Organisms → cellular organisms → Bacteria | 2390 | Open in IMG/M |
| 3300025022|Ga0210056_1132633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 936 | Open in IMG/M |
| 3300025031|Ga0210024_1049847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1621 | Open in IMG/M |
| 3300025081|Ga0208953_1105367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 605 | Open in IMG/M |
| 3300025135|Ga0209498_1066785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 1560 | Open in IMG/M |
| 3300025556|Ga0210120_1057646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 760 | Open in IMG/M |
| 3300025725|Ga0209638_1199341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 605 | Open in IMG/M |
| 3300025843|Ga0209182_10097655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 828 | Open in IMG/M |
| 3300025843|Ga0209182_10149179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 655 | Open in IMG/M |
| 3300025948|Ga0210088_1060203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 603 | Open in IMG/M |
| 3300025952|Ga0210077_1018482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1494 | Open in IMG/M |
| 3300025952|Ga0210077_1075006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 701 | Open in IMG/M |
| 3300025995|Ga0210079_1069937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 574 | Open in IMG/M |
| 3300026839|Ga0207764_125698 | Not Available | 514 | Open in IMG/M |
| 3300026860|Ga0207823_110923 | Not Available | 627 | Open in IMG/M |
| 3300027740|Ga0214474_1226030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 677 | Open in IMG/M |
| 3300027863|Ga0207433_10002292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 39132 | Open in IMG/M |
| 3300027885|Ga0209450_10034272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3013 | Open in IMG/M |
| 3300027897|Ga0209254_10236340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1437 | Open in IMG/M |
| 3300027897|Ga0209254_10846877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 614 | Open in IMG/M |
| 3300027897|Ga0209254_10916109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 581 | Open in IMG/M |
| 3300027900|Ga0209253_10476960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 934 | Open in IMG/M |
| 3300027902|Ga0209048_10075333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2661 | Open in IMG/M |
| 3300027902|Ga0209048_10447921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 879 | Open in IMG/M |
| 3300028032|Ga0265296_1000028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 344084 | Open in IMG/M |
| 3300028168|Ga0268277_1060399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1048 | Open in IMG/M |
| 3300028299|Ga0268276_1083346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1103 | Open in IMG/M |
| 3300029288|Ga0265297_10004843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 21372 | Open in IMG/M |
| 3300029959|Ga0272380_10810011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 589 | Open in IMG/M |
| 3300031255|Ga0315554_1130543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 893 | Open in IMG/M |
| 3300031276|Ga0307441_1066680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1095 | Open in IMG/M |
| 3300031552|Ga0315542_1016246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 3492 | Open in IMG/M |
| 3300031552|Ga0315542_1037278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2063 | Open in IMG/M |
| 3300031552|Ga0315542_1100861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1098 | Open in IMG/M |
| 3300031699|Ga0315535_1202610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 697 | Open in IMG/M |
| 3300031749|Ga0315298_1183783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 1071 | Open in IMG/M |
| 3300031772|Ga0315288_11426751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 578 | Open in IMG/M |
| 3300031834|Ga0315290_10502859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1058 | Open in IMG/M |
| 3300031834|Ga0315290_10655866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 907 | Open in IMG/M |
| 3300031834|Ga0315290_11239670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 617 | Open in IMG/M |
| 3300031949|Ga0214473_10535616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1302 | Open in IMG/M |
| 3300031997|Ga0315278_11522460 | Not Available | 643 | Open in IMG/M |
| 3300032143|Ga0315292_11167682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 634 | Open in IMG/M |
| 3300032156|Ga0315295_10014593 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6889 | Open in IMG/M |
| 3300032163|Ga0315281_11050028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 823 | Open in IMG/M |
| 3300032163|Ga0315281_11479792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 666 | Open in IMG/M |
| 3300032163|Ga0315281_11636804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 626 | Open in IMG/M |
| 3300032163|Ga0315281_11683247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 616 | Open in IMG/M |
| 3300032164|Ga0315283_10636600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1153 | Open in IMG/M |
| 3300032168|Ga0316593_10335363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 577 | Open in IMG/M |
| 3300032173|Ga0315268_10087455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2936 | Open in IMG/M |
| 3300032173|Ga0315268_10440223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1280 | Open in IMG/M |
| 3300032173|Ga0315268_10690992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1017 | Open in IMG/M |
| 3300032173|Ga0315268_12140043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 573 | Open in IMG/M |
| 3300032173|Ga0315268_12526627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 527 | Open in IMG/M |
| 3300032177|Ga0315276_10086944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 3150 | Open in IMG/M |
| 3300032177|Ga0315276_11141974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 823 | Open in IMG/M |
| 3300032256|Ga0315271_10042533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3248 | Open in IMG/M |
| 3300032256|Ga0315271_10091088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2299 | Open in IMG/M |
| 3300032256|Ga0315271_11810913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 524 | Open in IMG/M |
| 3300032397|Ga0315287_10296197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1906 | Open in IMG/M |
| 3300032397|Ga0315287_10929152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1016 | Open in IMG/M |
| 3300032401|Ga0315275_10680292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium CG07_land_8_20_14_0_80_60_11 | 1145 | Open in IMG/M |
| 3300032516|Ga0315273_12132242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 660 | Open in IMG/M |
| 3300033416|Ga0316622_100927486 | Not Available | 1015 | Open in IMG/M |
| 3300033480|Ga0316620_10818484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 895 | Open in IMG/M |
| 3300033486|Ga0316624_10188345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1584 | Open in IMG/M |
| 3300033489|Ga0299912_10487106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 994 | Open in IMG/M |
| 3300033513|Ga0316628_101161581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1027 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 18.57% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.29% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 5.00% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 4.29% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 4.29% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 4.29% |
| Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 3.57% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 3.57% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.57% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.86% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.86% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.86% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 2.14% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.14% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.14% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.43% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.43% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 1.43% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 1.43% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.43% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.43% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.43% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.71% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.71% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.71% |
| Groundwater | Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater | 0.71% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.71% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.71% |
| Hot Spring Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Microbial Mat | 0.71% |
| Brackish Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Brackish Water | 0.71% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.71% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.71% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.71% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 0.71% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.71% |
| Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture | 0.71% |
| Bioremediated Contaminated Groundwater | Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000231 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4 | Environmental | Open in IMG/M |
| 3300000232 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_64 | Environmental | Open in IMG/M |
| 3300000312 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300000734 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
| 3300005573 | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPADES assembly) | Environmental | Open in IMG/M |
| 3300005645 | Brackish water microbial communities from Lake Sakinaw in Canada: eDNA_2 (120m) | Environmental | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300007965 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-25 | Environmental | Open in IMG/M |
| 3300008001 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-13 | Environmental | Open in IMG/M |
| 3300008008 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-23 | Environmental | Open in IMG/M |
| 3300008086 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-12 | Environmental | Open in IMG/M |
| 3300009031 | Microbial communities from groundwater in Rifle, Colorado, USA - 3D_0.1um | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009388 | Metatranscriptome sequencing of an Anaerobic Hexadecane-Degrading Microbial Consortia from University of California, San Diego, USA - Hexadecane | Engineered | Open in IMG/M |
| 3300009504 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300011408 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT723_2 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013088 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_200m | Environmental | Open in IMG/M |
| 3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
| 3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
| 3300013125 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m | Environmental | Open in IMG/M |
| 3300013136 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5m | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
| 3300014264 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rd | Environmental | Open in IMG/M |
| 3300014304 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014306 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D1 | Environmental | Open in IMG/M |
| 3300014316 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 | Environmental | Open in IMG/M |
| 3300014319 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
| 3300022653 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W1 | Environmental | Open in IMG/M |
| 3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025022 | Groundwater microbial communities from aquifer - Crystal Geyser CG07_land_8/20/14_0.80 (SPAdes) | Environmental | Open in IMG/M |
| 3300025031 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-25 (SPAdes) | Environmental | Open in IMG/M |
| 3300025081 | Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection B2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025135 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment (SPAdes) | Environmental | Open in IMG/M |
| 3300025556 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025725 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025843 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes) | Environmental | Open in IMG/M |
| 3300025948 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025952 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025995 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026839 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 52 (SPAdes) | Environmental | Open in IMG/M |
| 3300026860 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 70 (SPAdes) | Environmental | Open in IMG/M |
| 3300027740 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeq | Environmental | Open in IMG/M |
| 3300027863 | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300028032 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1 | Environmental | Open in IMG/M |
| 3300028168 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_50m | Environmental | Open in IMG/M |
| 3300028299 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_45m | Environmental | Open in IMG/M |
| 3300029288 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91 | Engineered | Open in IMG/M |
| 3300029959 | EPA Superfund site combined assembly | Engineered | Open in IMG/M |
| 3300031255 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-70 | Environmental | Open in IMG/M |
| 3300031276 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-20 | Environmental | Open in IMG/M |
| 3300031552 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-20 | Environmental | Open in IMG/M |
| 3300031699 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-20 | Environmental | Open in IMG/M |
| 3300031749 | Extremophilic microbial mat communities from Washburn Hot Springs, YNP, Wyoming, USA - WHS_1_MG | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB_LI09_4DRAFT_101849582 | 3300000231 | Groundwater | MNRWLPYVLFPRPGWFILHAAVIALVFLLGYSVKF* |
| TB_PC08_64DRAFT_10343023 | 3300000232 | Groundwater | MNRWLPHVLFPRPGWFILHAIIIVLIFCLGYVVKF* |
| WSSedB2BaDRAFT_10208072 | 3300000312 | Wetland | MNRWLPYVMFPRPGWFILHAAVIALIFFLGYSVKF* |
| JGI12535J11911_10088331 | 3300000734 | Tropical Forest Soil | MNRWLPFILFPRPGWFVLHAIVITLVLLLGYSVEF* |
| JGIcombinedJ13530_1000166262 | 3300001213 | Wetland | MNRWLPYILFPRPGWFVLHAVAIALVFLLGYSIEF* |
| JGIcombinedJ13530_1003901863 | 3300001213 | Wetland | MNRWLPYILFPRPGWFILHAVAIASVFCLGFVVKF* |
| JGIcombinedJ13530_1015486643 | 3300001213 | Wetland | MNRWLPHVLFPRPGWFVLHAIIIALVFCLGYVVKF* |
| JGIcombinedJ13530_1084875432 | 3300001213 | Wetland | MNRWLPYVLFPRPGWFILHAIVIALIFSLGYVVKF* |
| JGIcombinedJ13530_1095665922 | 3300001213 | Wetland | MLRLIPYVLFPRPGWFILHAAVIGLLFWLGYSIDFTPPP* |
| Draft_100349642 | 3300001580 | Hydrocarbon Resource Environments | MNRWLPYVLHPRPGWFILHAAAIVLVFLLGYSVKF* |
| Ga0078972_100444929 | 3300005573 | Hot Spring | MNRWLPYILFPRPGWFILHGAAIALVFLLGYSMEF* |
| Ga0077109_11156082 | 3300005645 | Brackish Water | MNRWLSPVLFPRPGWFILHAAVIVLVFLLGYSVKF* |
| Ga0074469_100851693 | 3300005832 | Sediment (Intertidal) | MNRWLPHVLFPRPGWFILHAAVIVLVFLLGYSVKF* |
| Ga0066794_100814682 | 3300005947 | Soil | MNHWLPYVLYPRPGWFILHAAVIVLVFLLGYSVKF* |
| Ga0075520_13614461 | 3300006795 | Arctic Peat Soil | MNRWLPLVLYPRPGWFILHAAAIVLVFLLGYSVKF* |
| Ga0100401_10238506 | 3300007965 | Aquifer | MNRWLPHILYPRPGWLILHAIAIVLVFLLGYSVKF* |
| Ga0100389_12688792 | 3300008001 | Aquifer | MNRWLSYILYPRPGWLILHAIAIVLVFLLGYSVKF* |
| Ga0100399_12222692 | 3300008008 | Aquifer | MNRWLPYILYPRPGWLILHAIAIVLVFLLGYSVKF* |
| Ga0100388_105817182 | 3300008086 | Aquifer | MNRWPPHILYPRPGWLILHAIAIVLVFLLGYSVKF* |
| Ga0103682_102908442 | 3300009031 | Groundwater | MNRWLPHVLFPRPGWFILHAAAIVLVFLLGYSVRF* |
| Ga0105152_101150692 | 3300009039 | Lake Sediment | MNRWLPYVLYLRPGWFILHAAVIGLVFLLGYSVKF* |
| Ga0105106_111191562 | 3300009078 | Freshwater Sediment | MNRWLPHVLYPRPGWFILHAAVIVLVFLLGYSVKF* |
| Ga0105099_101387043 | 3300009082 | Freshwater Sediment | MNRWLPHVLFPRPGWFILHGAIIALVFLLGYSVKF* |
| Ga0102851_109768602 | 3300009091 | Freshwater Wetlands | MNRWLPHILFPRPGWFILHAAAIALVFLLGYSVKF* |
| Ga0115026_108863682 | 3300009111 | Wetland | MNRWLPYVLFPRPGWFILHAALIVLVFLLGYAVKF* |
| Ga0115026_116923602 | 3300009111 | Wetland | MNRWLPHVLFPRPGWFILHAAVIALVFLLGYSVKF* |
| Ga0115027_116255712 | 3300009131 | Wetland | MNPWLPHVLFPRPGWFILHAAVIGLVFLLGYSVKF* |
| Ga0105091_101909451 | 3300009146 | Freshwater Sediment | MNRWLPHVLFPRPGWYILHAAVIVLVFLLGYSVKF* |
| Ga0105100_106666102 | 3300009166 | Freshwater Sediment | MNHWLPHVLYPRPGWFILHAAVIVLVFLLGYSVTF* |
| Ga0113563_121667521 | 3300009167 | Freshwater Wetlands | MNRWLPHVLFPRPGWLLLHATAIVLVFLLGYSVKF* |
| Ga0113563_127528372 | 3300009167 | Freshwater Wetlands | MNRWLPYVLFPRPGWFILHAAVIVPVFLLGYSVKF* |
| Ga0103809_10310272 | 3300009388 | Enrichment Culture | MNRWLPHVLHPRPGWFILHAAAIVLVFLLGYSVRF* |
| Ga0114946_100914153 | 3300009504 | Sediment | VNRWLPHVLFPRPGWFILHAAAMVLVFLLGYSVKF* |
| Ga0136847_111773781 | 3300010391 | Freshwater Sediment | MLRLVPYILFPRPGWFILHAAAIALVFLLGYSAKF* |
| Ga0137460_11229151 | 3300011408 | Soil | MNRWLPHVLYLRPGWFILHGAVIVLVFLLGYSVKF* |
| Ga0153915_128551112 | 3300012931 | Freshwater Wetlands | MNRWLPYVLFPRPGWFILHATVIALVFLLGYSVKF* |
| Ga0153916_108243343 | 3300012964 | Freshwater Wetlands | MRWVPYVLFPKAGWFVLHAAAITLVFLLGYSVRF* |
| Ga0153916_110361142 | 3300012964 | Freshwater Wetlands | MNRWLSYVLFPRPGWFILHATVIVLVFLLGYSVKF* |
| Ga0153916_118099862 | 3300012964 | Freshwater Wetlands | MNRWLPHILFPRPGWFILHAAVIGLVFLLGYSVKF* |
| Ga0163200_10359063 | 3300013088 | Freshwater | MNRWLPHILYPRPGWFILHAIAIVLVFLLGYVVKF* |
| Ga0163200_10375632 | 3300013088 | Freshwater | MNRWLPYVLYRRPGWFILHAAVIVLVFLLGYSVKF* |
| Ga0163199_11014562 | 3300013092 | Freshwater | MNRWLPYVLFPRPGWFILHGAVIVLVFLLGYSVKF* |
| (restricted) Ga0172374_10097173 | 3300013122 | Freshwater | MNRWLPHVLFPRPGWFILHGAIIVLVFLLGYSVKF* |
| (restricted) Ga0172369_101920852 | 3300013125 | Freshwater | MNRWLPHVLFPRPGWFILHGAVIVLVFLLGYSVKF* |
| (restricted) Ga0172370_102252482 | 3300013136 | Freshwater | MIKYFQYVLFPQPGWFILHGLAITLIFLLGYSVKF* |
| (restricted) Ga0172375_100295252 | 3300013137 | Freshwater | MNRWLPYVLFPRPGWFILHAVAVTLVFCLGYVVKF* |
| (restricted) Ga0172375_100418071 | 3300013137 | Freshwater | MMNRWLPHVLFPRPGWFILHGAVIVLVFLLGYSVKF* |
| (restricted) Ga0172375_103095202 | 3300013137 | Freshwater | MNRWLPYVLFPRPGWFVLHGAAIILVFLLGYTVRF* |
| (restricted) Ga0172375_105541322 | 3300013137 | Freshwater | MNRWLPYVLFPRPGWFILHAIVITLVFCLGYVVKF* |
| (restricted) Ga0172375_109455222 | 3300013137 | Freshwater | MNRWLPYILFPKPGWFILHAVAMALIFSLGYVVKC* |
| (restricted) Ga0172371_100763253 | 3300013138 | Freshwater | MNRWLPYVLFPRPGWFVLHAVAITLVFFLGYSVHF* |
| Ga0075308_10729732 | 3300014264 | Natural And Restored Wetlands | MIRWLPHVLFPRPGWFILHAAVIALVFLLGYSVKF* |
| Ga0075308_11096022 | 3300014264 | Natural And Restored Wetlands | MNRWLPHVLFPRPGWFILHAVVITLVFLLGYSVKF* |
| Ga0075340_10604131 | 3300014304 | Natural And Restored Wetlands | MMNRWLPHVLFPRPGWFILHAVVIVLVFLLGYSVKF* |
| Ga0075346_10925302 | 3300014306 | Natural And Restored Wetlands | MMNRWLPHVLFPRPGWFILHAAVIVLVFLLGYSVKF* |
| Ga0075339_12610072 | 3300014316 | Natural And Restored Wetlands | MNRWLPHVLFPRHGWFILHAAAIVLVFLLGYSVKF* |
| Ga0075348_11214942 | 3300014319 | Natural And Restored Wetlands | MMNRWLPQVLFPRPGWFILHAAAIVLVFLLGYSVKF* |
| Ga0182010_102111722 | 3300014490 | Fen | MNRWLPHVLFPRPGWFILHAAAIVLVFLLGCSVKF* |
| Ga0182010_102634482 | 3300014490 | Fen | MNRWLPHILYPRPGWFILHAAAIVLVFLLGYSVKF* |
| Ga0182010_103418432 | 3300014490 | Fen | MNRWLPYVLYPRPGWFILHAAVIVLVFLLGYSVKF* |
| Ga0182021_113223341 | 3300014502 | Fen | MNRWLPHVLFPRPGWFILHAAAIILVFLLGYSVKF* |
| Ga0182021_115160162 | 3300014502 | Fen | MNRWLPHVLFSRPGWFILHAAVIVLVFLLGYSVKF* |
| Ga0182021_119702032 | 3300014502 | Fen | MNRWLPLVLYPRPGWFILHAAVIVLVFLLGYSVKF* |
| Ga0187779_113859831 | 3300017959 | Tropical Peatland | MNRWLPYFLFPRSLWFVWHAAVITLVFLLGYSVNFGG |
| Ga0187776_115112062 | 3300017966 | Tropical Peatland | GGSQGRMKMRWVPYVLFPKAGWFVLHAAAVTLVFLLGYSVRF |
| Ga0184616_100127954 | 3300018055 | Groundwater Sediment | MLRLVPYILFPRPGWFILHAAAVALVFLLGYSVKF |
| Ga0184616_100502362 | 3300018055 | Groundwater Sediment | MNRWLPYVLFPRPGWFILHAAAIILVFLLGYSVKF |
| Ga0187773_101637123 | 3300018064 | Tropical Peatland | MARWIAYVLFPRPGWFILHATVIALVFLLGYSVKF |
| Ga0194113_100064273 | 3300020074 | Freshwater Lake | MNRWLPHVLFPRPGWFILHAIVIVLVFLLGYSVKF |
| Ga0212124_100481453 | 3300022553 | Freshwater | MNRWLPHILYPRPGWFILHAIAIVLVFLLGYVVKF |
| Ga0236337_11626421 | 3300022653 | Freshwater | MNRWLPYVLYPRPGWFFLHAAVIALVFLLGYSVKF |
| Ga0124853_13122031 | 3300024056 | Freshwater Wetlands | MNRWLPQVLFPRPGWFILHAAAIVLVFLLGYSVKF |
| Ga0210056_11326331 | 3300025022 | Groundwater | MNRWLSYILYPRPGWLILHAIAIVLVFLLGYSVKF |
| Ga0210024_10498472 | 3300025031 | Aquifer | MNRWLPHILYPRPGWLILHAIAIVLVFLLGYSVKF |
| Ga0208953_11053671 | 3300025081 | Groundwater | MNRWLPYVLHPRPGWFILHAAAIVLVFLLGYSVRF |
| Ga0209498_10667853 | 3300025135 | Sediment | VNRWLPHVLFPRPGWFILHAAAMVLVFLLGYSVKF |
| Ga0210120_10576462 | 3300025556 | Natural And Restored Wetlands | MNRWLPHVLFPRPGWFILHAVIIVLVFLLGYSVKF |
| Ga0209638_11993412 | 3300025725 | Arctic Peat Soil | MNRWLPHVLFPRPGWFILHAAAIVLVFLLGYSVKF |
| Ga0209182_100976552 | 3300025843 | Lake Sediment | MNRWLPYVLYLRPGWFILHAAVIGLVFLLGYSVKF |
| Ga0209182_101491791 | 3300025843 | Lake Sediment | MNRWLPHVLFPRPGWFILHAAVIVLVFLLGYSVKF |
| Ga0210088_10602032 | 3300025948 | Natural And Restored Wetlands | MNRWLPYILFPRPGWFILHAAAIVLVFLLGYSVKF |
| Ga0210077_10184823 | 3300025952 | Natural And Restored Wetlands | MNRWLPYILFPRPGWFVLHAIAVALVFLLGYSVEF |
| Ga0210077_10750062 | 3300025952 | Natural And Restored Wetlands | MNRWVPYILFPRPGWFVLHAVAIALVFLLGYSVEF |
| Ga0210079_10699372 | 3300025995 | Natural And Restored Wetlands | MMNRWLPHVLFPRPGWFILHGVIIILVFLLGYSVKF |
| Ga0207764_1256982 | 3300026839 | Tropical Forest Soil | MNRWLPFILFPRPGWFVLHAIVITLVLLLGYSVEF |
| Ga0207823_1109232 | 3300026860 | Tropical Forest Soil | MNRWLPFILFPRPGWFILHAAAITLVFLLGYSVKF |
| Ga0214474_12260301 | 3300027740 | Soil | MLRLVPYVLFPRPGWFILHAAAIALVFLLGYSVSF |
| Ga0207433_1000229229 | 3300027863 | Hot Spring | MNRWLPYILFPRPGWFILHGAAIALVFLLGYSMEF |
| Ga0209450_100342723 | 3300027885 | Freshwater Lake Sediment | MNRWLPHVLFPRPGWFVLHAAVIALVFLLGYSVKF |
| Ga0209254_102363402 | 3300027897 | Freshwater Lake Sediment | MNRWLPHVLFPRPGWFILHGAVIVLVFLLGYSVKF |
| Ga0209254_108468772 | 3300027897 | Freshwater Lake Sediment | MNRWLPHILYPRPGWFILHAIAMVLVFLLGYVVKY |
| Ga0209254_109161092 | 3300027897 | Freshwater Lake Sediment | MNRWLPHVLYLRSGWFILHAAVIVLVFLLGYSVKF |
| Ga0209253_104769601 | 3300027900 | Freshwater Lake Sediment | MNRWLPHVLFPRPGWFILHAAVIGLVFLLGYSVKF |
| Ga0209048_100753332 | 3300027902 | Freshwater Lake Sediment | MNRWLPYVLFPRPGWFILHGAAIALVFLLGYSVRF |
| Ga0209048_104479212 | 3300027902 | Freshwater Lake Sediment | MNRWLPYVLFPRPGWFILHGAVIVLVFLLGYSVKF |
| Ga0265296_1000028214 | 3300028032 | Groundwater | MNRWLPYVLFPRPGWYILHAIIITLVFCLGYVVKF |
| Ga0268277_10603991 | 3300028168 | Saline Water | MNRWLSPVLFPRPGWFILHAAVIVLVFLLGYSVKF |
| Ga0268276_10833463 | 3300028299 | Saline Water | MNRWLPHVLFPRPGWFILHAAVIVLVFLLGCSVKF |
| Ga0265297_100048434 | 3300029288 | Landfill Leachate | MNRWLTHVLFPRPGWFILHAAAIALLFGLGYVVKF |
| Ga0272380_108100111 | 3300029959 | Bioremediated Contaminated Groundwater | MHRWLPHVLFPRPGWFVLHAAAIVLVFLLGYSVKF |
| Ga0315554_11305433 | 3300031255 | Salt Marsh Sediment | MNRWLPYVLFPRPGWFILHGTAIALIFLLGYAVEF |
| Ga0307441_10666802 | 3300031276 | Salt Marsh | MNRWLPYVLFPRPGWFILHAVIITLLFFLGYAVRF |
| Ga0315542_10162463 | 3300031552 | Salt Marsh Sediment | MNRWLPRILFPRPGWFILHAIAIALVFGLGYVVKF |
| Ga0315542_10372781 | 3300031552 | Salt Marsh Sediment | MNRWLPYVLFPRPGWFILHAIIITLLFFLGYAVRF |
| Ga0315542_11008611 | 3300031552 | Salt Marsh Sediment | MNRWLPYVLFPRPGWFILHAIIITLIFFLGLAVRF |
| Ga0315535_12026102 | 3300031699 | Salt Marsh Sediment | MNRWLPRILFPRPGWFILHAAAIALVFGLGYVVKF |
| Ga0315298_11837832 | 3300031749 | Hot Spring Microbial Mat | MNRWLPHVLFPRPGWFILHAIIIALVFFLGYSVRF |
| Ga0315288_114267511 | 3300031772 | Sediment | MNRWLPLVLFPRPGWFILHAIAIVLVFLLGYVVNF |
| Ga0315290_105028591 | 3300031834 | Sediment | MNPWLPHILYPRPGWFILHAIAIVLVFLLGYSVKF |
| Ga0315290_106558662 | 3300031834 | Sediment | MNRWLPLVLFPRPGWFILHAIAIVLVFLLGYVVKF |
| Ga0315290_112396702 | 3300031834 | Sediment | MNRWLPYVLFPRPGWFILHGAVIVLVFLLGYVVKF |
| Ga0214473_105356162 | 3300031949 | Soil | MNRWLPHVLFPRPGWFILHAAAIILVFLLGYSVEF |
| Ga0315278_115224601 | 3300031997 | Sediment | MNRWLPYVLFPRPGWFILHAIAIVLVFLLGYVVKF |
| Ga0315292_111676822 | 3300032143 | Sediment | MNRWLPHILYLRPGWFILHAIAIVLVFLLGYVVKF |
| Ga0315295_100145933 | 3300032156 | Sediment | MNRWLPYVLFPRPGWFILHAAVIVLVFLLGYSVKF |
| Ga0315281_110500282 | 3300032163 | Sediment | MNRWLPYVLFPRPGWFILHAIAIVLVFLLGYSVKF |
| Ga0315281_114797922 | 3300032163 | Sediment | MNRWLPYVLFPRPGWFILHAIVIVLVFLLGYSVKF |
| Ga0315281_116368042 | 3300032163 | Sediment | MHRWLPHILYPRPGWFILHAIVIVMVFLLGYSVKF |
| Ga0315281_116832472 | 3300032163 | Sediment | MLRLIPYILFPRPGWFILHAAAIGLLFWLGYSIDFAPPP |
| Ga0315283_106366002 | 3300032164 | Sediment | MNRWLPHVLYPRPGWFILHGAAIVLVFLLGYVVKF |
| Ga0316593_103353632 | 3300032168 | Rhizosphere | MNRWLPYVLFPRPGWFILHGVAIILIFLLGYGVEF |
| Ga0315268_100874553 | 3300032173 | Sediment | MIKYIPYILYPRVGWFILHAAAVGFAFFIGYTVKF |
| Ga0315268_104402232 | 3300032173 | Sediment | MNRWLPHILYPRPGWFILHAIAIVLVFLLGYIVKF |
| Ga0315268_106909921 | 3300032173 | Sediment | MMNRWLPHVLYPRPGWFILQTAVIVLVFLLGYSVKF |
| Ga0315268_121400431 | 3300032173 | Sediment | MNRWLPHVLFPRPGWFILHAVVIVLVFLLGYSVKF |
| Ga0315268_125266271 | 3300032173 | Sediment | MMNRWLPHILFPRPGWFILHAVAIVLVFCLGYSVKF |
| Ga0315276_100869442 | 3300032177 | Sediment | MNRWLPYMLFPRPGWFILHAAVIVLVFLLGYSVKF |
| Ga0315276_111419742 | 3300032177 | Sediment | MNRWLPLVLFPRPGWFILHAIAIVLVFLLGYSVKF |
| Ga0315271_100425334 | 3300032256 | Sediment | MNRWLPYVMFPRPGWFILHATVIALLFFLGYSVKF |
| Ga0315271_100910883 | 3300032256 | Sediment | MNRWLPYVLYPLPGWFILHAAAIVLVFLLGYSVKF |
| Ga0315271_118109132 | 3300032256 | Sediment | MNRWLPYVLFPRPGWFILHAAVIGLVFLLGYSVKF |
| Ga0315287_102961971 | 3300032397 | Sediment | MNRWLPYVLYPRPGWFILHAAVIVLVFLLGYSVKF |
| Ga0315287_109291522 | 3300032397 | Sediment | MNRWLPHVLYPRPGWFILHGAVIVLVFLLGYAVKF |
| Ga0315275_106802921 | 3300032401 | Sediment | MNRWLPYVLFPRPGWFILHGAVIVLVFLLGFSVKF |
| Ga0315273_121322421 | 3300032516 | Sediment | AMNRWLPYVLFPRPGWFILHGAVIVLVFLLGYVVKF |
| Ga0316622_1009274862 | 3300033416 | Soil | MNRWLPYVLFPRPGWFILHAALIVLVFLLGYAVKF |
| Ga0316620_108184842 | 3300033480 | Soil | MNRWLPYVLFPRPGWFVLHAIIITLVFCLGYVVKF |
| Ga0316624_101883454 | 3300033486 | Soil | MNRWLPYVLFPRPGWFILHAIIITLVFSLGYVVKF |
| Ga0299912_104871061 | 3300033489 | Soil | MLRLVPYVLFPRPGWFILHAAAIALVFLLGYSVRF |
| Ga0316628_1011615812 | 3300033513 | Soil | MNRWLPYVLYPRPGWFILHAAAIALVFLLGYSVKF |
| ⦗Top⦘ |