Metagenome / Metatranscriptome Family F053932

Basic Information
Family ID	F053932
Family Type	Metagenome / Metatranscriptome
Number of Sequences	140
Average Sequence Length	35 residues
Representative Sequence	MNRWLPYVLFPRPGWFILHAAVIVLVFLLGYSVKF
Number of Associated Samples	101
Number of Associated Scaffolds	140

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	95.00 %
% of genes near scaffold ends (potentially truncated)	2.86 %
% of genes from short scaffolds (< 2000 bps)	83.57 %
Associated GOLD sequencing projects	93
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.44

Most Common Taxonomy
Group	Bacteria (93.571 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (18.571 % of family members)
Environment Ontology (ENVO)	Unclassified (30.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (29.286 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 39.68% β-sheet: 0.00% Coil/Unstructured: 60.32%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 140 Family Scaffolds
PF10120	ThiP_synth	10.00
PF01553	Acyltransferase	8.57
PF00266	Aminotran_5	3.57
PF00300	His_Phos_1	1.43
PF01381	HTH_3	0.71
PF01343	Peptidase_S49	0.71
PF02811	PHP	0.71
PF01479	S4	0.71
PF00478	IMPDH	0.71
PF02281	Dimer_Tnp_Tn5	0.71
PF04055	Radical_SAM	0.71
PF06050	HGD-D	0.71
PF04316	FlgM	0.71
PF00005	ABC_tran	0.71
PF01636	APH	0.71
PF08245	Mur_ligase_M	0.71

COG ID	Name	Functional Category	% Frequency in 140 Family Scaffolds
COG2747	Negative regulator of flagellin synthesis (anti-sigma28 factor)	Transcription [K]	2.14
COG0616	Periplasmic serine protease, ClpP class	Posttranslational modification, protein turnover, chaperones [O]	1.43
COG1775	Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA dehydratase subunit, BcrC/BadD/HgdB	Amino acid transport and metabolism [E]	0.71

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	93.57 %
Unclassified	root	N/A	6.43 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	93.57 %
Unclassified	root	N/A	6.43 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	93.57 %
Unclassified	root	N/A	6.43 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	92.86 %
Unclassified	root	N/A	6.43 %

Name	Rank	Taxonomy	Distribution
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	92.14 %
Unclassified	root	N/A	6.43 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	92.14 %
Unclassified	root	N/A	6.43 %

Name	Rank	Taxonomy	Distribution
Syntrophobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	13.57 %
Unclassified	root	N/A	6.43 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	1.43 %

Name	Rank	Taxonomy	Distribution
Syntrophaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae	13.57 %
Unclassified	root	N/A	6.43 %
Deltaproteobacteria bacterium CG07_land_8_20_14_0_80_60_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium CG07_land_8_20_14_0_80_60_11	0.71 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.71 %

Name	Rank	Taxonomy	Distribution
Desulfobacca	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	10.00 %
Unclassified	root	N/A	6.43 %
Deltaproteobacteria bacterium CG07_land_8_20_14_0_80_60_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium CG07_land_8_20_14_0_80_60_11	0.71 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.71 %

Name	Rank	Taxonomy	Distribution
Desulfobacca acetoxidans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans	9.29 %
Unclassified	root	N/A	6.43 %
unclassified Desulfobacca	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → unclassified Desulfobacca	0.71 %
Deltaproteobacteria bacterium CG07_land_8_20_14_0_80_60_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium CG07_land_8_20_14_0_80_60_11	0.71 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.71 %

Name	Rank	Taxonomy	Distribution
Desulfobacca acetoxidans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans	9.29 %
Unclassified	root	N/A	6.43 %
Desulfobacca sp. RBG_16_60_12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → unclassified Desulfobacca → Desulfobacca sp. RBG_16_60_12	0.71 %
Deltaproteobacteria bacterium CG07_land_8_20_14_0_80_60_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium CG07_land_8_20_14_0_80_60_11	0.71 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.71 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000231\|TB_LI09_4DRAFT_10184958	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	686	Open in IMG/M
3300000232\|TB_PC08_64DRAFT_1034302	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1336	Open in IMG/M
3300000312\|WSSedB2BaDRAFT_1020807	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	519	Open in IMG/M
3300000734\|JGI12535J11911_1008833	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans	877	Open in IMG/M
3300001213\|JGIcombinedJ13530_100016626	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1081	Open in IMG/M
3300001213\|JGIcombinedJ13530_100390186	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	760	Open in IMG/M
3300001213\|JGIcombinedJ13530_101548664	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	718	Open in IMG/M
3300001213\|JGIcombinedJ13530_108487543	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	510	Open in IMG/M
3300001213\|JGIcombinedJ13530_109566592	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1512	Open in IMG/M
3300001580\|Draft_10034964	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae	3453	Open in IMG/M
3300005573\|Ga0078972_1004449	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans	38310	Open in IMG/M
3300005645\|Ga0077109_1115608	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	709	Open in IMG/M
3300005832\|Ga0074469_10085169	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	543	Open in IMG/M
3300005947\|Ga0066794_10081468	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	964	Open in IMG/M
3300006795\|Ga0075520_1361446	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	590	Open in IMG/M
3300007965\|Ga0100401_1023850	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans	3685	Open in IMG/M
3300008001\|Ga0100389_1268879	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	765	Open in IMG/M
3300008008\|Ga0100399_1222269	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	723	Open in IMG/M
3300008086\|Ga0100388_10581718	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	503	Open in IMG/M
3300009031\|Ga0103682_10290844	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	846	Open in IMG/M
3300009039\|Ga0105152_10115069	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1095	Open in IMG/M
3300009078\|Ga0105106_11119156	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	559	Open in IMG/M
3300009082\|Ga0105099_10138704	Not Available	1363	Open in IMG/M
3300009091\|Ga0102851_10976860	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	919	Open in IMG/M
3300009111\|Ga0115026_10886368	Not Available	704	Open in IMG/M
3300009111\|Ga0115026_11692360	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	533	Open in IMG/M
3300009131\|Ga0115027_11625571	Not Available	535	Open in IMG/M
3300009146\|Ga0105091_10190945	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	972	Open in IMG/M
3300009166\|Ga0105100_10666610	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	640	Open in IMG/M
3300009167\|Ga0113563_12166752	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	667	Open in IMG/M
3300009167\|Ga0113563_12752837	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	595	Open in IMG/M
3300009388\|Ga0103809_1031027	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	736	Open in IMG/M
3300009504\|Ga0114946_10091415	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans	1706	Open in IMG/M
3300010391\|Ga0136847_11177378	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	674	Open in IMG/M
3300011408\|Ga0137460_1122915	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	517	Open in IMG/M
3300012931\|Ga0153915_12855111	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	564	Open in IMG/M
3300012964\|Ga0153916_10824334	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1008	Open in IMG/M
3300012964\|Ga0153916_11036114	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	901	Open in IMG/M
3300012964\|Ga0153916_11809986	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	683	Open in IMG/M
3300013088\|Ga0163200_1035906	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1497	Open in IMG/M
3300013088\|Ga0163200_1037563	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1463	Open in IMG/M
3300013092\|Ga0163199_1101456	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1212	Open in IMG/M
(restricted) 3300013122\|Ga0172374_1009717	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans	4960	Open in IMG/M
(restricted) 3300013125\|Ga0172369_10192085	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1179	Open in IMG/M
(restricted) 3300013136\|Ga0172370_10225248	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1145	Open in IMG/M
(restricted) 3300013137\|Ga0172375_10029525	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans	5902	Open in IMG/M
(restricted) 3300013137\|Ga0172375_10041807	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans	4631	Open in IMG/M
(restricted) 3300013137\|Ga0172375_10309520	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → unclassified Desulfobacca → Desulfobacca sp. RBG_16_60_12	1139	Open in IMG/M
(restricted) 3300013137\|Ga0172375_10554132	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	753	Open in IMG/M
(restricted) 3300013137\|Ga0172375_10945522	Not Available	517	Open in IMG/M
(restricted) 3300013138\|Ga0172371_10076325	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae	3271	Open in IMG/M
3300014264\|Ga0075308_1072973	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	702	Open in IMG/M
3300014264\|Ga0075308_1109602	Not Available	601	Open in IMG/M
3300014304\|Ga0075340_1060413	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	685	Open in IMG/M
3300014306\|Ga0075346_1092530	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	649	Open in IMG/M
3300014316\|Ga0075339_1261007	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	503	Open in IMG/M
3300014319\|Ga0075348_1121494	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	672	Open in IMG/M
3300014490\|Ga0182010_10211172	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1020	Open in IMG/M
3300014490\|Ga0182010_10263448	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	918	Open in IMG/M
3300014490\|Ga0182010_10341843	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	809	Open in IMG/M
3300014502\|Ga0182021_11322334	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	868	Open in IMG/M
3300014502\|Ga0182021_11516016	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	807	Open in IMG/M
3300014502\|Ga0182021_11970203	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	703	Open in IMG/M
3300017959\|Ga0187779_11385983	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans	500	Open in IMG/M
3300017966\|Ga0187776_11511206	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	516	Open in IMG/M
3300018055\|Ga0184616_10012795	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2437	Open in IMG/M
3300018055\|Ga0184616_10050236	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1392	Open in IMG/M
3300018064\|Ga0187773_10163712	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1158	Open in IMG/M
3300020074\|Ga0194113_10006427	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans	14917	Open in IMG/M
3300022553\|Ga0212124_10048145	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2532	Open in IMG/M
3300022653\|Ga0236337_1162642	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	828	Open in IMG/M
3300024056\|Ga0124853_1312203	All Organisms → cellular organisms → Bacteria	2390	Open in IMG/M
3300025022\|Ga0210056_1132633	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	936	Open in IMG/M
3300025031\|Ga0210024_1049847	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1621	Open in IMG/M
3300025081\|Ga0208953_1105367	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	605	Open in IMG/M
3300025135\|Ga0209498_1066785	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans	1560	Open in IMG/M
3300025556\|Ga0210120_1057646	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	760	Open in IMG/M
3300025725\|Ga0209638_1199341	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	605	Open in IMG/M
3300025843\|Ga0209182_10097655	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	828	Open in IMG/M
3300025843\|Ga0209182_10149179	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	655	Open in IMG/M
3300025948\|Ga0210088_1060203	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	603	Open in IMG/M
3300025952\|Ga0210077_1018482	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1494	Open in IMG/M
3300025952\|Ga0210077_1075006	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	701	Open in IMG/M
3300025995\|Ga0210079_1069937	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	574	Open in IMG/M
3300026839\|Ga0207764_125698	Not Available	514	Open in IMG/M
3300026860\|Ga0207823_110923	Not Available	627	Open in IMG/M
3300027740\|Ga0214474_1226030	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	677	Open in IMG/M
3300027863\|Ga0207433_10002292	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans	39132	Open in IMG/M
3300027885\|Ga0209450_10034272	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3013	Open in IMG/M
3300027897\|Ga0209254_10236340	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1437	Open in IMG/M
3300027897\|Ga0209254_10846877	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	614	Open in IMG/M
3300027897\|Ga0209254_10916109	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	581	Open in IMG/M
3300027900\|Ga0209253_10476960	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae	934	Open in IMG/M
3300027902\|Ga0209048_10075333	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2661	Open in IMG/M
3300027902\|Ga0209048_10447921	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	879	Open in IMG/M
3300028032\|Ga0265296_1000028	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	344084	Open in IMG/M
3300028168\|Ga0268277_1060399	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1048	Open in IMG/M
3300028299\|Ga0268276_1083346	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1103	Open in IMG/M
3300029288\|Ga0265297_10004843	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans	21372	Open in IMG/M
3300029959\|Ga0272380_10810011	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	589	Open in IMG/M
3300031255\|Ga0315554_1130543	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	893	Open in IMG/M
3300031276\|Ga0307441_1066680	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1095	Open in IMG/M
3300031552\|Ga0315542_1016246	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans	3492	Open in IMG/M
3300031552\|Ga0315542_1037278	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2063	Open in IMG/M
3300031552\|Ga0315542_1100861	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1098	Open in IMG/M
3300031699\|Ga0315535_1202610	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	697	Open in IMG/M
3300031749\|Ga0315298_1183783	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae	1071	Open in IMG/M
3300031772\|Ga0315288_11426751	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	578	Open in IMG/M
3300031834\|Ga0315290_10502859	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1058	Open in IMG/M
3300031834\|Ga0315290_10655866	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	907	Open in IMG/M
3300031834\|Ga0315290_11239670	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	617	Open in IMG/M
3300031949\|Ga0214473_10535616	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1302	Open in IMG/M
3300031997\|Ga0315278_11522460	Not Available	643	Open in IMG/M
3300032143\|Ga0315292_11167682	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	634	Open in IMG/M
3300032156\|Ga0315295_10014593	All Organisms → cellular organisms → Bacteria → Proteobacteria	6889	Open in IMG/M
3300032163\|Ga0315281_11050028	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	823	Open in IMG/M
3300032163\|Ga0315281_11479792	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	666	Open in IMG/M
3300032163\|Ga0315281_11636804	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	626	Open in IMG/M
3300032163\|Ga0315281_11683247	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	616	Open in IMG/M
3300032164\|Ga0315283_10636600	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1153	Open in IMG/M
3300032168\|Ga0316593_10335363	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	577	Open in IMG/M
3300032173\|Ga0315268_10087455	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2936	Open in IMG/M
3300032173\|Ga0315268_10440223	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1280	Open in IMG/M
3300032173\|Ga0315268_10690992	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1017	Open in IMG/M
3300032173\|Ga0315268_12140043	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	573	Open in IMG/M
3300032173\|Ga0315268_12526627	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	527	Open in IMG/M
3300032177\|Ga0315276_10086944	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae	3150	Open in IMG/M
3300032177\|Ga0315276_11141974	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	823	Open in IMG/M
3300032256\|Ga0315271_10042533	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3248	Open in IMG/M
3300032256\|Ga0315271_10091088	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2299	Open in IMG/M
3300032256\|Ga0315271_11810913	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	524	Open in IMG/M
3300032397\|Ga0315287_10296197	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1906	Open in IMG/M
3300032397\|Ga0315287_10929152	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1016	Open in IMG/M
3300032401\|Ga0315275_10680292	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium CG07_land_8_20_14_0_80_60_11	1145	Open in IMG/M
3300032516\|Ga0315273_12132242	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	660	Open in IMG/M
3300033416\|Ga0316622_100927486	Not Available	1015	Open in IMG/M
3300033480\|Ga0316620_10818484	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	895	Open in IMG/M
3300033486\|Ga0316624_10188345	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1584	Open in IMG/M
3300033489\|Ga0299912_10487106	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	994	Open in IMG/M
3300033513\|Ga0316628_101161581	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1027	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	96.43%
Engineered	Engineered	2.86%
Host-Associated	Host-Associated	0.71%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	76.43%
Terrestrial	Environmental → Terrestrial	20.00%
Plants	Host-Associated → Plants	0.71%
Solid Waste	Engineered → Solid Waste	0.71%
Wastewater	Engineered → Wastewater	0.71%
Lab Enrichment	Engineered → Lab Enrichment	0.71%
Bioremediation	Engineered → Bioremediation	0.71%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	57.14%
Soil	Environmental → Terrestrial → Soil	20.00%
Marine	Environmental → Aquatic → Marine	12.14%
Sediment	Environmental → Aquatic → Sediment	2.86%
Thermal Springs	Environmental → Aquatic → Thermal Springs	2.14%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	2.14%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.71%
Landfill	Engineered → Solid Waste → Landfill	0.71%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	0.71%
Defined Media	Engineered → Lab Enrichment → Defined Media	0.71%
Tetrachloroethylene And Derivatives	Engineered → Bioremediation → Tetrachloroethylene And Derivatives	0.71%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	32.14%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	14.29%
Wetlands	Environmental → Aquatic → Marine → Wetlands	7.86%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	7.14%
Sediment	Environmental → Aquatic → Freshwater → Sediment	6.43%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	5.71%
Lentic	Environmental → Aquatic → Freshwater → Lentic	5.00%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	4.29%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	3.57%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.86%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	2.14%
Saline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline	2.14%
Loam	Environmental → Terrestrial → Soil → Loam	2.14%
Drinking Water	Environmental → Aquatic → Freshwater → Drinking Water	0.71%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.71%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified	0.71%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	0.71%
Anaerobic Media	Engineered → Lab Enrichment → Defined Media → Anaerobic Media	0.71%
Tetrachloroethylene	Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene	0.71%

Habitat	Taxonomy	Distribution
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	21.43%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	10.71%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	9.29%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	6.43%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	5.71%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	5.71%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	5.00%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	5.00%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	4.29%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	4.29%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	3.57%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.86%
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	2.14%
Unclassified	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified	2.14%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	2.14%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.14%
Cave Water	Environmental → Aquatic → Freshwater → Groundwater → Cave Water	1.43%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	1.43%
Chlorinated	Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated	0.71%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.71%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified → Unclassified	0.71%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	0.71%
Unclassified	Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified	0.71%
Unclassified	Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified	0.71%

Habitat	Taxonomy	Distribution
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	18.57%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	9.29%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	5.00%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	4.29%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	4.29%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	4.29%
Aquifer	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer	3.57%
Salt Marsh Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment	3.57%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	3.57%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	2.86%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	2.86%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	2.86%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	2.86%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	2.14%
Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment	2.14%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	2.14%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	2.14%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.14%
Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment	1.43%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	1.43%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater	1.43%
Hot Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring	1.43%
Saline Water	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water	1.43%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.43%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	1.43%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.71%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.71%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	0.71%
Groundwater	Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater	0.71%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	0.71%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.71%
Hot Spring Microbial Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Microbial Mat	0.71%
Brackish Water	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Brackish Water	0.71%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.71%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.71%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.71%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.71%
Landfill Leachate	Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate	0.71%
Hydrocarbon Resource Environments	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments	0.71%
Enrichment Culture	Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture	0.71%
Bioremediated Contaminated Groundwater	Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater	0.71%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000231	Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4	Environmental	Open in IMG/M
3300000232	Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_64	Environmental	Open in IMG/M
3300000312	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B2 Bulk	Environmental	Open in IMG/M
3300000734	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81	Environmental	Open in IMG/M
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental	Open in IMG/M
3300001580	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6	Engineered	Open in IMG/M
3300005573	Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPADES assembly)	Environmental	Open in IMG/M
3300005645	Brackish water microbial communities from Lake Sakinaw in Canada: eDNA_2 (120m)	Environmental	Open in IMG/M
3300005832	Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB	Environmental	Open in IMG/M
3300005947	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190	Environmental	Open in IMG/M
3300006795	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B	Environmental	Open in IMG/M
3300007965	Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-25	Environmental	Open in IMG/M
3300008001	Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-13	Environmental	Open in IMG/M
3300008008	Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-23	Environmental	Open in IMG/M
3300008086	Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-12	Environmental	Open in IMG/M
3300009031	Microbial communities from groundwater in Rifle, Colorado, USA - 3D_0.1um	Environmental	Open in IMG/M
3300009039	Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm	Environmental	Open in IMG/M
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009082	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009091	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental	Open in IMG/M
3300009131	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1	Environmental	Open in IMG/M
3300009146	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015	Environmental	Open in IMG/M
3300009166	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009388	Metatranscriptome sequencing of an Anaerobic Hexadecane-Degrading Microbial Consortia from University of California, San Diego, USA - Hexadecane	Engineered	Open in IMG/M
3300009504	Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment	Environmental	Open in IMG/M
3300010391	Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406	Environmental	Open in IMG/M
3300011408	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT723_2	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012964	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG	Environmental	Open in IMG/M
3300013088	Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_200m	Environmental	Open in IMG/M
3300013092	Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m	Environmental	Open in IMG/M
3300013122 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m	Environmental	Open in IMG/M
3300013125 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m	Environmental	Open in IMG/M
3300013136 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5m	Environmental	Open in IMG/M
3300013137 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m	Environmental	Open in IMG/M
3300013138 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m	Environmental	Open in IMG/M
3300014264	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rd	Environmental	Open in IMG/M
3300014304	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1	Environmental	Open in IMG/M
3300014306	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D1	Environmental	Open in IMG/M
3300014316	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1	Environmental	Open in IMG/M
3300014319	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1	Environmental	Open in IMG/M
3300014490	Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG	Environmental	Open in IMG/M
3300014502	Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental	Open in IMG/M
3300018055	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex	Environmental	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300020074	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m	Environmental	Open in IMG/M
3300022553	Powell_combined assembly	Environmental	Open in IMG/M
3300022653	Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W1	Environmental	Open in IMG/M
3300024056	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction)	Environmental	Open in IMG/M
3300025022	Groundwater microbial communities from aquifer - Crystal Geyser CG07_land_8/20/14_0.80 (SPAdes)	Environmental	Open in IMG/M
3300025031	Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-25 (SPAdes)	Environmental	Open in IMG/M
3300025081	Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection B2 (SPAdes)	Environmental	Open in IMG/M
3300025135	Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment (SPAdes)	Environmental	Open in IMG/M
3300025556	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes)	Environmental	Open in IMG/M
3300025725	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes)	Environmental	Open in IMG/M
3300025843	Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes)	Environmental	Open in IMG/M
3300025948	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D2 (SPAdes)	Environmental	Open in IMG/M
3300025952	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025995	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordA_D2 (SPAdes)	Environmental	Open in IMG/M
3300026839	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 52 (SPAdes)	Environmental	Open in IMG/M
3300026860	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 70 (SPAdes)	Environmental	Open in IMG/M
3300027740	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeq	Environmental	Open in IMG/M
3300027863	Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes)	Environmental	Open in IMG/M
3300027885	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)	Environmental	Open in IMG/M
3300027897	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)	Environmental	Open in IMG/M
3300027900	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)	Environmental	Open in IMG/M
3300027902	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)	Environmental	Open in IMG/M
3300028032	Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1	Environmental	Open in IMG/M
3300028168	Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_50m	Environmental	Open in IMG/M
3300028299	Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_45m	Environmental	Open in IMG/M
3300029288	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91	Engineered	Open in IMG/M
3300029959	EPA Superfund site combined assembly	Engineered	Open in IMG/M
3300031255	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-70	Environmental	Open in IMG/M
3300031276	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-20	Environmental	Open in IMG/M
3300031552	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-20	Environmental	Open in IMG/M
3300031699	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-20	Environmental	Open in IMG/M
3300031749	Extremophilic microbial mat communities from Washburn Hot Springs, YNP, Wyoming, USA - WHS_1_MG	Environmental	Open in IMG/M
3300031772	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20	Environmental	Open in IMG/M
3300031834	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0	Environmental	Open in IMG/M
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental	Open in IMG/M
3300031997	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0	Environmental	Open in IMG/M
3300032143	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0	Environmental	Open in IMG/M
3300032156	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0	Environmental	Open in IMG/M
3300032163	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0	Environmental	Open in IMG/M
3300032164	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0	Environmental	Open in IMG/M
3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032173	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top	Environmental	Open in IMG/M
3300032177	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0	Environmental	Open in IMG/M
3300032256	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300032401	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M
3300033416	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C	Environmental	Open in IMG/M
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental	Open in IMG/M
3300033486	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A	Environmental	Open in IMG/M
3300033489	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.44
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.44
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F053932

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
TB_LI09_4DRAFT_101849582	3300000231	Groundwater	MNRWLPYVLFPRPGWFILHAAVIALVFLLGYSVKF*
TB_PC08_64DRAFT_10343023	3300000232	Groundwater	MNRWLPHVLFPRPGWFILHAIIIVLIFCLGYVVKF*
WSSedB2BaDRAFT_10208072	3300000312	Wetland	MNRWLPYVMFPRPGWFILHAAVIALIFFLGYSVKF*
JGI12535J11911_10088331	3300000734	Tropical Forest Soil	MNRWLPFILFPRPGWFVLHAIVITLVLLLGYSVEF*
JGIcombinedJ13530_1000166262	3300001213	Wetland	MNRWLPYILFPRPGWFVLHAVAIALVFLLGYSIEF*
JGIcombinedJ13530_1003901863	3300001213	Wetland	MNRWLPYILFPRPGWFILHAVAIASVFCLGFVVKF*
JGIcombinedJ13530_1015486643	3300001213	Wetland	MNRWLPHVLFPRPGWFVLHAIIIALVFCLGYVVKF*
JGIcombinedJ13530_1084875432	3300001213	Wetland	MNRWLPYVLFPRPGWFILHAIVIALIFSLGYVVKF*
JGIcombinedJ13530_1095665922	3300001213	Wetland	MLRLIPYVLFPRPGWFILHAAVIGLLFWLGYSIDFTPPP*
Draft_100349642	3300001580	Hydrocarbon Resource Environments	MNRWLPYVLHPRPGWFILHAAAIVLVFLLGYSVKF*
Ga0078972_100444929	3300005573	Hot Spring	MNRWLPYILFPRPGWFILHGAAIALVFLLGYSMEF*
Ga0077109_11156082	3300005645	Brackish Water	MNRWLSPVLFPRPGWFILHAAVIVLVFLLGYSVKF*
Ga0074469_100851693	3300005832	Sediment (Intertidal)	MNRWLPHVLFPRPGWFILHAAVIVLVFLLGYSVKF*
Ga0066794_100814682	3300005947	Soil	MNHWLPYVLYPRPGWFILHAAVIVLVFLLGYSVKF*
Ga0075520_13614461	3300006795	Arctic Peat Soil	MNRWLPLVLYPRPGWFILHAAAIVLVFLLGYSVKF*
Ga0100401_10238506	3300007965	Aquifer	MNRWLPHILYPRPGWLILHAIAIVLVFLLGYSVKF*
Ga0100389_12688792	3300008001	Aquifer	MNRWLSYILYPRPGWLILHAIAIVLVFLLGYSVKF*
Ga0100399_12222692	3300008008	Aquifer	MNRWLPYILYPRPGWLILHAIAIVLVFLLGYSVKF*
Ga0100388_105817182	3300008086	Aquifer	MNRWPPHILYPRPGWLILHAIAIVLVFLLGYSVKF*
Ga0103682_102908442	3300009031	Groundwater	MNRWLPHVLFPRPGWFILHAAAIVLVFLLGYSVRF*
Ga0105152_101150692	3300009039	Lake Sediment	MNRWLPYVLYLRPGWFILHAAVIGLVFLLGYSVKF*
Ga0105106_111191562	3300009078	Freshwater Sediment	MNRWLPHVLYPRPGWFILHAAVIVLVFLLGYSVKF*
Ga0105099_101387043	3300009082	Freshwater Sediment	MNRWLPHVLFPRPGWFILHGAIIALVFLLGYSVKF*
Ga0102851_109768602	3300009091	Freshwater Wetlands	MNRWLPHILFPRPGWFILHAAAIALVFLLGYSVKF*
Ga0115026_108863682	3300009111	Wetland	MNRWLPYVLFPRPGWFILHAALIVLVFLLGYAVKF*
Ga0115026_116923602	3300009111	Wetland	MNRWLPHVLFPRPGWFILHAAVIALVFLLGYSVKF*
Ga0115027_116255712	3300009131	Wetland	MNPWLPHVLFPRPGWFILHAAVIGLVFLLGYSVKF*
Ga0105091_101909451	3300009146	Freshwater Sediment	MNRWLPHVLFPRPGWYILHAAVIVLVFLLGYSVKF*
Ga0105100_106666102	3300009166	Freshwater Sediment	MNHWLPHVLYPRPGWFILHAAVIVLVFLLGYSVTF*
Ga0113563_121667521	3300009167	Freshwater Wetlands	MNRWLPHVLFPRPGWLLLHATAIVLVFLLGYSVKF*
Ga0113563_127528372	3300009167	Freshwater Wetlands	MNRWLPYVLFPRPGWFILHAAVIVPVFLLGYSVKF*
Ga0103809_10310272	3300009388	Enrichment Culture	MNRWLPHVLHPRPGWFILHAAAIVLVFLLGYSVRF*
Ga0114946_100914153	3300009504	Sediment	VNRWLPHVLFPRPGWFILHAAAMVLVFLLGYSVKF*
Ga0136847_111773781	3300010391	Freshwater Sediment	MLRLVPYILFPRPGWFILHAAAIALVFLLGYSAKF*
Ga0137460_11229151	3300011408	Soil	MNRWLPHVLYLRPGWFILHGAVIVLVFLLGYSVKF*
Ga0153915_128551112	3300012931	Freshwater Wetlands	MNRWLPYVLFPRPGWFILHATVIALVFLLGYSVKF*
Ga0153916_108243343	3300012964	Freshwater Wetlands	MRWVPYVLFPKAGWFVLHAAAITLVFLLGYSVRF*
Ga0153916_110361142	3300012964	Freshwater Wetlands	MNRWLSYVLFPRPGWFILHATVIVLVFLLGYSVKF*
Ga0153916_118099862	3300012964	Freshwater Wetlands	MNRWLPHILFPRPGWFILHAAVIGLVFLLGYSVKF*
Ga0163200_10359063	3300013088	Freshwater	MNRWLPHILYPRPGWFILHAIAIVLVFLLGYVVKF*
Ga0163200_10375632	3300013088	Freshwater	MNRWLPYVLYRRPGWFILHAAVIVLVFLLGYSVKF*
Ga0163199_11014562	3300013092	Freshwater	MNRWLPYVLFPRPGWFILHGAVIVLVFLLGYSVKF*
(restricted) Ga0172374_10097173	3300013122	Freshwater	MNRWLPHVLFPRPGWFILHGAIIVLVFLLGYSVKF*
(restricted) Ga0172369_101920852	3300013125	Freshwater	MNRWLPHVLFPRPGWFILHGAVIVLVFLLGYSVKF*
(restricted) Ga0172370_102252482	3300013136	Freshwater	MIKYFQYVLFPQPGWFILHGLAITLIFLLGYSVKF*
(restricted) Ga0172375_100295252	3300013137	Freshwater	MNRWLPYVLFPRPGWFILHAVAVTLVFCLGYVVKF*
(restricted) Ga0172375_100418071	3300013137	Freshwater	MMNRWLPHVLFPRPGWFILHGAVIVLVFLLGYSVKF*
(restricted) Ga0172375_103095202	3300013137	Freshwater	MNRWLPYVLFPRPGWFVLHGAAIILVFLLGYTVRF*
(restricted) Ga0172375_105541322	3300013137	Freshwater	MNRWLPYVLFPRPGWFILHAIVITLVFCLGYVVKF*
(restricted) Ga0172375_109455222	3300013137	Freshwater	MNRWLPYILFPKPGWFILHAVAMALIFSLGYVVKC*
(restricted) Ga0172371_100763253	3300013138	Freshwater	MNRWLPYVLFPRPGWFVLHAVAITLVFFLGYSVHF*
Ga0075308_10729732	3300014264	Natural And Restored Wetlands	MIRWLPHVLFPRPGWFILHAAVIALVFLLGYSVKF*
Ga0075308_11096022	3300014264	Natural And Restored Wetlands	MNRWLPHVLFPRPGWFILHAVVITLVFLLGYSVKF*
Ga0075340_10604131	3300014304	Natural And Restored Wetlands	MMNRWLPHVLFPRPGWFILHAVVIVLVFLLGYSVKF*
Ga0075346_10925302	3300014306	Natural And Restored Wetlands	MMNRWLPHVLFPRPGWFILHAAVIVLVFLLGYSVKF*
Ga0075339_12610072	3300014316	Natural And Restored Wetlands	MNRWLPHVLFPRHGWFILHAAAIVLVFLLGYSVKF*
Ga0075348_11214942	3300014319	Natural And Restored Wetlands	MMNRWLPQVLFPRPGWFILHAAAIVLVFLLGYSVKF*
Ga0182010_102111722	3300014490	Fen	MNRWLPHVLFPRPGWFILHAAAIVLVFLLGCSVKF*
Ga0182010_102634482	3300014490	Fen	MNRWLPHILYPRPGWFILHAAAIVLVFLLGYSVKF*
Ga0182010_103418432	3300014490	Fen	MNRWLPYVLYPRPGWFILHAAVIVLVFLLGYSVKF*
Ga0182021_113223341	3300014502	Fen	MNRWLPHVLFPRPGWFILHAAAIILVFLLGYSVKF*
Ga0182021_115160162	3300014502	Fen	MNRWLPHVLFSRPGWFILHAAVIVLVFLLGYSVKF*
Ga0182021_119702032	3300014502	Fen	MNRWLPLVLYPRPGWFILHAAVIVLVFLLGYSVKF*
Ga0187779_113859831	3300017959	Tropical Peatland	MNRWLPYFLFPRSLWFVWHAAVITLVFLLGYSVNFGG
Ga0187776_115112062	3300017966	Tropical Peatland	GGSQGRMKMRWVPYVLFPKAGWFVLHAAAVTLVFLLGYSVRF
Ga0184616_100127954	3300018055	Groundwater Sediment	MLRLVPYILFPRPGWFILHAAAVALVFLLGYSVKF
Ga0184616_100502362	3300018055	Groundwater Sediment	MNRWLPYVLFPRPGWFILHAAAIILVFLLGYSVKF
Ga0187773_101637123	3300018064	Tropical Peatland	MARWIAYVLFPRPGWFILHATVIALVFLLGYSVKF
Ga0194113_100064273	3300020074	Freshwater Lake	MNRWLPHVLFPRPGWFILHAIVIVLVFLLGYSVKF
Ga0212124_100481453	3300022553	Freshwater	MNRWLPHILYPRPGWFILHAIAIVLVFLLGYVVKF
Ga0236337_11626421	3300022653	Freshwater	MNRWLPYVLYPRPGWFFLHAAVIALVFLLGYSVKF
Ga0124853_13122031	3300024056	Freshwater Wetlands	MNRWLPQVLFPRPGWFILHAAAIVLVFLLGYSVKF
Ga0210056_11326331	3300025022	Groundwater	MNRWLSYILYPRPGWLILHAIAIVLVFLLGYSVKF
Ga0210024_10498472	3300025031	Aquifer	MNRWLPHILYPRPGWLILHAIAIVLVFLLGYSVKF
Ga0208953_11053671	3300025081	Groundwater	MNRWLPYVLHPRPGWFILHAAAIVLVFLLGYSVRF
Ga0209498_10667853	3300025135	Sediment	VNRWLPHVLFPRPGWFILHAAAMVLVFLLGYSVKF
Ga0210120_10576462	3300025556	Natural And Restored Wetlands	MNRWLPHVLFPRPGWFILHAVIIVLVFLLGYSVKF
Ga0209638_11993412	3300025725	Arctic Peat Soil	MNRWLPHVLFPRPGWFILHAAAIVLVFLLGYSVKF
Ga0209182_100976552	3300025843	Lake Sediment	MNRWLPYVLYLRPGWFILHAAVIGLVFLLGYSVKF
Ga0209182_101491791	3300025843	Lake Sediment	MNRWLPHVLFPRPGWFILHAAVIVLVFLLGYSVKF
Ga0210088_10602032	3300025948	Natural And Restored Wetlands	MNRWLPYILFPRPGWFILHAAAIVLVFLLGYSVKF
Ga0210077_10184823	3300025952	Natural And Restored Wetlands	MNRWLPYILFPRPGWFVLHAIAVALVFLLGYSVEF
Ga0210077_10750062	3300025952	Natural And Restored Wetlands	MNRWVPYILFPRPGWFVLHAVAIALVFLLGYSVEF
Ga0210079_10699372	3300025995	Natural And Restored Wetlands	MMNRWLPHVLFPRPGWFILHGVIIILVFLLGYSVKF
Ga0207764_1256982	3300026839	Tropical Forest Soil	MNRWLPFILFPRPGWFVLHAIVITLVLLLGYSVEF
Ga0207823_1109232	3300026860	Tropical Forest Soil	MNRWLPFILFPRPGWFILHAAAITLVFLLGYSVKF
Ga0214474_12260301	3300027740	Soil	MLRLVPYVLFPRPGWFILHAAAIALVFLLGYSVSF
Ga0207433_1000229229	3300027863	Hot Spring	MNRWLPYILFPRPGWFILHGAAIALVFLLGYSMEF
Ga0209450_100342723	3300027885	Freshwater Lake Sediment	MNRWLPHVLFPRPGWFVLHAAVIALVFLLGYSVKF
Ga0209254_102363402	3300027897	Freshwater Lake Sediment	MNRWLPHVLFPRPGWFILHGAVIVLVFLLGYSVKF
Ga0209254_108468772	3300027897	Freshwater Lake Sediment	MNRWLPHILYPRPGWFILHAIAMVLVFLLGYVVKY
Ga0209254_109161092	3300027897	Freshwater Lake Sediment	MNRWLPHVLYLRSGWFILHAAVIVLVFLLGYSVKF
Ga0209253_104769601	3300027900	Freshwater Lake Sediment	MNRWLPHVLFPRPGWFILHAAVIGLVFLLGYSVKF
Ga0209048_100753332	3300027902	Freshwater Lake Sediment	MNRWLPYVLFPRPGWFILHGAAIALVFLLGYSVRF
Ga0209048_104479212	3300027902	Freshwater Lake Sediment	MNRWLPYVLFPRPGWFILHGAVIVLVFLLGYSVKF
Ga0265296_1000028214	3300028032	Groundwater	MNRWLPYVLFPRPGWYILHAIIITLVFCLGYVVKF
Ga0268277_10603991	3300028168	Saline Water	MNRWLSPVLFPRPGWFILHAAVIVLVFLLGYSVKF
Ga0268276_10833463	3300028299	Saline Water	MNRWLPHVLFPRPGWFILHAAVIVLVFLLGCSVKF
Ga0265297_100048434	3300029288	Landfill Leachate	MNRWLTHVLFPRPGWFILHAAAIALLFGLGYVVKF
Ga0272380_108100111	3300029959	Bioremediated Contaminated Groundwater	MHRWLPHVLFPRPGWFVLHAAAIVLVFLLGYSVKF
Ga0315554_11305433	3300031255	Salt Marsh Sediment	MNRWLPYVLFPRPGWFILHGTAIALIFLLGYAVEF
Ga0307441_10666802	3300031276	Salt Marsh	MNRWLPYVLFPRPGWFILHAVIITLLFFLGYAVRF
Ga0315542_10162463	3300031552	Salt Marsh Sediment	MNRWLPRILFPRPGWFILHAIAIALVFGLGYVVKF
Ga0315542_10372781	3300031552	Salt Marsh Sediment	MNRWLPYVLFPRPGWFILHAIIITLLFFLGYAVRF
Ga0315542_11008611	3300031552	Salt Marsh Sediment	MNRWLPYVLFPRPGWFILHAIIITLIFFLGLAVRF
Ga0315535_12026102	3300031699	Salt Marsh Sediment	MNRWLPRILFPRPGWFILHAAAIALVFGLGYVVKF
Ga0315298_11837832	3300031749	Hot Spring Microbial Mat	MNRWLPHVLFPRPGWFILHAIIIALVFFLGYSVRF
Ga0315288_114267511	3300031772	Sediment	MNRWLPLVLFPRPGWFILHAIAIVLVFLLGYVVNF
Ga0315290_105028591	3300031834	Sediment	MNPWLPHILYPRPGWFILHAIAIVLVFLLGYSVKF
Ga0315290_106558662	3300031834	Sediment	MNRWLPLVLFPRPGWFILHAIAIVLVFLLGYVVKF
Ga0315290_112396702	3300031834	Sediment	MNRWLPYVLFPRPGWFILHGAVIVLVFLLGYVVKF
Ga0214473_105356162	3300031949	Soil	MNRWLPHVLFPRPGWFILHAAAIILVFLLGYSVEF
Ga0315278_115224601	3300031997	Sediment	MNRWLPYVLFPRPGWFILHAIAIVLVFLLGYVVKF
Ga0315292_111676822	3300032143	Sediment	MNRWLPHILYLRPGWFILHAIAIVLVFLLGYVVKF
Ga0315295_100145933	3300032156	Sediment	MNRWLPYVLFPRPGWFILHAAVIVLVFLLGYSVKF
Ga0315281_110500282	3300032163	Sediment	MNRWLPYVLFPRPGWFILHAIAIVLVFLLGYSVKF
Ga0315281_114797922	3300032163	Sediment	MNRWLPYVLFPRPGWFILHAIVIVLVFLLGYSVKF
Ga0315281_116368042	3300032163	Sediment	MHRWLPHILYPRPGWFILHAIVIVMVFLLGYSVKF
Ga0315281_116832472	3300032163	Sediment	MLRLIPYILFPRPGWFILHAAAIGLLFWLGYSIDFAPPP
Ga0315283_106366002	3300032164	Sediment	MNRWLPHVLYPRPGWFILHGAAIVLVFLLGYVVKF
Ga0316593_103353632	3300032168	Rhizosphere	MNRWLPYVLFPRPGWFILHGVAIILIFLLGYGVEF
Ga0315268_100874553	3300032173	Sediment	MIKYIPYILYPRVGWFILHAAAVGFAFFIGYTVKF
Ga0315268_104402232	3300032173	Sediment	MNRWLPHILYPRPGWFILHAIAIVLVFLLGYIVKF
Ga0315268_106909921	3300032173	Sediment	MMNRWLPHVLYPRPGWFILQTAVIVLVFLLGYSVKF
Ga0315268_121400431	3300032173	Sediment	MNRWLPHVLFPRPGWFILHAVVIVLVFLLGYSVKF
Ga0315268_125266271	3300032173	Sediment	MMNRWLPHILFPRPGWFILHAVAIVLVFCLGYSVKF
Ga0315276_100869442	3300032177	Sediment	MNRWLPYMLFPRPGWFILHAAVIVLVFLLGYSVKF
Ga0315276_111419742	3300032177	Sediment	MNRWLPLVLFPRPGWFILHAIAIVLVFLLGYSVKF
Ga0315271_100425334	3300032256	Sediment	MNRWLPYVMFPRPGWFILHATVIALLFFLGYSVKF
Ga0315271_100910883	3300032256	Sediment	MNRWLPYVLYPLPGWFILHAAAIVLVFLLGYSVKF
Ga0315271_118109132	3300032256	Sediment	MNRWLPYVLFPRPGWFILHAAVIGLVFLLGYSVKF
Ga0315287_102961971	3300032397	Sediment	MNRWLPYVLYPRPGWFILHAAVIVLVFLLGYSVKF
Ga0315287_109291522	3300032397	Sediment	MNRWLPHVLYPRPGWFILHGAVIVLVFLLGYAVKF
Ga0315275_106802921	3300032401	Sediment	MNRWLPYVLFPRPGWFILHGAVIVLVFLLGFSVKF
Ga0315273_121322421	3300032516	Sediment	AMNRWLPYVLFPRPGWFILHGAVIVLVFLLGYVVKF
Ga0316622_1009274862	3300033416	Soil	MNRWLPYVLFPRPGWFILHAALIVLVFLLGYAVKF
Ga0316620_108184842	3300033480	Soil	MNRWLPYVLFPRPGWFVLHAIIITLVFCLGYVVKF
Ga0316624_101883454	3300033486	Soil	MNRWLPYVLFPRPGWFILHAIIITLVFSLGYVVKF
Ga0299912_104871061	3300033489	Soil	MLRLVPYVLFPRPGWFILHAAAIALVFLLGYSVRF
Ga0316628_1011615812	3300033513	Soil	MNRWLPYVLYPRPGWFILHAAAIALVFLLGYSVKF

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign