Basic Information | |
---|---|
Family ID | F037490 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 168 |
Average Sequence Length | 41 residues |
Representative Sequence | GSIGSPDRLDALVWAITDLSLNGYAKPQLKLAYSSAKGLI |
Number of Associated Samples | 142 |
Number of Associated Scaffolds | 168 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.21 % |
% of genes from short scaffolds (< 2000 bps) | 88.69 % |
Associated GOLD sequencing projects | 124 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.31 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (42.262 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (29.167 % of family members) |
Environment Ontology (ENVO) | Unclassified (60.714 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (76.190 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.53% β-sheet: 0.00% Coil/Unstructured: 76.47% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 168 Family Scaffolds |
---|---|---|
PF06074 | DUF935 | 30.95 |
PF01391 | Collagen | 1.19 |
PF06791 | TMP_2 | 1.19 |
PF13554 | DUF4128 | 1.19 |
PF14550 | Peptidase_S78_2 | 0.60 |
PF03237 | Terminase_6N | 0.60 |
PF13385 | Laminin_G_3 | 0.60 |
PF05658 | YadA_head | 0.60 |
COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
---|---|---|---|
COG4383 | Mu-like prophage protein gp29 | Mobilome: prophages, transposons [X] | 30.95 |
COG5281 | Phage-related minor tail protein | Mobilome: prophages, transposons [X] | 1.19 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 57.74 % |
Unclassified | root | N/A | 42.26 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000101|DelMOSum2010_c10113335 | All Organisms → Viruses → Predicted Viral | 1089 | Open in IMG/M |
3300000101|DelMOSum2010_c10148758 | Not Available | 863 | Open in IMG/M |
3300000115|DelMOSum2011_c10119434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 828 | Open in IMG/M |
3300000116|DelMOSpr2010_c10125283 | Not Available | 920 | Open in IMG/M |
3300000116|DelMOSpr2010_c10200392 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300000117|DelMOWin2010_c10192533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 634 | Open in IMG/M |
3300000117|DelMOWin2010_c10261370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 502 | Open in IMG/M |
3300000362|SL_1KL_011_SEDDRAFT_10156996 | Not Available | 766 | Open in IMG/M |
3300000517|PR_CR_10_Liq_3_inCRDRAFT_1004567 | All Organisms → Viruses → Predicted Viral | 3462 | Open in IMG/M |
3300000517|PR_CR_10_Liq_3_inCRDRAFT_1010097 | All Organisms → Viruses → Predicted Viral | 2176 | Open in IMG/M |
3300000947|BBAY92_10046940 | All Organisms → Viruses → Predicted Viral | 1177 | Open in IMG/M |
3300000949|BBAY94_10102546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 784 | Open in IMG/M |
3300001419|JGI11705J14877_10185955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 541 | Open in IMG/M |
3300003635|p5metav_104885 | All Organisms → Viruses → Predicted Viral | 1378 | Open in IMG/M |
3300003635|p5metav_109438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 855 | Open in IMG/M |
3300004097|Ga0055584_100729745 | All Organisms → Viruses → Predicted Viral | 1036 | Open in IMG/M |
3300004481|Ga0069718_15672692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 781 | Open in IMG/M |
3300005512|Ga0074648_1029935 | All Organisms → Viruses → Predicted Viral | 2770 | Open in IMG/M |
3300005611|Ga0074647_1014060 | All Organisms → Viruses → Predicted Viral | 1402 | Open in IMG/M |
3300005737|Ga0076927_153049 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300005747|Ga0076924_1108206 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300006025|Ga0075474_10062547 | All Organisms → Viruses → Predicted Viral | 1240 | Open in IMG/M |
3300006029|Ga0075466_1094518 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300006029|Ga0075466_1151046 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
3300006352|Ga0075448_10197967 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300006396|Ga0075493_1054256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 538 | Open in IMG/M |
3300006396|Ga0075493_1421338 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
3300006484|Ga0070744_10019281 | All Organisms → Viruses → Predicted Viral | 2027 | Open in IMG/M |
3300006484|Ga0070744_10054537 | All Organisms → Viruses → Predicted Viral | 1169 | Open in IMG/M |
3300006484|Ga0070744_10203868 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300006737|Ga0098037_1084313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1113 | Open in IMG/M |
3300006789|Ga0098054_1168793 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300006789|Ga0098054_1277322 | Not Available | 602 | Open in IMG/M |
3300006790|Ga0098074_1050566 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
3300006793|Ga0098055_1007153 | Not Available | 5235 | Open in IMG/M |
3300006793|Ga0098055_1121463 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1014 | Open in IMG/M |
3300006802|Ga0070749_10000942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 19683 | Open in IMG/M |
3300006802|Ga0070749_10708149 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300006803|Ga0075467_10176875 | All Organisms → Viruses → Predicted Viral | 1204 | Open in IMG/M |
3300006868|Ga0075481_10104363 | All Organisms → Viruses → Predicted Viral | 1051 | Open in IMG/M |
3300006870|Ga0075479_10329395 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300006919|Ga0070746_10085879 | All Organisms → Viruses → Predicted Viral | 1586 | Open in IMG/M |
3300006919|Ga0070746_10547869 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300006920|Ga0070748_1155281 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300006920|Ga0070748_1263287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 618 | Open in IMG/M |
3300006920|Ga0070748_1279870 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
3300006925|Ga0098050_1112319 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300007276|Ga0070747_1166434 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300007276|Ga0070747_1169705 | Not Available | 779 | Open in IMG/M |
3300007345|Ga0070752_1048486 | All Organisms → Viruses → Predicted Viral | 1962 | Open in IMG/M |
3300007346|Ga0070753_1323103 | Not Available | 548 | Open in IMG/M |
3300007538|Ga0099851_1005880 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5139 | Open in IMG/M |
3300007611|Ga0102927_1036081 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
3300007658|Ga0102898_1029925 | All Organisms → Viruses → Predicted Viral | 1218 | Open in IMG/M |
3300007665|Ga0102908_1063848 | Not Available | 722 | Open in IMG/M |
3300007983|Ga0102941_1223759 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 646 | Open in IMG/M |
3300008012|Ga0075480_10138393 | All Organisms → Viruses → Predicted Viral | 1332 | Open in IMG/M |
3300008050|Ga0098052_1131281 | All Organisms → Viruses → Predicted Viral | 1002 | Open in IMG/M |
3300008470|Ga0115371_10708217 | Not Available | 707 | Open in IMG/M |
3300009002|Ga0102810_1264643 | Not Available | 531 | Open in IMG/M |
3300009027|Ga0102957_1004718 | All Organisms → Viruses → Predicted Viral | 4611 | Open in IMG/M |
3300009061|Ga0102938_10200276 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
3300009061|Ga0102938_10639349 | Not Available | 533 | Open in IMG/M |
3300009076|Ga0115550_1003346 | Not Available | 10457 | Open in IMG/M |
3300009138|Ga0102959_1192538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 652 | Open in IMG/M |
3300009169|Ga0105097_10890284 | Not Available | 511 | Open in IMG/M |
3300009505|Ga0115564_10255886 | Not Available | 890 | Open in IMG/M |
3300010149|Ga0098049_1032394 | All Organisms → Viruses → Predicted Viral | 1696 | Open in IMG/M |
3300010316|Ga0136655_1014906 | All Organisms → Viruses → Predicted Viral | 2683 | Open in IMG/M |
3300010316|Ga0136655_1020894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 2187 | Open in IMG/M |
3300010368|Ga0129324_10031176 | All Organisms → Viruses → Predicted Viral | 2548 | Open in IMG/M |
3300010368|Ga0129324_10300851 | Not Available | 631 | Open in IMG/M |
3300012031|Ga0136561_1032603 | Not Available | 848 | Open in IMG/M |
3300012037|Ga0136559_1045821 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
3300012268|Ga0136590_1017247 | All Organisms → Viruses → Predicted Viral | 1460 | Open in IMG/M |
3300012516|Ga0129325_1230843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 710 | Open in IMG/M |
3300012936|Ga0163109_11254174 | Not Available | 540 | Open in IMG/M |
3300013010|Ga0129327_10209447 | Not Available | 986 | Open in IMG/M |
3300016749|Ga0182053_1464117 | Not Available | 527 | Open in IMG/M |
3300016791|Ga0182095_1186115 | All Organisms → Viruses → Predicted Viral | 1076 | Open in IMG/M |
3300017719|Ga0181390_1054523 | All Organisms → Viruses → Predicted Viral | 1163 | Open in IMG/M |
3300017725|Ga0181398_1031437 | All Organisms → Viruses → Predicted Viral | 1304 | Open in IMG/M |
3300017742|Ga0181399_1074874 | Not Available | 857 | Open in IMG/M |
3300017772|Ga0181430_1024156 | All Organisms → Viruses → Predicted Viral | 1980 | Open in IMG/M |
3300017782|Ga0181380_1030777 | All Organisms → Viruses → Predicted Viral | 1967 | Open in IMG/M |
3300017785|Ga0181355_1050782 | All Organisms → Viruses → Predicted Viral | 1762 | Open in IMG/M |
3300017969|Ga0181585_10442367 | Not Available | 881 | Open in IMG/M |
3300018416|Ga0181553_10476579 | Not Available | 669 | Open in IMG/M |
3300018420|Ga0181563_10051768 | Not Available | 2894 | Open in IMG/M |
3300018421|Ga0181592_10445665 | Not Available | 905 | Open in IMG/M |
3300019266|Ga0182061_1437618 | Not Available | 589 | Open in IMG/M |
3300020048|Ga0207193_1484711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
3300020166|Ga0206128_1106087 | All Organisms → Viruses → Predicted Viral | 1206 | Open in IMG/M |
3300020182|Ga0206129_10076426 | All Organisms → Viruses → Predicted Viral | 1885 | Open in IMG/M |
3300020187|Ga0206130_10202732 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300020194|Ga0181597_10154500 | All Organisms → Viruses → Predicted Viral | 1171 | Open in IMG/M |
3300020595|Ga0206126_10179572 | Not Available | 994 | Open in IMG/M |
3300021335|Ga0213867_1037162 | All Organisms → Viruses → Predicted Viral | 1908 | Open in IMG/M |
3300021350|Ga0206692_1524294 | Not Available | 548 | Open in IMG/M |
3300021379|Ga0213864_10660274 | Not Available | 514 | Open in IMG/M |
3300022053|Ga0212030_1052668 | Not Available | 578 | Open in IMG/M |
3300022057|Ga0212025_1003677 | All Organisms → Viruses → Predicted Viral | 1907 | Open in IMG/M |
3300022057|Ga0212025_1023250 | Not Available | 1016 | Open in IMG/M |
3300022063|Ga0212029_1001639 | All Organisms → Viruses → Predicted Viral | 1986 | Open in IMG/M |
3300022065|Ga0212024_1080210 | Not Available | 580 | Open in IMG/M |
3300022067|Ga0196895_1045685 | Not Available | 505 | Open in IMG/M |
3300022164|Ga0212022_1068097 | Not Available | 547 | Open in IMG/M |
3300022169|Ga0196903_1038174 | Not Available | 561 | Open in IMG/M |
3300022200|Ga0196901_1079524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → sulfur-oxidizing symbionts → Solemya elarraichensis gill symbiont | 1171 | Open in IMG/M |
3300022200|Ga0196901_1220431 | Not Available | 600 | Open in IMG/M |
3300022200|Ga0196901_1271465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 519 | Open in IMG/M |
3300022929|Ga0255752_10082760 | All Organisms → cellular organisms → Bacteria | 1815 | Open in IMG/M |
(restricted) 3300022938|Ga0233409_10354841 | Not Available | 517 | Open in IMG/M |
3300023229|Ga0222661_1026344 | Not Available | 838 | Open in IMG/M |
3300023676|Ga0232114_129458 | Not Available | 539 | Open in IMG/M |
3300024247|Ga0228675_1062662 | Not Available | 755 | Open in IMG/M |
3300024281|Ga0228610_1059372 | Not Available | 549 | Open in IMG/M |
3300024301|Ga0233451_10203867 | Not Available | 840 | Open in IMG/M |
3300024346|Ga0244775_10484968 | All Organisms → Viruses → Predicted Viral | 1011 | Open in IMG/M |
3300024348|Ga0244776_10946969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
(restricted) 3300024520|Ga0255047_10004603 | Not Available | 8308 | Open in IMG/M |
3300024559|Ga0255284_1057032 | Not Available | 838 | Open in IMG/M |
3300024573|Ga0256337_1183103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 519 | Open in IMG/M |
3300025070|Ga0208667_1024532 | All Organisms → Viruses → Predicted Viral | 1133 | Open in IMG/M |
3300025070|Ga0208667_1060716 | Not Available | 590 | Open in IMG/M |
3300025103|Ga0208013_1089511 | Not Available | 786 | Open in IMG/M |
3300025110|Ga0208158_1106437 | Not Available | 656 | Open in IMG/M |
3300025543|Ga0208303_1035583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → sulfur-oxidizing symbionts → Solemya elarraichensis gill symbiont | 1294 | Open in IMG/M |
3300025543|Ga0208303_1096169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 633 | Open in IMG/M |
3300025577|Ga0209304_1109081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 616 | Open in IMG/M |
3300025594|Ga0209094_1128970 | Not Available | 550 | Open in IMG/M |
3300025610|Ga0208149_1100002 | Not Available | 697 | Open in IMG/M |
3300025621|Ga0209504_1003091 | Not Available | 10647 | Open in IMG/M |
3300025645|Ga0208643_1089948 | Not Available | 859 | Open in IMG/M |
3300025647|Ga0208160_1090862 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 805 | Open in IMG/M |
3300025652|Ga0208134_1043271 | All Organisms → Viruses → Predicted Viral | 1480 | Open in IMG/M |
3300025652|Ga0208134_1061564 | All Organisms → Viruses → Predicted Viral | 1147 | Open in IMG/M |
3300025655|Ga0208795_1097636 | Not Available | 791 | Open in IMG/M |
3300025655|Ga0208795_1152459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300025696|Ga0209532_1160883 | Not Available | 682 | Open in IMG/M |
3300025704|Ga0209602_1205117 | Not Available | 582 | Open in IMG/M |
3300025769|Ga0208767_1267266 | Not Available | 522 | Open in IMG/M |
3300025810|Ga0208543_1093906 | Not Available | 718 | Open in IMG/M |
3300025818|Ga0208542_1124258 | Not Available | 721 | Open in IMG/M |
3300025828|Ga0208547_1104722 | Not Available | 865 | Open in IMG/M |
3300025849|Ga0209603_1031459 | All Organisms → Viruses → Predicted Viral | 3090 | Open in IMG/M |
3300025887|Ga0208544_10351520 | Not Available | 560 | Open in IMG/M |
3300025889|Ga0208644_1001852 | Not Available | 17263 | Open in IMG/M |
3300026094|Ga0209937_1041728 | Not Available | 852 | Open in IMG/M |
3300026105|Ga0209923_1013244 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
3300026172|Ga0209964_1016464 | All Organisms → Viruses → Predicted Viral | 2023 | Open in IMG/M |
3300026458|Ga0247578_1038863 | Not Available | 901 | Open in IMG/M |
3300026503|Ga0247605_1088137 | Not Available | 762 | Open in IMG/M |
3300026569|Ga0255277_1115684 | Not Available | 667 | Open in IMG/M |
3300027159|Ga0208020_1007141 | All Organisms → Viruses → Predicted Viral | 2194 | Open in IMG/M |
3300027752|Ga0209192_10065928 | All Organisms → Viruses → Predicted Viral | 1576 | Open in IMG/M |
3300027888|Ga0209635_10202802 | All Organisms → Viruses → Predicted Viral | 1611 | Open in IMG/M |
3300028110|Ga0247584_1164803 | Not Available | 543 | Open in IMG/M |
3300028115|Ga0233450_10399343 | Not Available | 545 | Open in IMG/M |
3300028125|Ga0256368_1035876 | Not Available | 884 | Open in IMG/M |
3300028287|Ga0257126_1205398 | Not Available | 612 | Open in IMG/M |
3300031211|Ga0307974_1143465 | Not Available | 767 | Open in IMG/M |
3300031269|Ga0307983_1014713 | All Organisms → Viruses → Predicted Viral | 1848 | Open in IMG/M |
3300031600|Ga0307930_1205977 | Not Available | 564 | Open in IMG/M |
3300031628|Ga0308014_1030378 | All Organisms → Viruses → Predicted Viral | 1378 | Open in IMG/M |
3300032136|Ga0316201_10531968 | All Organisms → Viruses → Predicted Viral | 1007 | Open in IMG/M |
3300032262|Ga0316194_10427483 | Not Available | 837 | Open in IMG/M |
3300034418|Ga0348337_174995 | Not Available | 569 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 29.17% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 8.33% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 6.55% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.76% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.17% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.17% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.98% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.98% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.98% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.38% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.38% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 2.38% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.38% |
Pond Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil | 2.38% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.79% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.79% |
Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.79% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.19% |
Enviromental | Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental | 1.19% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.19% |
Hypersaline Samples | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Samples | 1.19% |
Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.19% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.60% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.60% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.60% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.60% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.60% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.60% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.60% |
Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.60% |
Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 0.60% |
Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.60% |
Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.60% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.60% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 0.60% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.60% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.60% |
Alkaline Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment | 0.60% |
Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.60% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.60% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300000362 | Alkaline sediment microbial communities from Cock Soda Lake, Kulunda Steppe, Russia - 1KL_011_SED | Environmental | Open in IMG/M |
3300000517 | Marine microbial community from Cabo Rojo, Puerto Rico - PR CR 10% Liquid 3 | Environmental | Open in IMG/M |
3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
3300003635 | Hypersaline viral communities from Bras del Port, Santa Pola, Spain - Lo Valdivia P5 | Environmental | Open in IMG/M |
3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
3300005737 | Seawater microbial communities from Vineyard Sound, MA, USA - sterilised with crude oil T14 | Environmental | Open in IMG/M |
3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
3300006352 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA | Environmental | Open in IMG/M |
3300006396 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007611 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_A_H2O_MG | Environmental | Open in IMG/M |
3300007658 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 | Environmental | Open in IMG/M |
3300007665 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3 | Environmental | Open in IMG/M |
3300007983 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_C_D2_MG | Environmental | Open in IMG/M |
3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
3300009002 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 | Environmental | Open in IMG/M |
3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
3300009061 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_B_D2_MG | Environmental | Open in IMG/M |
3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
3300009138 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MG | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300012031 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Hop E1 #498 | Environmental | Open in IMG/M |
3300012037 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Hop E1 #496 | Environmental | Open in IMG/M |
3300012268 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 3 #765 | Environmental | Open in IMG/M |
3300012516 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
3300016749 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011512AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016791 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019266 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
3300021350 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
3300022938 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MG | Environmental | Open in IMG/M |
3300023229 | Saline water microbial communities from Ace Lake, Antarctica - #551 | Environmental | Open in IMG/M |
3300023676 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 55R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024247 | Seawater microbial communities from Monterey Bay, California, United States - 36D_r | Environmental | Open in IMG/M |
3300024281 | Seawater microbial communities from Monterey Bay, California, United States - 11D | Environmental | Open in IMG/M |
3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
3300024559 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
3300025594 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes) | Environmental | Open in IMG/M |
3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025696 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes) | Environmental | Open in IMG/M |
3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300026094 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300026105 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300026172 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_B_D1_MG (SPAdes) | Environmental | Open in IMG/M |
3300026458 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026569 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027159 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes) | Environmental | Open in IMG/M |
3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
3300028110 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
3300028287 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m | Environmental | Open in IMG/M |
3300031211 | Saline water microbial communities from Organic Lake, Antarctica - #784 | Environmental | Open in IMG/M |
3300031269 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #991 | Environmental | Open in IMG/M |
3300031600 | Saline water microbial communities from Organic Lake, Antarctica - #46 | Environmental | Open in IMG/M |
3300031628 | Marine microbial communities from water near the shore, Antarctic Ocean - #229 | Environmental | Open in IMG/M |
3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
3300032262 | Coastal sediment microbial communities from Maine, United States - Cross River sediment 1 | Environmental | Open in IMG/M |
3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSum2010_101133351 | 3300000101 | Marine | TQMRTWEPLGSIGSPDRLDACVWAITDLSLNGYAKPKLTLAYSSAKGLSQK* |
DelMOSum2010_101487581 | 3300000101 | Marine | RLDALVWAITDLSLNGYSKPKLTLAYSSAKGLSR* |
DelMOSum2011_101194341 | 3300000115 | Marine | GSPDRLDALVWAITDLSLNGYAKPTLKLAYSSAKGLR* |
DelMOSpr2010_101252831 | 3300000116 | Marine | PDRLDACVWAITDLSLNGYAKPKLTLAYSSAKGLSQK* |
DelMOSpr2010_102003922 | 3300000116 | Marine | SPDRLDALVWAITDLSLNGYAKPTLKLAYSSAKGLR* |
DelMOWin2010_101925331 | 3300000117 | Marine | QWEPLGSTGSPDRLDALVWAITDLSLNGYAKPTLKLAYSSAKGLR* |
DelMOWin2010_102613701 | 3300000117 | Marine | TWEPLGSVGSPDRLDALVWAITDLSLQGYAKPQLKLAYSSAKGLR* |
SL_1KL_011_SEDDRAFT_101569962 | 3300000362 | Alkaline Sediment | GSPDRLDALVWACTELALGSYQVPPMQLVYETAKGIR* |
PR_CR_10_Liq_3_inCRDRAFT_10045671 | 3300000517 | Enviromental | PDRLDALVWALTDLCLGSYQKPKLQLVYSNAKGLR* |
PR_CR_10_Liq_3_inCRDRAFT_10100974 | 3300000517 | Enviromental | IGSPDRLDALVWALTDLCLGSYQKPKLQLVYSNAKGLR* |
BBAY92_100469401 | 3300000947 | Macroalgal Surface | IGSPDRLDACVWALTELLLNGYSKPQLKLVYSSIKGLR* |
BBAY94_101025461 | 3300000949 | Macroalgal Surface | LGSIGSPDRLDALVWALTDLSLNGYAKPQLKLAYSSAKGLM* |
JGI11705J14877_101859552 | 3300001419 | Saline Water And Sediment | IGSPDRLDALVWALTDLSLNGYAKPQLTLAYSSAKGLSR* |
p5metav_1048852 | 3300003635 | Hypersaline Samples | MRTWEPLGSIGSPDRLDACVWALTDLSLNGYAKPQLTLAYTSAKGLS* |
p5metav_1094381 | 3300003635 | Hypersaline Samples | PLGSIGSPDRLDALVWALTDLMLGSYQKPKLQLVYSNAKGLR* |
Ga0055584_1007297452 | 3300004097 | Pelagic Marine | SIGSPDRLDALVWAITDLSLNGYAKPQLVLAYSNAKGLR* |
Ga0069718_156726921 | 3300004481 | Sediment | VQWEPLGSIGSPDRLDAMVWAITELALKGIAKPELRLAYTDSKGLSRHA* |
Ga0074648_10299351 | 3300005512 | Saline Water And Sediment | IGSPDRLDALVWALTDLSLNGYAKPQLKLAYSSAKGLV* |
Ga0074647_10140602 | 3300005611 | Saline Water And Sediment | WEPLGSIGSPDRLDALVWALTDLSLNGYAKPQLTLAYSSAKGLSR* |
Ga0076927_1530491 | 3300005737 | Marine | SPDRLDACVWAITDLSLNGYAKPKLTLAYSSAKGLSQK* |
Ga0076924_11082061 | 3300005747 | Marine | GSIGSPDRLDACVWAITDLSLNGYAKPKLTLAYSSAKGLSQK* |
Ga0075474_100625471 | 3300006025 | Aqueous | SIGSPDRLDALVWALTDLSLNGYAKPQLKLAYSSAKGLI* |
Ga0075466_10945182 | 3300006029 | Aqueous | DRLDALVWAITDLSLNGYAKPQLKLAYSSAKGLI* |
Ga0075466_11510461 | 3300006029 | Aqueous | SPDRLDACVWAITDLSLNGYSKPKLTLVYSSAKGLSK* |
Ga0075448_101979672 | 3300006352 | Marine | SPDRLDALVWAITDLSLNGYAKPKLTLAYSSAKGLSQK* |
Ga0075493_10542561 | 3300006396 | Aqueous | GSIGSPDRLDAMVWALTDLMMNGYTKPKLQLAYSNAKGLGSK* |
Ga0075493_14213381 | 3300006396 | Aqueous | YEPMGKHKSPDRYDALVWAITDLMLQGYAKPQLKLVYSNSKGLR* |
Ga0070744_100192811 | 3300006484 | Estuarine | YEPMGKHKSPDRYDALVWAITDLMLNGYAKPQLRLVHSSAKGLR* |
Ga0070744_100545374 | 3300006484 | Estuarine | DRYDALVWALTDLMLNGYSKPKLQLVYSNTKGLR* |
Ga0070744_102038682 | 3300006484 | Estuarine | WEPLGRIGSPDRLDAMVWALTDLCLNGWSKPQLTLAYSSAKGLSK* |
Ga0098037_10843131 | 3300006737 | Marine | QWEPLGSKGSPDRLDACVWAITDLSLNGYAKPQLKLAYSNAQGLK* |
Ga0098054_11687932 | 3300006789 | Marine | IGSPDRLDAMVWALTDLSLNGYAKPQLKLAYSNAKGLR* |
Ga0098054_12773221 | 3300006789 | Marine | LDACVWALTDLMLNGVTNPTLRLSYSNAKGLSQIHLG* |
Ga0098074_10505661 | 3300006790 | Marine | PLGSIGSPDRLDACVWALTDLMLNGVSTPNVRLAYASAKGLESEIYLG* |
Ga0098055_10071535 | 3300006793 | Marine | DRLDAMVWALTDLMLNGYQKPQLKLVYSSIKGLS* |
Ga0098055_11214632 | 3300006793 | Marine | DRLDALVWAITDLSLNGYAKPTLKLAYSSAKGLR* |
Ga0070749_100009421 | 3300006802 | Aqueous | WEPLGSIGSPDRLDALVWALTDLSLNGYAKPQLKLAYSSAKGLM* |
Ga0070749_107081492 | 3300006802 | Aqueous | PDRLDALVWAITDLSLQGYAKPQLKLAYSSAKGLR* |
Ga0075467_101768752 | 3300006803 | Aqueous | PDRLDALVWAITDLSLNGYAKPQLKLAYSSAKGLI* |
Ga0075481_101043631 | 3300006868 | Aqueous | LGSIGSPDRLDACVWALTDLSLNGYAKPQLTLAYTSAKGLS* |
Ga0075479_103293952 | 3300006870 | Aqueous | WEPLGSIGSPDRLDACVWALTDLSLNGYAKPQLTLAYTSAKGLS* |
Ga0070746_100858793 | 3300006919 | Aqueous | GSPDRLDACVWALTDLSLNGYAKPQLTLAYTSAKGLS* |
Ga0070746_105478692 | 3300006919 | Aqueous | DRLDALVWALTDLSLNGYAKPQLKLAYSSAKGLI* |
Ga0070748_11552812 | 3300006920 | Aqueous | RLDALVWALTDLSLNGYAKPKLALVYSSSKGLSSPR* |
Ga0070748_12632871 | 3300006920 | Aqueous | WEPLGSIGSPDRLDAMVWALTDLMMNGYTKPKLQLAYSNAKGLGNK* |
Ga0070748_12798702 | 3300006920 | Aqueous | LETQMRTWSPLGSIGSPDRLDAMVWALTDLMMNGYTRPKLSLAYSNAKGLSR* |
Ga0098050_11123191 | 3300006925 | Marine | DRLDACVWALTDLMLNGVNNPTVRLSYASAKGLNEVYLG* |
Ga0070747_11664341 | 3300007276 | Aqueous | TQMRTWEPLGSIGSPDRLDACVWAITDLSLNGYSKPKLTLVYSSAKGLSK* |
Ga0070747_11697051 | 3300007276 | Aqueous | LGSTGSPDRLDALVWAITDLSLNGYAKPTLKLAYSSAKGLR* |
Ga0070752_10484864 | 3300007345 | Aqueous | LGSIGSPDRLDALVWALTDLSLNGYAKPQLKLAYSSAKGLI* |
Ga0070753_13231031 | 3300007346 | Aqueous | RLDALVWAITDLSLNGYAKPKLTLAYSSAKGLSQK* |
Ga0099851_10058801 | 3300007538 | Aqueous | IGSPDRLDALVWAITDLSLNGYSKPKLALVYSSSKGLLNR* |
Ga0102927_10360813 | 3300007611 | Pond Water | LGKHKSPDRYDALVWALTDLMLKGFAKPKLQLVYSNAKGLR* |
Ga0102898_10299254 | 3300007658 | Estuarine | YEPLGRHKSPDRYDALVWALTDLMLNGYSKPKLQLVYSNTKGLR* |
Ga0102908_10638482 | 3300007665 | Estuarine | EPLGRVGSPDRLDALVWAITDLSLNGYSKPKLTLAYSSAKGLSR* |
Ga0102941_12237591 | 3300007983 | Pond Soil | PLGSIGSPDRLDALVWALTDLMLGSYQKPQLQLVYSNAKGLR* |
Ga0075480_101383931 | 3300008012 | Aqueous | PDRLDALVWALTDLSLNGYAKPQLKLAYSSAKGLM* |
Ga0098052_11312811 | 3300008050 | Marine | DRLDALVWAITDLSLNGYAKPQLKLAYSSAQGLL* |
Ga0115371_107082171 | 3300008470 | Sediment | MRTWEPLGRIGSPDRLDAMVWAITDLSLNGYAKPKLTLAYSSAKGLSK* |
Ga0102810_12646431 | 3300009002 | Estuarine | TYEPLGRHKSPDRYDALVWALTDLMLNGYSKPKLQLVYSNTKGLR* |
Ga0102957_10047186 | 3300009027 | Pond Water | VQWEPLGSIGSPDRLDALVWALTDLSLNGYAKPQLKLAYSSAKGLM* |
Ga0102938_102002763 | 3300009061 | Pond Soil | DRLDALVWALTDLMLGSYQKPQLQLVYSNAKGLR* |
Ga0102938_106393491 | 3300009061 | Pond Soil | IGSPDRLDALVWALTDLMLGSYQKPQLQLVYSNAKGLR* |
Ga0115550_10033461 | 3300009076 | Pelagic Marine | RTWEPLGRIGSPDRLDAAVWALTELCLGGYSKPKLTLAYSSAKGLTK* |
Ga0102959_11925382 | 3300009138 | Soil | GSPDRLDAMVWALTDLMLNGYSKPQLQLVYSSSKGLR* |
Ga0105097_108902841 | 3300009169 | Freshwater Sediment | VQWEPLGSTGSPDRLDAMVWAITDLALKGVAKPELNLAYADAKGLLARN* |
Ga0115564_102558862 | 3300009505 | Pelagic Marine | WEPLGSIGSPDRLDALVWAITDLSLNGYAKPTLKLAYSSAKGLR* |
Ga0098049_10323943 | 3300010149 | Marine | LGSIGSPDRLDAMVWALTELMLNGYQKPQLKLVYSSNKGLS* |
Ga0136655_10149061 | 3300010316 | Freshwater To Marine Saline Gradient | RLDAMVWALTDLMMNGYTKPKLQLAYSNAKGLGK* |
Ga0136655_10208942 | 3300010316 | Freshwater To Marine Saline Gradient | SIGSPDRLDAMVWALTDLMMNGYTKPKLQLAYSNAKGLGK* |
Ga0129324_100311761 | 3300010368 | Freshwater To Marine Saline Gradient | GSPDRLDAMVWALTDLMMNGYTKPKLQLAYSNAKGLGK* |
Ga0129324_103008513 | 3300010368 | Freshwater To Marine Saline Gradient | RTWEPLGSIGSPDRLDAMVWALTDLMMNGYTKPKLQLAYSNAKGLGK* |
Ga0136561_10326033 | 3300012031 | Saline Lake | LGSIGSPDRLDALVWCLTDLMLNGYSKPQLSLVYSNSKGLSR* |
Ga0136559_10458213 | 3300012037 | Saline Lake | SIGSPDRLDALVWSMTELMLNGVQRPQLQIVYASARGK* |
Ga0136590_10172472 | 3300012268 | Saline Lake | LGSIGSPDRLDALVWAITDLSLNGYTKPKLSLVYSSNKGLSR* |
Ga0129325_12308432 | 3300012516 | Aqueous | EPLGSIGSPDRLDAMVWALTDLMMNGYTKPKLQLAYSNAKGLGK* |
Ga0163109_112541742 | 3300012936 | Surface Seawater | LDACVWALTDLMLNGVNNPTVRLSYASAKGLNEVYLG* |
Ga0129327_102094471 | 3300013010 | Freshwater To Marine Saline Gradient | WEPLGSTGSPDRLDAMVWAITDLSLNGYAKPQLVLAYSNAKGLK* |
Ga0182053_14641171 | 3300016749 | Salt Marsh | PDRLDACVWAITDLSLYGYAKPKLTLAYSSAKGLSQK |
Ga0182095_11861152 | 3300016791 | Salt Marsh | GSIGSPDRLDACVWAITDLSLNGYAKPKLTLAYSSAKGLSQK |
Ga0181390_10545231 | 3300017719 | Seawater | TWEPLGSIGSPDRLDALVWAITDLSLNGYTKPKLTLAYSSVKGLSR |
Ga0181398_10314372 | 3300017725 | Seawater | LGSTGSPDRLDAMVWAITDLSLNGYAKPQLVLAYSNAKGLK |
Ga0181399_10748742 | 3300017742 | Seawater | QWEPLGSIGSPDRLDALVWAITDLSLNGYAKPTLKLAYSSAKGLR |
Ga0181430_10241563 | 3300017772 | Seawater | PLGSIGSPDRLDAMVWALTELMLNGYSKPQLKLVYSSNKGLS |
Ga0181380_10307773 | 3300017782 | Seawater | PDRLDAMVWALTELMLNGYQKPQLKLVYSSSKGLS |
Ga0181355_10507821 | 3300017785 | Freshwater Lake | QWEPLGSIGSPDRLDAMVWAVTELSLKGIAKPELRLAYSDAKGLIPRS |
Ga0181585_104423671 | 3300017969 | Salt Marsh | IGSPDRLDAMVWALTDLSLNGYAKPQLILAYSNAKGLR |
Ga0181553_104765792 | 3300018416 | Salt Marsh | RLDACVWALTDLMLNGVNNPTVRLSYASAKGLNENNIYLG |
Ga0181563_100517686 | 3300018420 | Salt Marsh | SIGSPDRLDACVWALTDLMLNGVNNPTVRLSYASAKGLDQVYLG |
Ga0181592_104456652 | 3300018421 | Salt Marsh | EPLGSVGSPDRLDACVWALTDLMLNGVNNPTVRLSYASAKGLNENNIYLG |
Ga0182061_14376181 | 3300019266 | Salt Marsh | GSIGSPDRLDAMVWALTDLSLNGYAKPQLILAYSNAKGLK |
Ga0207193_14847113 | 3300020048 | Freshwater Lake Sediment | PDRLDAMVWSITELALKGISRPELNLAYSDAKGLISRL |
Ga0206128_11060871 | 3300020166 | Seawater | FSIGSPDRLDACVWALTELMLNGYQRPQLKLLYSSSKGLS |
Ga0206129_100764263 | 3300020182 | Seawater | RTWEPLGSIGSPDRLDACVWAITDLSLNGYAKPKLTLAYSSAKGLSQK |
Ga0206130_102027321 | 3300020187 | Seawater | GSPDRLDACVWALTELMLNGYQRPQLKLLYSSSKGLS |
Ga0181597_101545002 | 3300020194 | Salt Marsh | PLGSIGSPDRLDAMVWALTDLMLNGHAKPQLQLIYSNSKGIH |
Ga0206126_101795721 | 3300020595 | Seawater | GSPDRLDAMVWALTELMLNGYQKPQLKLVYSSNKGL |
Ga0213867_10371621 | 3300021335 | Seawater | GSIGSPDRLDAMVWALTDLSLNGYAKPQLKLAYSNAKGLR |
Ga0206692_15242942 | 3300021350 | Seawater | RTWEPLGSIGSPDRLDSLVWAITDLSLNGYTKPKLTLAYSSVKGLSR |
Ga0213864_106602741 | 3300021379 | Seawater | LGSIGSPDRLDALVWALTDLSLNGYAKPQLKLAYSSAKGLI |
Ga0212030_10526682 | 3300022053 | Aqueous | IGSPDRLDALVWAITDLSLNGYAKPQLKLAYSSAKGLI |
Ga0212025_10036773 | 3300022057 | Aqueous | GSTGSPDRLDALVWAITDLSLNGYAKPTLKLAYSSAKGLR |
Ga0212025_10232502 | 3300022057 | Aqueous | PLGSLGSPDRLDACVWALTDLMHHGNPTPTLRLAYSSAKGLVA |
Ga0212029_10016392 | 3300022063 | Aqueous | SIGSPDRLDAMVWALTDLMMNGYTKPKLQLAYSNAKGLGK |
Ga0212024_10802102 | 3300022065 | Aqueous | PDRLDALVWAITDLSLNGYAKPTLKLAYSSAKGLR |
Ga0196895_10456851 | 3300022067 | Aqueous | PPDRLDALVWAITDLSLNGYAKPTLKLAYSSAKGLR |
Ga0212022_10680971 | 3300022164 | Aqueous | VQWEPLGSIGSPDRLDALVWAITDLSLNGYAKPTLKLAYSSAKGLR |
Ga0196903_10381741 | 3300022169 | Aqueous | PLGSIGSPDRLDALVWAITDLSLNGYSKPKLALVYSSSKGLLNR |
Ga0196901_10795241 | 3300022200 | Aqueous | GSIGSPDRLDAMVWALTDLMMNGYTKPKLQLAYSNAKGLGK |
Ga0196901_12204311 | 3300022200 | Aqueous | MRTWEPLGSIGSPDRLDALVWAVSDLALNGYSKPQLALLYTDNKGLAR |
Ga0196901_12714651 | 3300022200 | Aqueous | PLGSIGSPDRLDAMVWALTDLMMNGYTKPKLQLAYSNAKGLGK |
Ga0255752_100827603 | 3300022929 | Salt Marsh | PDRLDACVWALTDLMLNGVNNPTVRLSYASAKGLDQVYLG |
(restricted) Ga0233409_103548412 | 3300022938 | Seawater | TWEPLGSIGSPDRLDACVWAITDLSLNGYAKPKLTLAYSSAKGLSQK |
Ga0222661_10263442 | 3300023229 | Saline Water | GSPDRLDALVWAITDLSLNGYTKPKLSLVYSSNKGLSR |
Ga0232114_1294582 | 3300023676 | Seawater | SIGSPDRLDALVWAITDLSLNGYTKPKLTLAYSSVKGLSR |
Ga0228675_10626622 | 3300024247 | Seawater | GSIGSPDRLDALVWAITDLSLNGYAKPTLKLAYSSAKGLR |
Ga0228610_10593721 | 3300024281 | Seawater | WEPLGSTGSPDRLDAMVWAITDLSLNGYAKPQLVLAYSNAKGLK |
Ga0233451_102038671 | 3300024301 | Salt Marsh | LGSIGSPDRLDALVWALTDLSLNGYAKPQLKLAYSSAKGLM |
Ga0244775_104849681 | 3300024346 | Estuarine | PLGSIGSPDRLDALVWALTDLCLGGISKPTLNLNYAAKGLL |
Ga0244776_109469692 | 3300024348 | Estuarine | STGSPDRLDAMVWAITDLALKGVAKPELNLAYSDAKGLTARM |
(restricted) Ga0255047_100046031 | 3300024520 | Seawater | SIGSPDRLDACVWAITDLSLNGYAKPKLTLAYSSAKGLSQK |
Ga0255284_10570322 | 3300024559 | Freshwater | GSIGSPDRLDAMVWAVTELALKGIARPDLNLAYSDVKGLSLRI |
Ga0256337_11831032 | 3300024573 | Freshwater | MVQWCPLGSIGSPDRLDAMVWAVTELALKGISKPELNLAYSDAKGLLSRI |
Ga0208667_10245321 | 3300025070 | Marine | GSPDRLDALVWAITDLSLNGYAKPTLKLAYSSAKGLR |
Ga0208667_10607162 | 3300025070 | Marine | GSPDRLDAMVWALTDLMLNGYQKPQLKLVYSSIKGLS |
Ga0208013_10895111 | 3300025103 | Marine | SPDRLDALVWAITDLSLNGYAKPQLKLAYSSAKGLI |
Ga0208158_11064373 | 3300025110 | Marine | LGSIGSPDRLDAMVWAMTELMLNGYQKPQLKLVYSSSKGLR |
Ga0208303_10355831 | 3300025543 | Aqueous | SPDRLDAMVWALTDLMMNGYTKPKLQLAYSNAKGLGK |
Ga0208303_10961691 | 3300025543 | Aqueous | GSPDRLDAMVWALTDLMMNGYTKPKLQLAYSNAKGLGK |
Ga0209304_11090812 | 3300025577 | Pelagic Marine | LGSIGSPDRLDAMVWALTELMLNGYQRPQLKLLYSSSKGLS |
Ga0209094_11289702 | 3300025594 | Pelagic Marine | DRLDALVWAITDLSLNGYSKPKLTLAYSSAKGLSR |
Ga0208149_11000021 | 3300025610 | Aqueous | SIGSPDRLDALVWAITDLSLNGYAKPTLKLAYSSAKGLR |
Ga0209504_100309117 | 3300025621 | Pelagic Marine | YRTWEPLGRIGSPDRLDAAVWALTELCLGGYSKPKLTLAYSSAKGLTK |
Ga0208643_10899481 | 3300025645 | Aqueous | RTWEPLGSIGSPDRLDACVWAITDLSLNGYAKPKLTLAYSSAKGLSR |
Ga0208160_10908622 | 3300025647 | Aqueous | LRTWEPLGSIGSPDRLDAMVWALTDLMMNGYTKPKLQLAYSNAKGLGR |
Ga0208134_10432713 | 3300025652 | Aqueous | DRLDAMVWALTDLMLNGYSKPQLKLAYSNAKGLGK |
Ga0208134_10615641 | 3300025652 | Aqueous | SPDRLDAMVWALTDLMLNGWAKPELKLAYSNAKGLGTK |
Ga0208795_10976362 | 3300025655 | Aqueous | SPDRLDALVWAITDLSLNGYSKPKLALVYSSSKGLLNR |
Ga0208795_11524591 | 3300025655 | Aqueous | EPLGSIGSPDRLDAMVWAVTELALKGIAKPELNLAYSDAKGLSSRN |
Ga0209532_11608831 | 3300025696 | Pelagic Marine | EPLGSIGSPDRLDACVWAITDLSLNGYAKPKLTLAYSSAKGLSQK |
Ga0209602_12051171 | 3300025704 | Pelagic Marine | PLGSIGSPDRLDALVWAITDLSLNGYAKPQLKLAYSSAKGLI |
Ga0208767_12672662 | 3300025769 | Aqueous | RLDACVWALTDLMLNGVSTPNLRLSYTSAKGLEQSLYL |
Ga0208543_10939062 | 3300025810 | Aqueous | EPLGSIGSPDRLDALVWALTDLSLNGYAKPQLKLAYSSAKGLM |
Ga0208542_11242582 | 3300025818 | Aqueous | VQWEPLGSIGSPDRLDALVWALTDLSLNGYAKPQLKLAYSSAKGLI |
Ga0208547_11047222 | 3300025828 | Aqueous | LGSIGSPDRLDALVWAITDLSLNGYAKPTLKLAYSSAKGLR |
Ga0209603_10314594 | 3300025849 | Pelagic Marine | GSIGSPDRLDALVWAITDLSLNGYAKPQLKLAYSSAKGLI |
Ga0208544_103515201 | 3300025887 | Aqueous | PLGSTGSPDRLDAMVWAITDLSLNGYAKPQLVLAYSNAKGLK |
Ga0208644_100185219 | 3300025889 | Aqueous | QWEPLGSIGSPDRLDALVWALTDLSLNGYAKPQLKLAYSSAKGLI |
Ga0209937_10417282 | 3300026094 | Pond Water | YEPLGKHKSPDRYDALVWALTDLMLKGFAKPKLQLVYSNAKGLR |
Ga0209923_10132443 | 3300026105 | Pond Water | LGKHKSPDRYDALVWALTDLMLKGFAKPKLQLVYSNAKGLR |
Ga0209964_10164641 | 3300026172 | Pond Soil | PDRYDALVWALTDLMLKGFAKPKLQLVYSNAKGLR |
Ga0247578_10388632 | 3300026458 | Seawater | SPDRLDALVWAITDLSLNGYAKPKLTLAYSSAKGLSQK |
Ga0247605_10881371 | 3300026503 | Seawater | PLGSIGSPDRLDALVWAITDLSLNGYAKPTLKLAYSSAKGLR |
Ga0255277_11156842 | 3300026569 | Freshwater | LDAMVWAVTELALKGIARPDLNLAYSDVKGLSLRI |
Ga0208020_10071416 | 3300027159 | Estuarine | EPLGRHKSPDRYDALVWALTDLMLNGYSKPKLQLVYSNTKGLR |
Ga0209192_100659281 | 3300027752 | Marine | PLGSMGSQDRLDAMVWAITDLSLNGYAKPQLKLAYSSAKGLL |
Ga0209635_102028021 | 3300027888 | Marine Sediment | IGSPDRLDACVWAITDLSLNGYAKPKLTLAYSSAKGLSQK |
Ga0247584_11648032 | 3300028110 | Seawater | SPDRLDALVWAITDLSLNGYAKPTLKLAYSSAKGLR |
Ga0233450_103993432 | 3300028115 | Salt Marsh | SPDRLDACVWALTDLMLNGVSTPNLRLTYADAKGLESEIYLG |
Ga0256368_10358761 | 3300028125 | Sea-Ice Brine | RVGSPDRLDAMVWAITDLSLNGYSKPQLTLAYSSAKGLSK |
Ga0257126_12053981 | 3300028287 | Marine | PDRLDACVWAITDLSLNGYAKPKLTLAYSSAKGLSQK |
Ga0307974_11434652 | 3300031211 | Saline Water | PDRLDAMVWAITDLMLKGIARPQLRLAYSDAKGILNK |
Ga0307983_10147133 | 3300031269 | Saline Water | PDRLDALVWALTDLMLGGVARPQLSLSYKTAKEAVV |
Ga0307930_12059772 | 3300031600 | Saline Water | RLDAMVWAITDLMLKGIARPQLRLAYSDAKGILNK |
Ga0308014_10303782 | 3300031628 | Marine | TWEPLGRIGSPDRLDAMVWAITDLSLNGYAKPKLTLAYSSAKGLSK |
Ga0316201_105319681 | 3300032136 | Worm Burrow | EPLGSIGSPDRLDALVWAITDLSLQGYAKPQLKLAYSSAKGLR |
Ga0316194_104274831 | 3300032262 | Sediment | QWEPLGSIGSPDRLDALVWAITDLSLNGYAKPQLKLAYSSAKGLI |
Ga0348337_174995_456_569 | 3300034418 | Aqueous | GSPDRLDALVWAITDLSLQGYAKPQLKLAYSSAKGLR |
⦗Top⦘ |