NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300032970

3300032970: Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300032970 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128851 | Gp0330570 | Ga0314716
Sample NameMetatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size59336469
Sequencing Scaffolds19
Novel Protein Genes22
Associated Families20

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida1
Not Available6
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum4
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePhyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa
TypeHost-Associated
TaxonomyHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Michigan
CoordinatesLat. (o)42.3951Long. (o)-85.3736Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000459Metagenome / Metatranscriptome1109Y
F007513Metagenome / Metatranscriptome349Y
F018302Metagenome / Metatranscriptome235Y
F025200Metagenome / Metatranscriptome202Y
F029306Metagenome / Metatranscriptome188Y
F032897Metagenome / Metatranscriptome178Y
F034039Metagenome / Metatranscriptome175Y
F034784Metagenome / Metatranscriptome173Y
F035610Metagenome / Metatranscriptome171Y
F038063Metagenome / Metatranscriptome166Y
F054498Metagenome / Metatranscriptome139Y
F057814Metagenome / Metatranscriptome135Y
F060513Metagenome / Metatranscriptome132Y
F062378Metagenome / Metatranscriptome130Y
F062397Metagenome / Metatranscriptome130Y
F065372Metagenome / Metatranscriptome127Y
F067332Metagenome / Metatranscriptome125N
F068338Metagenome / Metatranscriptome124Y
F070783Metagenome / Metatranscriptome122Y
F096411Metagenome / Metatranscriptome104Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0314716_101387All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida2122Open in IMG/M
Ga0314716_107508Not Available1239Open in IMG/M
Ga0314716_112835All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax986Open in IMG/M
Ga0314716_116787All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum865Open in IMG/M
Ga0314716_117272All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae852Open in IMG/M
Ga0314716_118598Not Available821Open in IMG/M
Ga0314716_119434All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum801Open in IMG/M
Ga0314716_120629All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum776Open in IMG/M
Ga0314716_121135Not Available767Open in IMG/M
Ga0314716_127470All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii665Open in IMG/M
Ga0314716_130731All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum623Open in IMG/M
Ga0314716_131480Not Available614Open in IMG/M
Ga0314716_132263All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays604Open in IMG/M
Ga0314716_133484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum591Open in IMG/M
Ga0314716_135132All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum574Open in IMG/M
Ga0314716_142641Not Available512Open in IMG/M
Ga0314716_142814All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa510Open in IMG/M
Ga0314716_143199All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum508Open in IMG/M
Ga0314716_143769Not Available503Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0314716_101387Ga0314716_1013871F060513MSTTEIPEETGQTASADRSDRSCLVQHTGSTGQTGHPDRSDRSNAEWLQQRLDQYRARTNDMCEAIEDSDDLDKLGQGFTSADPLEKVDIGDGTIPRPTFVNKNLSAEYKTDLVNLLKEYVDCFAW
Ga0314716_107508Ga0314716_1075081F067332VYCHIIILANFGEDEIRRACIIISSCVEFWVVFLVHPILTRSLRAYIAVLKFCAALLSIQLLAIQIIFLEKLDYEKDMRNYRFTYYRNFNDLRGMFIWISRLNLALDPVPSMLIVTTQ
Ga0314716_112835Ga0314716_1128351F032897VDASFTRSHCHQNTIALQYVPSELQLADFFTKAQTREQHRLHMLKLNASDPPPPP
Ga0314716_116787Ga0314716_1167871F018302VPPQQHGEGIFYGGVDGTQAVAPPLPVAARCWHPVVPAAVALPQLGKKKAFAWEDACHVFAAVRLQAAARGLLARRRLQKMRLEMQEAALTAIDLGNWGRNLGKWGRDLVPSEGHQRSRQLAVVFKRALGSELQFYSSDKGGAFLLVIGGGTSPSAITFRHRPPRGRLRWSLLRLISGGDTCPPLSFRWSPWDPGGYLRAGPTQGGCPPHLQESKIKNCSLFKISRDVKGLFLGFRFASSGVIVSVIVRLQLEDELQVQVGCSVRGVKGLLGLNPLGLISRLLRD
Ga0314716_117272Ga0314716_1172722F096411WQGSCSQGWEARKELEPSHLGAQGCHHQYEGISNGVGSKGNLKPKNDFRGFGGLAYKLK
Ga0314716_118598Ga0314716_1185981F062378MAAPKPISXANRINTTLISLNNNLGTLFTLVLGCFPLDIQPYRTMSDNLINI
Ga0314716_119434Ga0314716_1194341F007513VEDSETVMVTVLQRVVALPAVLLVIFNTAMDHGTEALEEVTRHHTFLTMVVVSLAVDGTGDTLCLILLTLL
Ga0314716_120629Ga0314716_1206291F070783ALMDVDVAFDIMDSYMMRITYMLREIELMTLVGVIYIGYIVDMNFTCMLFFIKIW
Ga0314716_121135Ga0314716_1211352F035610MHESTKYLITLIELFVHIDREKHSLRVLTPLETTKDKLRKHVSLKL
Ga0314716_123130Ga0314716_1231301F000459VRNRVLERVDNVKRGRDRPKLTWDESAKRDLKDWNISKDIALDRSAWRLTINVPEP
Ga0314716_127470Ga0314716_1274702F065372VHPTACHSAADCREIQKLAKRVSGRREQSSKDGSPPPRQWPGKEKASDSGAAAGEKELGYQSPARELKGVYHDDDSDSDNGDRRKKLYVMYGGSWELVSRRDVKTLRREVL
Ga0314716_127754Ga0314716_1277541F000459GVLERVDNVKRGRGRPKLTCDESVKRDLKDWNIFKEIALDRSAWRLAINVPEP
Ga0314716_127904Ga0314716_1279042F057814MIEKIGAIHMIKSYGGECRKYPEVPRIKYLVLPKCGTKYQKVGSNINLI
Ga0314716_130731Ga0314716_1307311F034039MVYMYLLFRGTVLDREVQCLKVLGLNLRDPAVVVPDGVQVVANTTLDSAVVFHLTALADHVFPLVVIAFLKWDLICL
Ga0314716_131480Ga0314716_1314801F062397MCMNGLRINMGFGPSFGLWPSSFSVLALDHGPRHFMLQNRPKTCKNEVPPKYMCKCENDQNICANVKMTNN
Ga0314716_132263Ga0314716_1322632F065372VHPTARHSAADCRKIQKLAKRVGGRREQASKDGSPPPRQRSGKEKASDSETAVGEKELGYQSPARDLKGVYSH
Ga0314716_133484Ga0314716_1334841F034784MQSHLQAKGLNVWRVTSEGTKSNSQQEKQYDAIAKCAILNSLGENVFNRVFACENGNVLWKTISENHEGTKDVAIKNYHVLIDKLNSFKQLDDESA
Ga0314716_135132Ga0314716_1351321F054498SQHDPNEALDQISEDNLTLDAPQDEDESTRTARRVRNQHKGERRVQATERARLPPRNLNNKFNNVADPVFRTPIAAMTEAALRLMQMPQNSEMEHVIKLAKNVVEQLERQNPLSSLHGTQSRATATVIPQDK
Ga0314716_142641Ga0314716_1426411F038063ITRTEAFFMASNASYPDVRSMAFSRFIVLLLPTIYEYHVVSVQSRFNLMLILVA
Ga0314716_142814Ga0314716_1428141F068338MEEEICLVDSCTTNTILREVKFFQTLTKREGQVLTIAGRDAMIVGSGRATFILPMGTQIYIEEALLYPDSTCTLLSYRDIRKNEIHVETYEEHNEEFLLFTKNTGYGKQTLEKVPSLPSGLYYTYIK
Ga0314716_143199Ga0314716_1431991F025200LRPLHIGDDILGHPNGVIPTPFLLPNLVSNHLAIGFLLDYIGGAMALVPSVGLGVNERTLDCKLLFVLLIRKLLLWLRELVGLVAFLMAFRESHGGPLLKLLHHASR
Ga0314716_143769Ga0314716_1437692F029306MQTKLNKSKTITIETKLENKANKTGFTIFSLSSKKFYIKPPFGQQARNRNKTLTTSKQTCERVVPLKTTPHKESKKIWFDIFRAVYK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.