| Basic Information | |
|---|---|
| Family ID | F033483 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 177 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VTPGDASVTLDIGGLPVVLVLPERDVELMMWTYRANRILQEGRDDE |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 177 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 77.27 % |
| % of genes near scaffold ends (potentially truncated) | 31.64 % |
| % of genes from short scaffolds (< 2000 bps) | 84.75 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (68.362 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (20.904 % of family members) |
| Environment Ontology (ENVO) | Unclassified (91.525 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (41.243 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.38% β-sheet: 21.62% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 177 Family Scaffolds |
|---|---|---|
| PF14359 | DUF4406 | 16.95 |
| PF00145 | DNA_methylase | 5.65 |
| PF01555 | N6_N4_Mtase | 5.65 |
| PF06467 | zf-FCS | 3.39 |
| PF01507 | PAPS_reduct | 2.82 |
| PF08706 | D5_N | 1.69 |
| PF09250 | Prim-Pol | 1.13 |
| PF03837 | RecT | 0.56 |
| PF11367 | DUF3168 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 177 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 5.65 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 5.65 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 5.65 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 5.65 |
| COG3723 | Recombinational DNA repair protein RecT | Replication, recombination and repair [L] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.31 % |
| Unclassified | root | N/A | 14.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2209111018|Meso_c270008 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 510 | Open in IMG/M |
| 2209111018|Meso_c362457 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 500 | Open in IMG/M |
| 2209111018|Meso_c606390 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 850 | Open in IMG/M |
| 2209111018|Meso_c951820 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 513 | Open in IMG/M |
| 3300000482|Lynggard_1016058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2126 | Open in IMG/M |
| 3300001592|Draft_10121020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1172 | Open in IMG/M |
| 3300001594|Draft_10237168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Priestia → Priestia megaterium | 695 | Open in IMG/M |
| 3300001754|CSTRM28_101259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1920 | Open in IMG/M |
| 3300001756|CSTRM20_101624 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 4811 | Open in IMG/M |
| 3300001761|CSTRM36_1000578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2024 | Open in IMG/M |
| 3300001975|Draft_10088768 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 501 | Open in IMG/M |
| 3300001975|Draft_10951820 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 517 | Open in IMG/M |
| 3300002163|JGI24707J26582_10057191 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1384 | Open in IMG/M |
| 3300002163|JGI24707J26582_10090909 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300002163|JGI24707J26582_10153685 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 631 | Open in IMG/M |
| 3300002163|JGI24707J26582_10168452 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 590 | Open in IMG/M |
| 3300002163|JGI24707J26582_10192702 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 535 | Open in IMG/M |
| 3300002164|JGI24708J26588_10200536 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 516 | Open in IMG/M |
| 3300002167|JGI24714J26587_10008288 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 5296 | Open in IMG/M |
| 3300002168|JGI24712J26585_10085574 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1120 | Open in IMG/M |
| 3300002168|JGI24712J26585_10226008 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 507 | Open in IMG/M |
| 3300002170|JGI24711J26586_10034970 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1849 | Open in IMG/M |
| 3300002170|JGI24711J26586_10127248 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 658 | Open in IMG/M |
| 3300002173|JGI24709J26583_10109964 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 868 | Open in IMG/M |
| 3300002173|JGI24709J26583_10176360 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 595 | Open in IMG/M |
| 3300002174|JGI24710J26742_10135530 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 783 | Open in IMG/M |
| 3300002392|JGI24503J29689_10031906 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 544 | Open in IMG/M |
| 3300002406|JGI24499J29688_1013373 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 765 | Open in IMG/M |
| 3300002406|JGI24499J29688_1020379 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 630 | Open in IMG/M |
| 3300002406|JGI24499J29688_1020380 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 889 | Open in IMG/M |
| 3300002446|NAPDCCLC_10001433 | All Organisms → cellular organisms → Bacteria | 10983 | Open in IMG/M |
| 3300002898|draft_10165893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 1347 | Open in IMG/M |
| 3300002898|draft_10477958 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 557 | Open in IMG/M |
| 3300003306|Ga0004534J46558_1002758 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1506 | Open in IMG/M |
| 3300003306|Ga0004534J46558_1030263 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 832 | Open in IMG/M |
| 3300003306|Ga0004534J46558_1035094 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 835 | Open in IMG/M |
| 3300003667|LSCM3L_1026703 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 960 | Open in IMG/M |
| 3300003667|LSCM3L_1037802 | Not Available | 732 | Open in IMG/M |
| 3300005835|Ga0078910_100679 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 9012 | Open in IMG/M |
| 3300005835|Ga0078910_102306 | All Organisms → cellular organisms → Bacteria | 6824 | Open in IMG/M |
| 3300005835|Ga0078910_102382 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 7861 | Open in IMG/M |
| 3300005835|Ga0078910_102406 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 7500 | Open in IMG/M |
| 3300005835|Ga0078910_102622 | All Organisms → Viruses → Predicted Viral | 4287 | Open in IMG/M |
| 3300005835|Ga0078910_102623 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 2992 | Open in IMG/M |
| 3300005835|Ga0078910_117186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Thermoactinomycetaceae | 1785 | Open in IMG/M |
| 3300005835|Ga0078910_124576 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1191 | Open in IMG/M |
| 3300005835|Ga0078910_140420 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1163 | Open in IMG/M |
| 3300006225|Ga0082206_102023 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 3475 | Open in IMG/M |
| 3300006225|Ga0082206_102086 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin009 | 4734 | Open in IMG/M |
| 3300006225|Ga0082206_102095 | All Organisms → cellular organisms → Bacteria | 5035 | Open in IMG/M |
| 3300006225|Ga0082206_139722 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 801 | Open in IMG/M |
| 3300006482|Ga0100242_108075 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 27823 | Open in IMG/M |
| 3300006483|Ga0100240_111112 | Not Available | 1009 | Open in IMG/M |
| 3300006801|Ga0079223_10884034 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 565 | Open in IMG/M |
| 3300006801|Ga0079223_10932298 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 548 | Open in IMG/M |
| 3300006805|Ga0075464_10113603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Pseudodesulfovibrio → Pseudodesulfovibrio profundus | 1567 | Open in IMG/M |
| 3300009121|Ga0118671_1073699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 927 | Open in IMG/M |
| 3300009121|Ga0118671_1079290 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 884 | Open in IMG/M |
| 3300009121|Ga0118671_1097716 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 772 | Open in IMG/M |
| 3300009121|Ga0118671_1099683 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 762 | Open in IMG/M |
| 3300009121|Ga0118671_1102609 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 748 | Open in IMG/M |
| 3300009121|Ga0118671_1105722 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 732 | Open in IMG/M |
| 3300009122|Ga0118674_1027130 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1504 | Open in IMG/M |
| 3300009122|Ga0118674_1056173 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 933 | Open in IMG/M |
| 3300009122|Ga0118674_1066571 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 835 | Open in IMG/M |
| 3300009122|Ga0118674_1093344 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 671 | Open in IMG/M |
| 3300009122|Ga0118674_1118046 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 571 | Open in IMG/M |
| 3300009360|Ga0118672_1032352 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1567 | Open in IMG/M |
| 3300009360|Ga0118672_1035833 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1464 | Open in IMG/M |
| 3300009360|Ga0118672_1042141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1319 | Open in IMG/M |
| 3300009360|Ga0118672_1049158 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1197 | Open in IMG/M |
| 3300009360|Ga0118672_1095959 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 779 | Open in IMG/M |
| 3300009362|Ga0118673_1012746 | Not Available | 3381 | Open in IMG/M |
| 3300009362|Ga0118673_1029709 | Not Available | 1888 | Open in IMG/M |
| 3300009362|Ga0118673_1064120 | Not Available | 1109 | Open in IMG/M |
| 3300009362|Ga0118673_1091371 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 866 | Open in IMG/M |
| 3300009362|Ga0118673_1180028 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 532 | Open in IMG/M |
| 3300009540|Ga0073899_10658144 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 757 | Open in IMG/M |
| 3300009588|Ga0116232_1150281 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 684 | Open in IMG/M |
| 3300009607|Ga0123327_1102672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1028 | Open in IMG/M |
| 3300009607|Ga0123327_1219495 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 614 | Open in IMG/M |
| 3300009642|Ga0123331_1232364 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 549 | Open in IMG/M |
| 3300009647|Ga0123326_1078166 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1147 | Open in IMG/M |
| 3300009647|Ga0123326_1129657 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 814 | Open in IMG/M |
| 3300009647|Ga0123326_1235721 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 554 | Open in IMG/M |
| 3300009652|Ga0123330_1263030 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 592 | Open in IMG/M |
| 3300009655|Ga0116190_1242372 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 599 | Open in IMG/M |
| 3300009656|Ga0123329_1114659 | Not Available | 1042 | Open in IMG/M |
| 3300009656|Ga0123329_1118964 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300009656|Ga0123329_1324274 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 532 | Open in IMG/M |
| 3300009657|Ga0116179_1238745 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 602 | Open in IMG/M |
| 3300009657|Ga0116179_1292671 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 530 | Open in IMG/M |
| 3300009659|Ga0123328_1147852 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 925 | Open in IMG/M |
| 3300009659|Ga0123328_1308354 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 577 | Open in IMG/M |
| 3300009666|Ga0116182_1132021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Pseudodesulfovibrio → Pseudodesulfovibrio profundus | 1199 | Open in IMG/M |
| 3300009666|Ga0116182_1150038 | Not Available | 1094 | Open in IMG/M |
| 3300009667|Ga0116147_1285870 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 624 | Open in IMG/M |
| 3300009669|Ga0116148_1145174 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1089 | Open in IMG/M |
| 3300009669|Ga0116148_1182218 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 928 | Open in IMG/M |
| 3300009669|Ga0116148_1311447 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 642 | Open in IMG/M |
| 3300009671|Ga0123334_1178977 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 990 | Open in IMG/M |
| 3300009671|Ga0123334_1206599 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 898 | Open in IMG/M |
| 3300009675|Ga0116149_1409413 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 563 | Open in IMG/M |
| 3300009675|Ga0116149_1464683 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 517 | Open in IMG/M |
| 3300009681|Ga0116174_10178448 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1087 | Open in IMG/M |
| 3300009682|Ga0116172_10171902 | Not Available | 1143 | Open in IMG/M |
| 3300009687|Ga0116144_10538716 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 572 | Open in IMG/M |
| 3300009707|Ga0116195_1017969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2203 | Open in IMG/M |
| 3300009770|Ga0123332_1325798 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 616 | Open in IMG/M |
| 3300009773|Ga0123333_10379132 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 576 | Open in IMG/M |
| 3300009780|Ga0116156_10489364 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 585 | Open in IMG/M |
| 3300009781|Ga0116178_10609591 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 528 | Open in IMG/M |
| 3300010340|Ga0116250_10555547 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 644 | Open in IMG/M |
| 3300010340|Ga0116250_10740648 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 533 | Open in IMG/M |
| 3300010344|Ga0116243_10199104 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1342 | Open in IMG/M |
| 3300010346|Ga0116239_10292496 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1147 | Open in IMG/M |
| 3300010351|Ga0116248_10851040 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 631 | Open in IMG/M |
| 3300010353|Ga0116236_11539968 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 500 | Open in IMG/M |
| 3300010355|Ga0116242_10752823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae | 859 | Open in IMG/M |
| 3300014203|Ga0172378_10348188 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin009 | 1130 | Open in IMG/M |
| 3300014203|Ga0172378_10466753 | Not Available | 945 | Open in IMG/M |
| 3300014203|Ga0172378_10868425 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 650 | Open in IMG/M |
| 3300014203|Ga0172378_11114340 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 561 | Open in IMG/M |
| 3300014204|Ga0172381_10285844 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1310 | Open in IMG/M |
| 3300014204|Ga0172381_10438800 | Not Available | 1017 | Open in IMG/M |
| 3300014204|Ga0172381_10830357 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 691 | Open in IMG/M |
| 3300014206|Ga0172377_10529320 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 957 | Open in IMG/M |
| 3300014206|Ga0172377_10593282 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 891 | Open in IMG/M |
| 3300014206|Ga0172377_11359169 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 535 | Open in IMG/M |
| 3300014206|Ga0172377_11362114 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 535 | Open in IMG/M |
| 3300015214|Ga0172382_10515556 | Not Available | 872 | Open in IMG/M |
| 3300015214|Ga0172382_10818028 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 636 | Open in IMG/M |
| 3300019239|Ga0180030_1048135 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 696 | Open in IMG/M |
| 3300020072|Ga0180031_1260000 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 550 | Open in IMG/M |
| 3300025393|Ga0208041_1005270 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 4488 | Open in IMG/M |
| 3300025618|Ga0208693_1059138 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1265 | Open in IMG/M |
| 3300025618|Ga0208693_1096560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 849 | Open in IMG/M |
| 3300025657|Ga0208823_1128362 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 733 | Open in IMG/M |
| 3300025657|Ga0208823_1181833 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 556 | Open in IMG/M |
| 3300025677|Ga0209719_1094233 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 918 | Open in IMG/M |
| 3300025677|Ga0209719_1115350 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 788 | Open in IMG/M |
| 3300025677|Ga0209719_1128770 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 725 | Open in IMG/M |
| 3300025708|Ga0209201_1170264 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 694 | Open in IMG/M |
| 3300025708|Ga0209201_1222243 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 564 | Open in IMG/M |
| 3300025714|Ga0208458_1067836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Pseudodesulfovibrio → Pseudodesulfovibrio profundus | 1348 | Open in IMG/M |
| 3300025730|Ga0209606_1058245 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1660 | Open in IMG/M |
| 3300026194|Ga0209509_1031917 | All Organisms → Viruses → Predicted Viral | 1530 | Open in IMG/M |
| 3300026194|Ga0209509_1033735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1469 | Open in IMG/M |
| 3300026194|Ga0209509_1048724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1122 | Open in IMG/M |
| 3300026194|Ga0209509_1055532 | Not Available | 1021 | Open in IMG/M |
| 3300026194|Ga0209509_1059948 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 966 | Open in IMG/M |
| 3300026195|Ga0209312_1006135 | Not Available | 6202 | Open in IMG/M |
| 3300026198|Ga0209313_1038663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1247 | Open in IMG/M |
| 3300026252|Ga0209722_1066983 | Not Available | 1146 | Open in IMG/M |
| 3300026252|Ga0209722_1069286 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300026252|Ga0209722_1090096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 918 | Open in IMG/M |
| 3300026290|Ga0209510_1102430 | Not Available | 1028 | Open in IMG/M |
| (restricted) 3300028564|Ga0255344_1288529 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 587 | Open in IMG/M |
| (restricted) 3300028568|Ga0255345_1059455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Thermoactinomycetaceae | 2069 | Open in IMG/M |
| 3300028602|Ga0265294_10022822 | Not Available | 6341 | Open in IMG/M |
| 3300028602|Ga0265294_10099506 | Not Available | 2337 | Open in IMG/M |
| 3300028602|Ga0265294_10565057 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 676 | Open in IMG/M |
| 3300028602|Ga0265294_10634009 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 622 | Open in IMG/M |
| 3300028602|Ga0265294_10743216 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 553 | Open in IMG/M |
| 3300028602|Ga0265294_10849897 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 501 | Open in IMG/M |
| 3300028603|Ga0265293_10041525 | Not Available | 4447 | Open in IMG/M |
| 3300028603|Ga0265293_10376543 | Not Available | 866 | Open in IMG/M |
| 3300028603|Ga0265293_10594476 | Not Available | 616 | Open in IMG/M |
| 3300028626|Ga0302244_1028306 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1390 | Open in IMG/M |
| 3300028627|Ga0302243_1004878 | Not Available | 6089 | Open in IMG/M |
| 3300028629|Ga0302248_1101313 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 571 | Open in IMG/M |
| 3300028638|Ga0302240_1043699 | Not Available | 1240 | Open in IMG/M |
| 3300029781|Ga0167330_1066458 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 544 | Open in IMG/M |
| 3300029822|Ga0134854_1004180 | Not Available | 8837 | Open in IMG/M |
| 3300029822|Ga0134854_1045038 | Not Available | 1030 | Open in IMG/M |
| 3300029824|Ga0134852_100799 | Not Available | 2279 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 20.90% |
| Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 16.95% |
| Anaerobic Wastewater Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Wastewater Sludge | 11.86% |
| Biogas Fermentantion | Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion | 11.86% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 6.78% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 5.65% |
| Biogas Reactor | Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Biogas Reactor | 5.08% |
| Solid Waste From Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Solid Waste From Bioreactor | 2.26% |
| Activated Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge | 2.26% |
| Mixed Substrate Biogas Reactor | Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Mixed Substrate Biogas Reactor | 2.26% |
| Wastewater | Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater | 1.69% |
| Fermentation Pit Mud | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud | 1.69% |
| Coalbed Water | Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water | 1.13% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 1.13% |
| Manure | Engineered → Solid Waste → Animal Waste → Unclassified → Unclassified → Manure | 1.13% |
| Biogas Fermenter | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Biogas Fermenter | 1.13% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 1.13% |
| Biogas Fermenter | Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Biogas Fermenter | 1.13% |
| Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 1.13% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.56% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.56% |
| Biosolids | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids | 0.56% |
| Hydrocarbon Resource Environments | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments | 0.56% |
| Anaerobic Digester | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2209111018 | Mesophilic bioreactor microbial communities at Bielefeld, Germany | Engineered | Open in IMG/M |
| 3300000482 | Anaerobic digester microbial communities from Northern Denmark, sample from Lynggard manure | Engineered | Open in IMG/M |
| 3300001592 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April2: | Engineered | Open in IMG/M |
| 3300001594 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April2: | Engineered | Open in IMG/M |
| 3300001754 | Wastewater microbial communities from Belvaux, Luxembourg - M28 | Engineered | Open in IMG/M |
| 3300001756 | Wastewater microbial communities from Belvaux, Luxembourg - M20 | Engineered | Open in IMG/M |
| 3300001761 | Wastewater microbial communities from Belvaux, Luxembourg - M36 | Engineered | Open in IMG/M |
| 3300001975 | Biogas fermenter microbial communities from the University of Hamburg, Germany | Engineered | Open in IMG/M |
| 3300002163 | Biogas fermentation microbial communities from Germany - Plant 1 DNA1 | Engineered | Open in IMG/M |
| 3300002164 | Biogas fermentation microbial communities from Germany - Plant 1 DNA2 | Engineered | Open in IMG/M |
| 3300002167 | Biogas fermentation microbial communities from Germany - Plant 4 DNA2 | Engineered | Open in IMG/M |
| 3300002168 | Biogas fermentation microbial communities from Germany - Plant 3 DNA2 | Engineered | Open in IMG/M |
| 3300002170 | Biogas fermentation microbial communities from Germany - Plant 3 DNA1 | Engineered | Open in IMG/M |
| 3300002173 | Biogas fermentation microbial communities from Germany - Plant 2 DNA1 | Engineered | Open in IMG/M |
| 3300002174 | Biogas fermentation microbial communities from Germany - Plant 2 DNA2 | Engineered | Open in IMG/M |
| 3300002392 | Biogas fermentation microbial communities from Germany - Plant 3 RNA2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300002406 | Biogas fermentation microbial communities from Germany - Plant 1 RNA2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300002446 | Oil sands microbial community from Northern Alberta which degrade Naphthaline | Engineered | Open in IMG/M |
| 3300002898 | Metagenome Biopara biogasfermenter May 2013 pooled | Engineered | Open in IMG/M |
| 3300003306 | Biogas fermentation microbial communities from Germany - Plant 1 RNA1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300003667 | Lithgow State Coal Mine Metagenomic Study (LSCM 3 Late (Sample 2)) | Environmental | Open in IMG/M |
| 3300005835 | Biogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 1 to 3 kb reads | Engineered | Open in IMG/M |
| 3300006225 | Biogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 99 accuracy | Engineered | Open in IMG/M |
| 3300006482 | Microbial communities from pig manure storage tank from Sherbrooke, QC, Canada, enriched culture C10 | Engineered | Open in IMG/M |
| 3300006483 | Microbial communities from pig manure storage tank from Sherbrooke, QC, Canada, enriched culture C4 | Engineered | Open in IMG/M |
| 3300006801 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2011 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009121 | Syntrophic microbial communities from biogas reactors in Seattle, WA - R1.C12.But.A IDBA | Engineered | Open in IMG/M |
| 3300009122 | Syntrophic microbial communities from biogas reactors in Seattle, WA - R1.C13.But.B IBDA | Engineered | Open in IMG/M |
| 3300009360 | Syntrophic microbial communities from biogas reactors in Seattle, WA - R1.C12.But.B IBDA | Engineered | Open in IMG/M |
| 3300009362 | Syntrophic microbial communities from biogas reactors - R1.C13.But.A IBDA | Engineered | Open in IMG/M |
| 3300009540 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Ph | Engineered | Open in IMG/M |
| 3300009588 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A SIP RNA (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300009607 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009642 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009647 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009652 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009655 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG | Engineered | Open in IMG/M |
| 3300009656 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C12 SIP DNA | Engineered | Open in IMG/M |
| 3300009657 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC071_MetaG | Engineered | Open in IMG/M |
| 3300009659 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C12 SIP DNA | Engineered | Open in IMG/M |
| 3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
| 3300009667 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG | Engineered | Open in IMG/M |
| 3300009669 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG | Engineered | Open in IMG/M |
| 3300009671 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA | Engineered | Open in IMG/M |
| 3300009674 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaG | Engineered | Open in IMG/M |
| 3300009675 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG | Engineered | Open in IMG/M |
| 3300009681 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG | Engineered | Open in IMG/M |
| 3300009682 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG | Engineered | Open in IMG/M |
| 3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
| 3300009707 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU002_MetaG | Engineered | Open in IMG/M |
| 3300009770 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A C12 SIP DNA | Engineered | Open in IMG/M |
| 3300009773 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B C12 SIP DNA | Engineered | Open in IMG/M |
| 3300009780 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG | Engineered | Open in IMG/M |
| 3300009781 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaG | Engineered | Open in IMG/M |
| 3300010340 | AD_USOAca | Engineered | Open in IMG/M |
| 3300010344 | AD_JPASca | Engineered | Open in IMG/M |
| 3300010346 | AD_USMOca | Engineered | Open in IMG/M |
| 3300010351 | AD_USPNca | Engineered | Open in IMG/M |
| 3300010353 | AD_USCAca | Engineered | Open in IMG/M |
| 3300010355 | AD_USDVca | Engineered | Open in IMG/M |
| 3300014203 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaG | Environmental | Open in IMG/M |
| 3300014204 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG | Engineered | Open in IMG/M |
| 3300014206 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaG | Engineered | Open in IMG/M |
| 3300015214 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R metaG | Engineered | Open in IMG/M |
| 3300019239 | Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R2-A RNA time zero (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300020072 | Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R2-B RNA time zero (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300025393 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU002_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025618 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC071_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025657 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC075_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025677 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025714 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025730 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300026194 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026195 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026198 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B C13 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026252 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C12 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026290 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300028564 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant18 | Engineered | Open in IMG/M |
| 3300028568 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant20 | Engineered | Open in IMG/M |
| 3300028602 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 | Environmental | Open in IMG/M |
| 3300028603 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R | Engineered | Open in IMG/M |
| 3300028626 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Phe | Engineered | Open in IMG/M |
| 3300028627 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Met | Engineered | Open in IMG/M |
| 3300028629 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Leu | Engineered | Open in IMG/M |
| 3300028638 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_His | Engineered | Open in IMG/M |
| 3300029781 | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP11 - Uppsala-digested 112 | Engineered | Open in IMG/M |
| 3300029822 | Liquor fermentation pit mud microbial communities from Chengdu, China - Meta-7-3-30-T | Engineered | Open in IMG/M |
| 3300029824 | Liquor fermentation pit mud microbial communities from Chengdu, China - Meta-7-1-30-B | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Meso_2700082 | 2209111018 | Solid Waste From Bioreactor | VTPGDASVTLDXGGLPVVLVLPERDVELMMWTXRANRILQAG |
| Meso_3624572 | 2209111018 | Solid Waste From Bioreactor | VTPGDASVTLDIGGLPVVLVLPERDVELMMWPYQVHRILQVGARR |
| Meso_6063901 | 2209111018 | Solid Waste From Bioreactor | IDGLPVVLVLPERDVELMMWTYWVNRILQEGCGDE |
| Meso_9518202 | 2209111018 | Solid Waste From Bioreactor | VTPGDASVTLDIDGLPVVLALPERDVELMMWTYRANRILQEGRDDE |
| Lynggard_10160584 | 3300000482 | Anaerobic Digester | VTPGDACVALDIDGLPVVLVLPERDVELMMWPYWVNRILQEGHGDE* |
| Draft_101210201 | 3300001592 | Hydrocarbon Resource Environments | ALDIDGLPVQLVLPERDVELMMWPYRANRILQEGRDDE* |
| Draft_102371682 | 3300001594 | Hydrocarbon Resource Environments | VTPGDACVALDIDGLPVQLVLPERDVELMMWTYRANRILQEGRGDE* |
| CSTRM28_1012595 | 3300001754 | Wastewater | VTPSDASVAIDIDGLPVVLVLPERDVELMMWLYRANRILQEGRGDE* |
| CSTRM20_1016248 | 3300001756 | Wastewater | VTSGDACVALDIGGLPVVLVLPERDVELMMWLYQVHCILQEGCGDE* |
| CSTRM36_10005782 | 3300001761 | Wastewater | VTSGDACVALDIGGLPVVLVLPERDVELMMWLYRANRILQEGCGDE* |
| Draft_100887681 | 3300001975 | Biogas Fermenter | VTSGDACVTLDINGLPVVLVLPERDVELMMWTYRANRILQEGRD* |
| Draft_109518202 | 3300001975 | Biogas Fermenter | VTPGDASVTLDIDGLPVVLALPERDVELMMWTYRANRILQEGRDDE* |
| JGI24707J26582_100571914 | 3300002163 | Biogas Fermentantion | DIDGLPVQLVLPERDVELMMWTYRANRILQEGCGDE* |
| JGI24707J26582_100909093 | 3300002163 | Biogas Fermentantion | VTPGDASVTLDIXGLPVQLVLPERDVELMMWTYRANRILQEG |
| JGI24707J26582_101536852 | 3300002163 | Biogas Fermentantion | VTPGDASVSFDIDGLPVVLVLPERDVELXMWLYQVHCILQEGCGDE* |
| JGI24707J26582_101684522 | 3300002163 | Biogas Fermentantion | VSVTSGDASVTLDIGGLPVVLVLPERDVELMMWTYRANRILQEGRGDE* |
| JGI24707J26582_101927022 | 3300002163 | Biogas Fermentantion | VTSGNACVALDIDGLPVVLVLPERDVELMMWPYQVHYILQEGRDDE* |
| JGI24708J26588_102005361 | 3300002164 | Biogas Fermentantion | GDASVALDIDGLPVVLVLPERDVELMMWTYRANRILQEGRDDE* |
| JGI24714J26587_100082882 | 3300002167 | Biogas Fermentantion | VTPGDACIALDIDGLPVVLVLPERDVELMMWTYRANRILQEGRDDE* |
| JGI24712J26585_100855742 | 3300002168 | Biogas Fermentantion | VTPGDASVSFDIDGLPVVLVLPERDVELVMWLYQVHYILQEGRGDE* |
| JGI24712J26585_102260082 | 3300002168 | Biogas Fermentantion | VTPGDASVTLDIXGLPVVLVLPERDVELMMWTYRANRILQEGRGDE* |
| JGI24711J26586_100349706 | 3300002170 | Biogas Fermentantion | VTPGDASVSFDIDGLPVVLALPERDVELMMWTYRANRILQEGRGDE* |
| JGI24711J26586_101272481 | 3300002170 | Biogas Fermentantion | VTPGDASVAIDIDGLVVVLVLPERDVELMMWPCWVNRILQEGCDDE* |
| JGI24709J26583_101099644 | 3300002173 | Biogas Fermentantion | VTTGDASVTLDIDGLPVQLVLPERDVELMVWTYRANRILQEGRGDE* |
| JGI24709J26583_101763603 | 3300002173 | Biogas Fermentantion | VTPGDASVTLDIDGLPVVLVLPERDVELMMWPYRVHYILQEGCGDE* |
| JGI24710J26742_101355303 | 3300002174 | Biogas Fermentantion | VTPGDASVTLDIGGLPVVLVLPERDVELMMWTXRANRILQEGRDDE* |
| JGI24503J29689_100319062 | 3300002392 | Biogas Fermentantion | VTPGDASVTLDIDGLPVELVLPERDVELMMWTYRANRILQEGRDDE* |
| JGI24499J29688_10133733 | 3300002406 | Biogas Fermentantion | VTPGDASVSFDIDGLPVVLVLPERDVELMMWPYQVHYILQEGCGDE* |
| JGI24499J29688_10203791 | 3300002406 | Biogas Fermentantion | DGAGGVGVTPGDASVTLDIGGLPVVLVLPERDVELMMWTYRANRILQEGRDDE* |
| JGI24499J29688_10203801 | 3300002406 | Biogas Fermentantion | PGDASVTLDIGGLPVVLVLPERDVELMMWTYRANRILQEGRDDE* |
| NAPDCCLC_100014335 | 3300002446 | Hydrocarbon Resource Environments | MTPGDASVSFDIDGLPVVLVLPERDVELMMWPYQVRYILQEGRDDE* |
| draft_101658931 | 3300002898 | Biogas Fermenter | VTPGDACVALDIDGLPVVLVLPERDVELMMWPYRVHHILQEGRGDE* |
| draft_104779582 | 3300002898 | Biogas Fermenter | VTPGDASVSFDIDGLPVVLVLPEHDVELMMWPYWVNRILQEGCGDE* |
| Ga0004534J46558_10027584 | 3300003306 | Biogas Fermentantion | VTPGDASVTLDIGGLPVVLVLPERDVDLMMWTYRANRILQEGRGDE* |
| Ga0004534J46558_10302633 | 3300003306 | Biogas Fermentantion | VTPGDACVALDIDGLPVVLVLPERDVELMMWPYWVNRILQEGH |
| Ga0004534J46558_10350943 | 3300003306 | Biogas Fermentantion | MTPGDASVAIDIDGLLVVLVLPERDVELMMWPCWVNRILQEGRDDE* |
| LSCM3L_10267033 | 3300003667 | Coalbed Water | VTSGDACVTLDIDGLPVQLMLPERDVELMMWTYRANRILQEGRGDE* |
| LSCM3L_10378023 | 3300003667 | Coalbed Water | TGGAGVTSGDASVSFDIDGLPVQLVLPERDVELMMWTYRANRILQEGRGDE* |
| Ga0078910_10067912 | 3300005835 | Biogas Reactor | VTPGDASVTLDIGGLPVVLVLPERDVELMMWTYRANRILQEGRDDE* |
| Ga0078910_10230610 | 3300005835 | Biogas Reactor | VTPGDASVSFDIDGLPVQLVLPERDVDLMMWTYRANRILQEGRDDE* |
| Ga0078910_10238215 | 3300005835 | Biogas Reactor | VTPGDASVTLDIDGLPVVLVLPERDVDLMMWTYRANRILQEGRDDE* |
| Ga0078910_10240610 | 3300005835 | Biogas Reactor | VTPGDASVSFDIDGLPVVLVLPERDVELMMWTYRANRILQEGRDDE* |
| Ga0078910_1026224 | 3300005835 | Biogas Reactor | VTPGDASVXXDIXGLXVVLVLPERDVELMMWTYXANRILQEGRDDE* |
| Ga0078910_1026236 | 3300005835 | Biogas Reactor | VTPGDASVTLDIDGLPVQLVLPERDVDLMMWTYRANRILQEGRDDE* |
| Ga0078910_1171865 | 3300005835 | Biogas Reactor | VTSGDACVTLDIGGLPVVLVLPERDVELMMWTYRANRILQEGRDDE* |
| Ga0078910_1245762 | 3300005835 | Biogas Reactor | VGVTSGDACVVLDIDGLPVTLVLPERDVELMMWTYRANRILQEGRDDE* |
| Ga0078910_1404202 | 3300005835 | Biogas Reactor | MTPGDASVTLDIGGLPVVLVLPERDVELMMWTYRANRILQEGARR* |
| Ga0082206_1020233 | 3300006225 | Mixed Substrate Biogas Reactor | VTPGDASVTLDIXGLPVVLVLPERDVXLMMWTYRANRILQEGRDDE* |
| Ga0082206_1020866 | 3300006225 | Mixed Substrate Biogas Reactor | VTPGDASVTLDIGGLPVVLVLPERDVDLMMWTYRANRILQEGRDDE* |
| Ga0082206_1020952 | 3300006225 | Mixed Substrate Biogas Reactor | VTPGDASVTLDIDGLPVQLVLPERDVDLMMWTYRVNRILQEGRDDE* |
| Ga0082206_1397222 | 3300006225 | Mixed Substrate Biogas Reactor | VTSGDACVTLDIDGLPVVLVLPERDVELMMWTYRANHILQEGRDDE* |
| Ga0100242_1080755 | 3300006482 | Manure | VTSGDASVSFDIDGLPVELVLPECCIEAMGCAYRASCILQEGRGDE* |
| Ga0100240_1111121 | 3300006483 | Manure | VTPGDACVALDIDGLPVVLVLPERDAELIMWPYWANRILQEGRGDE* |
| Ga0079223_108840342 | 3300006801 | Agricultural Soil | VTPGDASVSFDIDGLPVVLVLPERDVELIMWLYQVHCILQEGR |
| Ga0079223_109322982 | 3300006801 | Agricultural Soil | VTSGDTCVTINIDGLPVQLVLPERDVELMMWTYRANRILQEGRDDE* |
| Ga0075464_101136034 | 3300006805 | Aqueous | VTPGDASVSFDIDGLPVQLVLPERDVELMMWTYRANRILQEGRDDE* |
| Ga0118671_10736992 | 3300009121 | Anaerobic Wastewater Sludge | VTLDIGGLPVVLVLPERDVELMMWTYRANRILQEGRDDE* |
| Ga0118671_10792902 | 3300009121 | Anaerobic Wastewater Sludge | VTPGDASVSFDIDGLPVVLVLPERDVELMMWPYQVHYTLQEGRGDE* |
| Ga0118671_10977162 | 3300009121 | Anaerobic Wastewater Sludge | VTSSDASVSFDIDGLPVVLVLPERDVEMIMWLYQVHCILQEGCGDE* |
| Ga0118671_10996832 | 3300009121 | Anaerobic Wastewater Sludge | VTPGDASVTLDIGGLPVVLVLPERDVELMMWPYQVHYTLQEGRGDE* |
| Ga0118671_11026093 | 3300009121 | Anaerobic Wastewater Sludge | VTPGDASVTLDIGGLPVVLVLPERDVELMMWPYRANCILQEGRYDE* |
| Ga0118671_11057223 | 3300009121 | Anaerobic Wastewater Sludge | VTSGDASVSFDIDGLPVVLVLPERDVELMMWPYRLHRILQEGCGDE* |
| Ga0118674_10271303 | 3300009122 | Anaerobic Wastewater Sludge | VTPGDASVTLDIGGLPVVLVLPERDVELMMWPYRANRILQEGRRR* |
| Ga0118674_10561733 | 3300009122 | Anaerobic Wastewater Sludge | VTPGDASVSFDIGGLPVVLVLPERDVELMMWTYRANRILQEGRDDE* |
| Ga0118674_10665713 | 3300009122 | Anaerobic Wastewater Sludge | VTPGDASVTLDIGGLPVVLVLPERDVESIMWLYQVHCILQEGCGDE* |
| Ga0118674_10933441 | 3300009122 | Anaerobic Wastewater Sludge | VTSGDASVSFDIDGLPVVLVLPERDVELMMWPYRVHRILQEGCGDE* |
| Ga0118674_11180461 | 3300009122 | Anaerobic Wastewater Sludge | TLDIGGLPVVLVLPERDVELMMWTYRANRILQEGRDDE* |
| Ga0118672_10323524 | 3300009360 | Anaerobic Wastewater Sludge | VTPGDASVTLDIGGLPVVLVLPERDVELMMWPYRANCILQEGRDDE* |
| Ga0118672_10358334 | 3300009360 | Anaerobic Wastewater Sludge | VTSSDASVSFDIDGLPVVLVLPERDVEMIMWLYQVHRILQEGCGDE* |
| Ga0118672_10421414 | 3300009360 | Anaerobic Wastewater Sludge | VTPGDASVTLDIGGLPVVLVLPERDVELMMWPYQVHRILQEGRGDE* |
| Ga0118672_10491583 | 3300009360 | Anaerobic Wastewater Sludge | VTPGDTSVTLDIGGLPVVLVLPERDVELMMWTYRANRILQEGRDDE* |
| Ga0118672_10959592 | 3300009360 | Anaerobic Wastewater Sludge | VTPGDASVSFDIDGLPVVLVLPERDVESIMWLYQVHCILQEGRDDE* |
| Ga0118673_10127462 | 3300009362 | Anaerobic Wastewater Sludge | VTPGDASVSFDIDGLPVVLVLPERDVESIMWLYQVHCILQEGCGDE* |
| Ga0118673_10297094 | 3300009362 | Anaerobic Wastewater Sludge | VTPGDASVALDIDGLPVQLVLPERDVELMMWPYRANRILQEGRGDE* |
| Ga0118673_10641204 | 3300009362 | Anaerobic Wastewater Sludge | VTPGDASVTLDIGGLPVVLVLPERDVELMMWTYRANRILQEGRRR* |
| Ga0118673_10913711 | 3300009362 | Anaerobic Wastewater Sludge | VTSGDACVTLDIGGLPVVLVLPERDVELMMWPYRANCILQEGRDDE* |
| Ga0118673_11800281 | 3300009362 | Anaerobic Wastewater Sludge | IGGLPVVLVLPERDVELMMWTYRANRILQEGRDDE* |
| Ga0073899_106581442 | 3300009540 | Activated Sludge | VTSGDACVALDIGGLPVVLVLPERDVELVMWLYWVNRILQEGHGDE* |
| Ga0116232_11502812 | 3300009588 | Anaerobic Biogas Reactor | VTPGDASVTLDIDGLPVVLVLPERDVELMMWPYRVHRILQEGCGDE* |
| Ga0123327_11026723 | 3300009607 | Anaerobic Biogas Reactor | SVTLDIGGLPVVLVLPERDVELMMWTYRANRILQEGRDDE* |
| Ga0123327_12194953 | 3300009607 | Anaerobic Biogas Reactor | GGLPVVLVLPERDVELMMWTYRANRILQEGRDDE* |
| Ga0123331_12323642 | 3300009642 | Anaerobic Biogas Reactor | VTPGDASVSFDIDGLPVVLVLPERDVESIMWLYQVHCILQEERDDE* |
| Ga0123326_10781661 | 3300009647 | Anaerobic Biogas Reactor | TLDIGGLPVVLVLPERDVELMMWTYRANRILQEGRRR* |
| Ga0123326_11296574 | 3300009647 | Anaerobic Biogas Reactor | VTPGDASVTLDIGGLPVVLVLPERDVELMMWTYRANRILQE |
| Ga0123326_12357211 | 3300009647 | Anaerobic Biogas Reactor | VTPGDASVSFDIGGLPVVLVLPERDVELMMWTYRANRILQEGRDD |
| Ga0123330_12630302 | 3300009652 | Anaerobic Biogas Reactor | VTPGDASVTLDIGGLPVVLVLPERDVELMMWTYRANRILQEGRGDE* |
| Ga0116190_12423722 | 3300009655 | Anaerobic Digestor Sludge | VTPGDALVVFDIDGLPVVLVLPERDVELMMWPYRVHCILQEGCGDE* |
| Ga0123329_11146593 | 3300009656 | Anaerobic Biogas Reactor | VTPGDACVALDIDGLPVVLVLPERDVELMMWPYRVHRILQ |
| Ga0123329_11189641 | 3300009656 | Anaerobic Biogas Reactor | DGAGGAGVTPGDASVTLDIGGLPVVLVLPERDVELMMWPYRANCILQEGRDDE* |
| Ga0123329_13242742 | 3300009656 | Anaerobic Biogas Reactor | DKEGGAGVTPGDASVSFDIDGLPVVLVLPERDVESIMWLYQVHCILQEGRDDE* |
| Ga0116179_12387452 | 3300009657 | Anaerobic Digestor Sludge | LFDIDGLPVVLVLPERDVELMIWTYRVNRILQEGRDDE* |
| Ga0116179_12926712 | 3300009657 | Anaerobic Digestor Sludge | VTSGDTCVMINIDGLPVTLVLPERDAELMMWTYRANRILQEGCGDE* |
| Ga0123328_11478523 | 3300009659 | Anaerobic Biogas Reactor | GDASVTLDIGGLPVVLVLPERDVELMMWTYRANRILQEGRGDE* |
| Ga0123328_13083542 | 3300009659 | Anaerobic Biogas Reactor | VTPGDASVTLDIDGLPVVLVLPERDVELMMWPYRANRILQEGRGDE* |
| Ga0116182_11320213 | 3300009666 | Anaerobic Digestor Sludge | VTSGDACVALDIDGLPVQLVLPERDVELMMWTYRANRILQEGRDDE* |
| Ga0116182_11500383 | 3300009666 | Anaerobic Digestor Sludge | DIDGLPVVLVLPERDVELMMWTYRANRILQEGRDDE* |
| Ga0116147_12858701 | 3300009667 | Anaerobic Digestor Sludge | MTSDDASVSFDIDGLPVVLVLPERDVELMMWTYRANRILQEGRGDE* |
| Ga0116148_11451744 | 3300009669 | Anaerobic Digestor Sludge | VTPGDACVTLDIGGLPVQLVLPERDVELMMWPYRAN |
| Ga0116148_11822183 | 3300009669 | Anaerobic Digestor Sludge | VTPGDASVSFDIDGLPVVLVLPERDVELMMWPYRANRILQEGRDDE* |
| Ga0116148_13114472 | 3300009669 | Anaerobic Digestor Sludge | VGVTSGDACVALDIDGLPVQLVLPERDVELMMWLYRANRILQEGRDDE* |
| Ga0123334_11789771 | 3300009671 | Anaerobic Biogas Reactor | SVTLDIGGLPVVLVLPERDVELMMWTYRANRILQEGRGDE* |
| Ga0123334_12065991 | 3300009671 | Anaerobic Biogas Reactor | GAGVTPGDASVTLDIGGLPVVLVLPERDVESIMWLYQVHCILQEGCGDE* |
| Ga0116173_11837031 | 3300009674 | Anaerobic Digestor Sludge | VTSGDACVALDIDGLPVVLVLPERDVELMMWTYRAN |
| Ga0116149_14094132 | 3300009675 | Anaerobic Digestor Sludge | VTSSDACVALDIDGLPVQLVLPERDVELMMWTYRANRILQEGRGDE* |
| Ga0116149_14646832 | 3300009675 | Anaerobic Digestor Sludge | VTPGDACVTLDIGGLPVQLVLPERDVELMMWPYQVHHILQ |
| Ga0116174_101784484 | 3300009681 | Anaerobic Digestor Sludge | VGVTPGDASVSFDIDGLPVVLVLPERDVELMMWTYRANRILQEGRDDE* |
| Ga0116172_101719023 | 3300009682 | Anaerobic Digestor Sludge | VGVTPGDASVSFDIDGLPVQLVLPERDVELMMWTYRA |
| Ga0116144_105387162 | 3300009687 | Anaerobic Digestor Sludge | VTSGDACVTLDIDRLPVVLVLPERDVDLMMWTYRANRILQEGRGDE* |
| Ga0116195_10179694 | 3300009707 | Anaerobic Digestor Sludge | VTPGDASVSYDIDGLPVALVLPERDVELMMWPHQVHYILQEGRGDE* |
| Ga0123332_13257981 | 3300009770 | Anaerobic Biogas Reactor | VTPGDASVTLDIGGLPVVLVLPERDVELMMWPYRVHRILQEGCGDE* |
| Ga0123333_103791322 | 3300009773 | Anaerobic Biogas Reactor | VTPGDASVTLDIGGLPVVLVLPERDVELMMWTYRA |
| Ga0116156_104893641 | 3300009780 | Anaerobic Digestor Sludge | VGVTSGDACVALDIDGLPVQLVLPERDVELMMWLYRANRILQEGR |
| Ga0116178_106095912 | 3300009781 | Anaerobic Digestor Sludge | GTGGAGVTPGDASVSFDIDGLPVVLVLPERDVELMMWTYRANRILQEGRDDE* |
| Ga0116250_105555474 | 3300010340 | Anaerobic Digestor Sludge | VTPSDASVTLDIGGLPVTLVLPERDVELMIWTYRANRILQEGRDDE* |
| Ga0116250_107406482 | 3300010340 | Anaerobic Digestor Sludge | FDIDGLPVTLVLPERDAELMMWTYRANRILQEGCGDE* |
| Ga0116243_101991043 | 3300010344 | Anaerobic Digestor Sludge | VTSGDASVAIDIDGLSVQLVLPERDVELMMWPYRANRILQEGRGDE* |
| Ga0116239_102924963 | 3300010346 | Anaerobic Digestor Sludge | VTSGDACVTLDIDRLPVVLVLPERDVELMMWPYRANRILQEGRGDE* |
| Ga0116248_108510403 | 3300010351 | Anaerobic Digestor Sludge | VGVTPGDASVSFDIDGLPVQLVLPERDVELMMWTYRANRILQEGRDDE* |
| Ga0116236_115399681 | 3300010353 | Anaerobic Digestor Sludge | LDIGGLPVVLVLPERDVELMMWTYRANRILQEGRDDE* |
| Ga0116242_107528231 | 3300010355 | Anaerobic Digestor Sludge | VGVTSGDACVALDIDGLPVQLVLPERDVELMMWLY |
| Ga0172378_103481884 | 3300014203 | Groundwater | VTPGDASVSFDIDGLPVVLVLPECCIEAMGCVYRISCILQEGRGDE* |
| Ga0172378_104667531 | 3300014203 | Groundwater | GTGGAGVTSGDACVALDIDGLPVQLVLPERDVELIMWPYQVRHILQGGRDDE* |
| Ga0172378_108684252 | 3300014203 | Groundwater | VTPGDASVSFDIDGLPVVLVLPECCIEAMGCAYRASCILQEGRGDE* |
| Ga0172378_111143402 | 3300014203 | Groundwater | VTSGDACVTLDIDGLPVQLVLPERDVELMMWTYRANRILQEGRDDE* |
| Ga0172381_102858444 | 3300014204 | Landfill Leachate | MTSGDACVTIDIDGLPVVLVLPERDVELIMWPYQVRHILQGGRDDE* |
| Ga0172381_104388004 | 3300014204 | Landfill Leachate | MTSGDASVTIDIDGLPVQLVLPERDVDLMMWTYRANRILQEGRGDE* |
| Ga0172381_108303572 | 3300014204 | Landfill Leachate | VTSGDACVALDIDGLPVQLVLPERDVELMMWPYRANCILQEGRDDE* |
| Ga0172377_105293201 | 3300014206 | Landfill Leachate | MTPGDASVSLNIDGLPVVLVLPERDVELMMWTYRANRILQEGRGD |
| Ga0172377_105932822 | 3300014206 | Landfill Leachate | VTSCDACVALDIDGLPVVLVLPECCIEAMGCVYRISCILQEGRGDE* |
| Ga0172377_113591692 | 3300014206 | Landfill Leachate | AGGAGVTPGDASVSFDIDGLPVVLVLPECCIEAMRHLYRLSCILQEGRSDE* |
| Ga0172377_113621142 | 3300014206 | Landfill Leachate | VTSGDASVSFDIDGLPVVLVLPECCIEAMGCAYRASCILQEGRGDE* |
| Ga0172382_105155562 | 3300015214 | Landfill Leachate | VTPGDASISFDIAGLPVVLVLPERDVELIMWPYRAKRILQEGRDDE* |
| Ga0172382_108180281 | 3300015214 | Landfill Leachate | VTPGDASVSFDIDGLPVQLVLPERDVELMMWPYQVHYTLQEGRGDE* |
| Ga0180030_10481351 | 3300019239 | Anaerobic Biogas Reactor | VTPGDASVTLDIGGLPVVLVLPERDVELIMWLYQVHCILQEGCGDE |
| Ga0180031_12600001 | 3300020072 | Anaerobic Biogas Reactor | VTPGDASVTLDIGGLPVVLVLPERDVELIMWLYQVHCILQEGRDDE |
| Ga0208041_10052703 | 3300025393 | Anaerobic Digestor Sludge | VTPGDASVSYDIDGLPVALVLPERDVELMMWPHQVHYILQEGRGDE |
| Ga0208693_10591384 | 3300025618 | Anaerobic Digestor Sludge | ASVTLDIGGLPVTLVLPERDVELMIWTYRANRILQEGRDDE |
| Ga0208693_10965601 | 3300025618 | Anaerobic Digestor Sludge | VTPSDASVTLDIGGLPVTLVLPERDVELMIWTYRANRILQEGRDDE |
| Ga0208823_11283624 | 3300025657 | Anaerobic Digestor Sludge | VTPSDASVSFDIDGLPVTLVLPERDAELMMWTYRANRILQEGRDDE |
| Ga0208823_11818332 | 3300025657 | Anaerobic Digestor Sludge | LFDIDGLPVVLVLPERDVELMIWTYRVNRILQEGRDDE |
| Ga0209719_10942333 | 3300025677 | Anaerobic Digestor Sludge | VTSGDASVAIDIDGLSVQLVLPERDVELMMWPYRANRILQEGRGDE |
| Ga0209719_11153502 | 3300025677 | Anaerobic Digestor Sludge | VTPGDASVSFDIDGLPVVLVLPERDVELMMWTYRANRILQEGRDDE |
| Ga0209719_11287703 | 3300025677 | Anaerobic Digestor Sludge | PGDASVSFDIDGLPVVLVLPERDVELMMWTYRANRILQEGRGDE |
| Ga0209201_11702642 | 3300025708 | Anaerobic Digestor Sludge | VTPGDASVSFDIDGLPVVLVLPERDVELMMWPYRANRILQEGRDDE |
| Ga0209201_12222431 | 3300025708 | Anaerobic Digestor Sludge | VTSGDACVTLDIDRLPVVLVLPERDVELMMWPYRANRIL |
| Ga0208458_10678362 | 3300025714 | Anaerobic Digestor Sludge | VTSGDACVELDIDGLPVVLVLPERDVELMMWTYRANRILQEGRDDE |
| Ga0209606_10582455 | 3300025730 | Anaerobic Digestor Sludge | VTSSDACVALDIDGLPVQLVLPERDVELMMWTYRANRILQEGRGDE |
| Ga0209509_10319174 | 3300026194 | Anaerobic Biogas Reactor | VTPGDASVSFDIDGLPVVLVLPERDVESIMWLYQVHCILQEGRDDE |
| Ga0209509_10337353 | 3300026194 | Anaerobic Biogas Reactor | VTPGDASVTLDIGGLPVVLVLPERDVELMMWTYRANRILQEGRDDE |
| Ga0209509_10487242 | 3300026194 | Anaerobic Biogas Reactor | VTPGDACVALDIDGLPVVLVLPERDVELMMWPYRVHRILQEGCGDE |
| Ga0209509_10555323 | 3300026194 | Anaerobic Biogas Reactor | VTPGDASVSFDIDGLPVVLVLPERDVESIMWLYQVHCILQEG |
| Ga0209509_10599482 | 3300026194 | Anaerobic Biogas Reactor | VTPGDASVTLDIGGLPVVLVLPERDVESIMWLYQVHCILQEGCGDE |
| Ga0209312_10061354 | 3300026195 | Anaerobic Biogas Reactor | VGVTPGDACVALDIDGLPVVLVLPERDVELMMWPYRVHRILQEGCGDE |
| Ga0209313_10386633 | 3300026198 | Anaerobic Biogas Reactor | VTPGDASVSFDIGGLPVVLVLPERDVELMMWTYRANRILQEGRDDE |
| Ga0209722_10669835 | 3300026252 | Anaerobic Biogas Reactor | GADVTPGDASVSFDIGGLPVVLVLPERDVELMMWTYRANRILQEGRDDE |
| Ga0209722_10692863 | 3300026252 | Anaerobic Biogas Reactor | VTPGDASVSFDIDGLPVVLVLPERDVELMMWPYQVHYTLQEGRGDE |
| Ga0209722_10900962 | 3300026252 | Anaerobic Biogas Reactor | VTPGDASVTLDIDGLPVQLVLPERDVDLMMWTYRANRILQEGRDDE |
| Ga0209510_11024303 | 3300026290 | Anaerobic Biogas Reactor | VTPGDASVSFDIDGLPVVLVLPERDVESIMWLYQVHC |
| (restricted) Ga0255344_12885291 | 3300028564 | Wastewater | DGTGCADVTPGDASVSFDIDGLPVVLVLPERDVELMMWTYRANRILQEGRDDE |
| (restricted) Ga0255345_10594553 | 3300028568 | Wastewater | VTPGDASVTLDIDGLPVQLMLPERDVELMMWTYRANRILQEGRDDE |
| Ga0265294_100228228 | 3300028602 | Groundwater | VTPGDASVSFDIDGLPVVLVLPECCIEAMRHLYRLSCILQEGRSDE |
| Ga0265294_100995068 | 3300028602 | Groundwater | VTSCDASVALDIDGLPVQLVLPERDVELMMWPYQVHHILQGGRDDE |
| Ga0265294_105650572 | 3300028602 | Groundwater | PADGAGGAGVTPGDASVTLDIGGLPVVLVLPERDVELMMWTYRANRILQEGRDDE |
| Ga0265294_106340092 | 3300028602 | Groundwater | GGAGVTPGDACVSFDIDGLPVQLVLPERDVELMMWTYRANRILQGGRDDE |
| Ga0265294_107432162 | 3300028602 | Groundwater | VTPGDASVTLDIDGLPVQLVLPERDVELIMWLYQVHCILQEGCGDE |
| Ga0265294_108498973 | 3300028602 | Groundwater | ASVTLDIGGLPVVLVLPERDVELMMWTYRANRILQEGRDDE |
| Ga0265293_100415251 | 3300028603 | Landfill Leachate | LEIGGLPVVLVLPERDVELMMWTYRANRILQEGRDDE |
| Ga0265293_103765434 | 3300028603 | Landfill Leachate | VTPGDASVTLDIGGLPVVLVLPERDVELMMWLYQVHCILQEGCGDE |
| Ga0265293_105944763 | 3300028603 | Landfill Leachate | VTPGDASVSFDIDGLPVVLVLPERDVELIMWLYQVHCILQEGRDDE |
| Ga0302244_10283062 | 3300028626 | Activated Sludge | VTPGDASVTLDIDGLPVQLVLPERDVELMMWTYRANRILQEGRDDE |
| Ga0302243_10048786 | 3300028627 | Activated Sludge | VTPGDACVTLDIGGLPVQLVLPERDVELMMWPYQVHRILQEGCGDE |
| Ga0302248_11013134 | 3300028629 | Activated Sludge | TPGDASVSFDIDGLPVVLVLPERDVELMMWPYRANRILQEGRDDE |
| Ga0302240_10436991 | 3300028638 | Activated Sludge | ADKEGGADVTPGDACVTLDIGGLPVQLVLPERDVELMMWPYQVHRILQEGCGDE |
| Ga0167330_10664582 | 3300029781 | Biosolids | VTSGDACVALDIGGLPVVLVLPERDVELMMWTYRANRILQEGRDDE |
| Ga0134854_100418011 | 3300029822 | Fermentation Pit Mud | MTPGDASVTINIDGLPVVLVLPERDVELMMWTYRANRILQEGRDDE |
| Ga0134854_10450385 | 3300029822 | Fermentation Pit Mud | GVGVTSGDTCVTINIDGLPVTLVLPERDVELMMWTYRANRILQEGRDDE |
| Ga0134852_1007997 | 3300029824 | Fermentation Pit Mud | VTSGDTCVTINIDGLPVTLVLPERDVELMMWTYRANRILQEGRDDE |
| ⦗Top⦘ |