| Basic Information | |
|---|---|
| Family ID | F007832 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 344 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VLVFADIFPGGGGPLADVFAIAIAVALFALLYWAIDLIDRI |
| Number of Associated Samples | 252 |
| Number of Associated Scaffolds | 344 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 42.15 % |
| % of genes near scaffold ends (potentially truncated) | 9.88 % |
| % of genes from short scaffolds (< 2000 bps) | 65.70 % |
| Associated GOLD sequencing projects | 212 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.151 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.628 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.547 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.872 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.13% β-sheet: 0.00% Coil/Unstructured: 60.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 344 Family Scaffolds |
|---|---|---|
| PF03814 | KdpA | 31.98 |
| PF00486 | Trans_reg_C | 17.15 |
| PF09604 | Potass_KdpF | 14.24 |
| PF13493 | DUF4118 | 2.91 |
| PF02518 | HATPase_c | 2.91 |
| PF00702 | Hydrolase | 2.62 |
| PF02669 | KdpC | 1.74 |
| PF01544 | CorA | 1.74 |
| PF12840 | HTH_20 | 1.45 |
| PF00582 | Usp | 0.87 |
| PF00122 | E1-E2_ATPase | 0.87 |
| PF00903 | Glyoxalase | 0.87 |
| PF02702 | KdpD | 0.87 |
| PF02566 | OsmC | 0.58 |
| PF13344 | Hydrolase_6 | 0.58 |
| PF00005 | ABC_tran | 0.58 |
| PF04480 | DUF559 | 0.58 |
| PF13302 | Acetyltransf_3 | 0.58 |
| PF01451 | LMWPc | 0.58 |
| PF00912 | Transgly | 0.58 |
| PF10011 | DUF2254 | 0.29 |
| PF08245 | Mur_ligase_M | 0.29 |
| PF13641 | Glyco_tranf_2_3 | 0.29 |
| PF12849 | PBP_like_2 | 0.29 |
| PF00809 | Pterin_bind | 0.29 |
| PF13738 | Pyr_redox_3 | 0.29 |
| PF01058 | Oxidored_q6 | 0.29 |
| PF13683 | rve_3 | 0.29 |
| PF03547 | Mem_trans | 0.29 |
| PF01872 | RibD_C | 0.29 |
| PF00690 | Cation_ATPase_N | 0.29 |
| PF00487 | FA_desaturase | 0.29 |
| PF03330 | DPBB_1 | 0.29 |
| PF02353 | CMAS | 0.29 |
| PF04116 | FA_hydroxylase | 0.29 |
| PF13473 | Cupredoxin_1 | 0.29 |
| PF00361 | Proton_antipo_M | 0.29 |
| PF04545 | Sigma70_r4 | 0.29 |
| PF00950 | ABC-3 | 0.29 |
| PF03793 | PASTA | 0.29 |
| PF13419 | HAD_2 | 0.29 |
| PF00561 | Abhydrolase_1 | 0.29 |
| PF07228 | SpoIIE | 0.29 |
| PF12847 | Methyltransf_18 | 0.29 |
| PF00072 | Response_reg | 0.29 |
| PF00294 | PfkB | 0.29 |
| PF09678 | Caa3_CtaG | 0.29 |
| PF10590 | PNP_phzG_C | 0.29 |
| PF00188 | CAP | 0.29 |
| PF02649 | GCHY-1 | 0.29 |
| PF04299 | FMN_bind_2 | 0.29 |
| PF01979 | Amidohydro_1 | 0.29 |
| PF00108 | Thiolase_N | 0.29 |
| PF01475 | FUR | 0.29 |
| PF07731 | Cu-oxidase_2 | 0.29 |
| PF13011 | LZ_Tnp_IS481 | 0.29 |
| PF00578 | AhpC-TSA | 0.29 |
| PF07681 | DoxX | 0.29 |
| PF04860 | Phage_portal | 0.29 |
| PF01402 | RHH_1 | 0.29 |
| PF00588 | SpoU_methylase | 0.29 |
| PF00392 | GntR | 0.29 |
| PF13784 | Fic_N | 0.29 |
| PF02673 | BacA | 0.29 |
| PF01850 | PIN | 0.29 |
| COG ID | Name | Functional Category | % Frequency in 344 Family Scaffolds |
|---|---|---|---|
| COG2060 | K+-transporting ATPase, KdpA subunit | Inorganic ion transport and metabolism [P] | 31.98 |
| COG2156 | K+-transporting ATPase, KdpC subunit | Inorganic ion transport and metabolism [P] | 1.74 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 1.74 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 1.16 |
| COG2205 | K+-sensing histidine kinase KdpD | Signal transduction mechanisms [T] | 0.87 |
| COG2216 | K+ transport ATPase, ATPase subunit KdpB | Inorganic ion transport and metabolism [P] | 0.87 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.87 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.58 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.58 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.29 |
| COG1968 | Undecaprenyl pyrophosphate phosphatase | Lipid transport and metabolism [I] | 0.29 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.29 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.29 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.29 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.29 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.29 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.29 |
| COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 0.29 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.29 |
| COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 0.29 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.29 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.29 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.29 |
| COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 0.29 |
| COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 0.29 |
| COG1469 | GTP cyclohydrolase FolE2 | Coenzyme transport and metabolism [H] | 0.29 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.29 |
| COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 0.29 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.29 |
| COG0679 | Predicted permease, AEC (auxin efflux carrier) family | General function prediction only [R] | 0.29 |
| COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 0.29 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 0.29 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.29 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.15 % |
| Unclassified | root | N/A | 32.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2046860001|MiccSOB_F3TY2AH02HH9PU | Not Available | 517 | Open in IMG/M |
| 2124908009|FWIRA_GRAM18401DR5L0 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 533 | Open in IMG/M |
| 2124908028|beta3_all_NODE_170612_len_9082_cov_8_695111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 9132 | Open in IMG/M |
| 2124908039|B3_v_NODE_6347_len_9050_cov_9_234807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 9100 | Open in IMG/M |
| 2124908044|A5_c1_ConsensusfromContig35445 | All Organisms → cellular organisms → Bacteria | 1827 | Open in IMG/M |
| 2140918008|ConsensusfromContig297831 | Not Available | 603 | Open in IMG/M |
| 2189573004|GZGWRS401CWTYF | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
| 3300000532|CNAas_1018466 | Not Available | 504 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_101434909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 724 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_109298612 | Not Available | 569 | Open in IMG/M |
| 3300001405|JGI20186J14852_1000026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 9034 | Open in IMG/M |
| 3300001633|JGI20241J16302_100670 | Not Available | 846 | Open in IMG/M |
| 3300001867|JGI12627J18819_10220671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 764 | Open in IMG/M |
| 3300001979|JGI24740J21852_10134496 | Not Available | 616 | Open in IMG/M |
| 3300002568|C688J35102_120864777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1889 | Open in IMG/M |
| 3300002906|JGI25614J43888_10038497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1490 | Open in IMG/M |
| 3300003402|JGI26528J50254_1030422 | Not Available | 1281 | Open in IMG/M |
| 3300003659|JGI25404J52841_10136696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 519 | Open in IMG/M |
| 3300003911|JGI25405J52794_10061768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 811 | Open in IMG/M |
| 3300003992|Ga0055470_10000310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4753 | Open in IMG/M |
| 3300003996|Ga0055467_10139185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 719 | Open in IMG/M |
| 3300003997|Ga0055466_10088808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 826 | Open in IMG/M |
| 3300003998|Ga0055472_10133071 | Not Available | 726 | Open in IMG/M |
| 3300004092|Ga0062389_101259087 | Not Available | 925 | Open in IMG/M |
| 3300004635|Ga0062388_102535495 | Not Available | 538 | Open in IMG/M |
| 3300005164|Ga0066815_10013174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1056 | Open in IMG/M |
| 3300005329|Ga0070683_100003273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 13099 | Open in IMG/M |
| 3300005329|Ga0070683_100031782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4803 | Open in IMG/M |
| 3300005332|Ga0066388_102556936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 929 | Open in IMG/M |
| 3300005332|Ga0066388_105223245 | Not Available | 659 | Open in IMG/M |
| 3300005333|Ga0070677_10000001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 118426 | Open in IMG/M |
| 3300005335|Ga0070666_10016717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4696 | Open in IMG/M |
| 3300005335|Ga0070666_10096412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2036 | Open in IMG/M |
| 3300005336|Ga0070680_100046341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3537 | Open in IMG/M |
| 3300005337|Ga0070682_100000026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 191388 | Open in IMG/M |
| 3300005337|Ga0070682_101291856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 620 | Open in IMG/M |
| 3300005337|Ga0070682_101646371 | Not Available | 556 | Open in IMG/M |
| 3300005337|Ga0070682_101682327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 551 | Open in IMG/M |
| 3300005340|Ga0070689_100383236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1185 | Open in IMG/M |
| 3300005347|Ga0070668_101327579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 654 | Open in IMG/M |
| 3300005355|Ga0070671_100557951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 988 | Open in IMG/M |
| 3300005356|Ga0070674_100000002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 271088 | Open in IMG/M |
| 3300005367|Ga0070667_100001291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 22638 | Open in IMG/M |
| 3300005367|Ga0070667_101231557 | Not Available | 701 | Open in IMG/M |
| 3300005435|Ga0070714_100224669 | All Organisms → cellular organisms → Bacteria | 1727 | Open in IMG/M |
| 3300005435|Ga0070714_100600736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1057 | Open in IMG/M |
| 3300005436|Ga0070713_100412517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1263 | Open in IMG/M |
| 3300005437|Ga0070710_11341673 | Not Available | 533 | Open in IMG/M |
| 3300005439|Ga0070711_100084094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2275 | Open in IMG/M |
| 3300005439|Ga0070711_101617559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300005455|Ga0070663_100002250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 10810 | Open in IMG/M |
| 3300005455|Ga0070663_100202228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1551 | Open in IMG/M |
| 3300005459|Ga0068867_101377774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 653 | Open in IMG/M |
| 3300005535|Ga0070684_100339674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1381 | Open in IMG/M |
| 3300005539|Ga0068853_100002403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 13996 | Open in IMG/M |
| 3300005539|Ga0068853_100830262 | Not Available | 886 | Open in IMG/M |
| 3300005544|Ga0070686_100024711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3604 | Open in IMG/M |
| 3300005547|Ga0070693_101041466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300005548|Ga0070665_100000068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 204531 | Open in IMG/M |
| 3300005548|Ga0070665_100213473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1931 | Open in IMG/M |
| 3300005548|Ga0070665_100316111 | Not Available | 1566 | Open in IMG/M |
| 3300005548|Ga0070665_101455927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 694 | Open in IMG/M |
| 3300005563|Ga0068855_100652675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1130 | Open in IMG/M |
| 3300005578|Ga0068854_100000044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 91882 | Open in IMG/M |
| 3300005587|Ga0066654_10000413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 11264 | Open in IMG/M |
| 3300005614|Ga0068856_100046728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 4263 | Open in IMG/M |
| 3300005614|Ga0068856_100605148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1117 | Open in IMG/M |
| 3300005617|Ga0068859_100245568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1880 | Open in IMG/M |
| 3300005834|Ga0068851_10003190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 7273 | Open in IMG/M |
| 3300005841|Ga0068863_100000004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 272478 | Open in IMG/M |
| 3300005842|Ga0068858_100000033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 142748 | Open in IMG/M |
| 3300005843|Ga0068860_100007463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 10936 | Open in IMG/M |
| 3300005937|Ga0081455_10101240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 2312 | Open in IMG/M |
| 3300005983|Ga0081540_1229085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 657 | Open in IMG/M |
| 3300006163|Ga0070715_10071182 | Not Available | 1554 | Open in IMG/M |
| 3300006173|Ga0070716_100382721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1006 | Open in IMG/M |
| 3300006175|Ga0070712_102010196 | Not Available | 506 | Open in IMG/M |
| 3300006578|Ga0074059_11460953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1336 | Open in IMG/M |
| 3300006579|Ga0074054_12077925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1543 | Open in IMG/M |
| 3300006604|Ga0074060_11417386 | Not Available | 889 | Open in IMG/M |
| 3300006642|Ga0075521_10268448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 818 | Open in IMG/M |
| 3300006642|Ga0075521_10367281 | Not Available | 698 | Open in IMG/M |
| 3300006642|Ga0075521_10693303 | Not Available | 503 | Open in IMG/M |
| 3300006854|Ga0075425_100098179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3327 | Open in IMG/M |
| 3300006871|Ga0075434_100648345 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300006881|Ga0068865_101050671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 715 | Open in IMG/M |
| 3300006903|Ga0075426_10421630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 986 | Open in IMG/M |
| 3300006954|Ga0079219_10003110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4640 | Open in IMG/M |
| 3300007822|Ga0104325_110622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1204 | Open in IMG/M |
| 3300009093|Ga0105240_10510293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1336 | Open in IMG/M |
| 3300009098|Ga0105245_10002754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 15803 | Open in IMG/M |
| 3300009098|Ga0105245_10015680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6606 | Open in IMG/M |
| 3300009098|Ga0105245_10147307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2222 | Open in IMG/M |
| 3300009101|Ga0105247_10001113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 20027 | Open in IMG/M |
| 3300009148|Ga0105243_13102855 | Not Available | 503 | Open in IMG/M |
| 3300009174|Ga0105241_10016246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5454 | Open in IMG/M |
| 3300009174|Ga0105241_10647564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 959 | Open in IMG/M |
| 3300009176|Ga0105242_10000430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 33469 | Open in IMG/M |
| 3300009176|Ga0105242_10001392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 19052 | Open in IMG/M |
| 3300009176|Ga0105242_10017159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5637 | Open in IMG/M |
| 3300009176|Ga0105242_10281201 | Not Available | 1511 | Open in IMG/M |
| 3300009545|Ga0105237_10155990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 2280 | Open in IMG/M |
| 3300009551|Ga0105238_10000023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 196844 | Open in IMG/M |
| 3300009551|Ga0105238_11032650 | Not Available | 843 | Open in IMG/M |
| 3300009551|Ga0105238_12742537 | Not Available | 529 | Open in IMG/M |
| 3300009551|Ga0105238_12764217 | Not Available | 527 | Open in IMG/M |
| 3300009553|Ga0105249_10000074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 145235 | Open in IMG/M |
| 3300009553|Ga0105249_10128588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2415 | Open in IMG/M |
| 3300009553|Ga0105249_10561546 | Not Available | 1193 | Open in IMG/M |
| 3300009553|Ga0105249_11364861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 781 | Open in IMG/M |
| 3300009826|Ga0123355_10964384 | Not Available | 913 | Open in IMG/M |
| 3300010037|Ga0126304_10043799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2693 | Open in IMG/M |
| 3300010043|Ga0126380_10974952 | Not Available | 711 | Open in IMG/M |
| 3300010048|Ga0126373_10123280 | Not Available | 2427 | Open in IMG/M |
| 3300010051|Ga0133939_1030542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3861 | Open in IMG/M |
| 3300010051|Ga0133939_1119771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1031 | Open in IMG/M |
| 3300010159|Ga0099796_10289026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 692 | Open in IMG/M |
| 3300010362|Ga0126377_10464202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1291 | Open in IMG/M |
| 3300010362|Ga0126377_10533855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81 | 1210 | Open in IMG/M |
| 3300010371|Ga0134125_10001548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 28084 | Open in IMG/M |
| 3300010371|Ga0134125_10688490 | Not Available | 1128 | Open in IMG/M |
| 3300010371|Ga0134125_10749499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1075 | Open in IMG/M |
| 3300010371|Ga0134125_11474194 | Not Available | 741 | Open in IMG/M |
| 3300010375|Ga0105239_10975608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 974 | Open in IMG/M |
| 3300010396|Ga0134126_10538702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1341 | Open in IMG/M |
| 3300010397|Ga0134124_12569483 | Not Available | 552 | Open in IMG/M |
| 3300010399|Ga0134127_10359462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1426 | Open in IMG/M |
| 3300010400|Ga0134122_13156457 | Not Available | 516 | Open in IMG/M |
| 3300010401|Ga0134121_11856997 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300011418|Ga0153954_1073640 | Not Available | 856 | Open in IMG/M |
| 3300011418|Ga0153954_1078139 | Not Available | 828 | Open in IMG/M |
| 3300011418|Ga0153954_1162294 | Not Available | 555 | Open in IMG/M |
| 3300012070|Ga0153963_1005393 | Not Available | 2628 | Open in IMG/M |
| 3300012090|Ga0153956_1004957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 7457 | Open in IMG/M |
| 3300012090|Ga0153956_1007095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5697 | Open in IMG/M |
| 3300012519|Ga0157352_1055151 | Not Available | 603 | Open in IMG/M |
| 3300012915|Ga0157302_10044150 | Not Available | 1234 | Open in IMG/M |
| 3300012924|Ga0137413_10377565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1013 | Open in IMG/M |
| 3300012924|Ga0137413_10468978 | Not Available | 920 | Open in IMG/M |
| 3300012924|Ga0137413_10856872 | Not Available | 702 | Open in IMG/M |
| 3300012929|Ga0137404_10701920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 915 | Open in IMG/M |
| 3300012930|Ga0137407_11931038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 563 | Open in IMG/M |
| 3300012942|Ga0164242_10002654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 20683 | Open in IMG/M |
| 3300012942|Ga0164242_10355308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1088 | Open in IMG/M |
| 3300012942|Ga0164242_10432591 | Not Available | 957 | Open in IMG/M |
| 3300012943|Ga0164241_10021459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5049 | Open in IMG/M |
| 3300012943|Ga0164241_10109518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1982 | Open in IMG/M |
| 3300012944|Ga0137410_10248019 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300012951|Ga0164300_10029736 | Not Available | 1993 | Open in IMG/M |
| 3300012955|Ga0164298_10003714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 5221 | Open in IMG/M |
| 3300012957|Ga0164303_10981590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 599 | Open in IMG/M |
| 3300012957|Ga0164303_11070107 | Not Available | 580 | Open in IMG/M |
| 3300012957|Ga0164303_11216420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 552 | Open in IMG/M |
| 3300012960|Ga0164301_10108745 | Not Available | 1610 | Open in IMG/M |
| 3300012984|Ga0164309_11223216 | Not Available | 631 | Open in IMG/M |
| 3300012985|Ga0164308_10797777 | Not Available | 823 | Open in IMG/M |
| 3300012986|Ga0164304_11613282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 541 | Open in IMG/M |
| 3300012987|Ga0164307_10025585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3122 | Open in IMG/M |
| 3300012988|Ga0164306_10196851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81 | 1411 | Open in IMG/M |
| 3300012988|Ga0164306_10737092 | Not Available | 787 | Open in IMG/M |
| 3300013102|Ga0157371_10002158 | All Organisms → cellular organisms → Bacteria | 19158 | Open in IMG/M |
| 3300013104|Ga0157370_10002243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 23500 | Open in IMG/M |
| 3300013104|Ga0157370_10565493 | Not Available | 1042 | Open in IMG/M |
| 3300013105|Ga0157369_12565083 | Not Available | 516 | Open in IMG/M |
| 3300013296|Ga0157374_10045144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4077 | Open in IMG/M |
| 3300013297|Ga0157378_11159635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 811 | Open in IMG/M |
| 3300013297|Ga0157378_11513506 | Not Available | 716 | Open in IMG/M |
| 3300013306|Ga0163162_10496071 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300013306|Ga0163162_11140394 | Not Available | 884 | Open in IMG/M |
| 3300013307|Ga0157372_10000923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 32007 | Open in IMG/M |
| 3300013308|Ga0157375_10000109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 80349 | Open in IMG/M |
| 3300013308|Ga0157375_11770028 | Not Available | 732 | Open in IMG/M |
| 3300013308|Ga0157375_12159499 | Not Available | 663 | Open in IMG/M |
| 3300013308|Ga0157375_12394682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 630 | Open in IMG/M |
| 3300013308|Ga0157375_12722057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 591 | Open in IMG/M |
| 3300013503|Ga0120127_10001129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4478 | Open in IMG/M |
| 3300014263|Ga0075324_1000008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 104045 | Open in IMG/M |
| 3300014301|Ga0075323_1069049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 718 | Open in IMG/M |
| 3300014314|Ga0075316_1121240 | Not Available | 639 | Open in IMG/M |
| 3300014323|Ga0075356_1005108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2094 | Open in IMG/M |
| 3300014325|Ga0163163_10280816 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300014326|Ga0157380_13352358 | Not Available | 512 | Open in IMG/M |
| 3300014498|Ga0182019_10151268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1470 | Open in IMG/M |
| 3300014502|Ga0182021_10231848 | Not Available | 2161 | Open in IMG/M |
| 3300014968|Ga0157379_10015509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6687 | Open in IMG/M |
| 3300014969|Ga0157376_10325132 | Not Available | 1463 | Open in IMG/M |
| 3300015067|Ga0167640_109507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81 | 918 | Open in IMG/M |
| 3300015085|Ga0167632_1004165 | All Organisms → cellular organisms → Bacteria | 2131 | Open in IMG/M |
| 3300015085|Ga0167632_1025058 | Not Available | 808 | Open in IMG/M |
| 3300015090|Ga0167634_1019400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 971 | Open in IMG/M |
| 3300015197|Ga0167638_1113483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 503 | Open in IMG/M |
| 3300015264|Ga0137403_10726746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11 | 852 | Open in IMG/M |
| 3300015371|Ga0132258_10998093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2115 | Open in IMG/M |
| 3300015373|Ga0132257_102563986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 663 | Open in IMG/M |
| 3300017792|Ga0163161_10104649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2110 | Open in IMG/M |
| 3300017792|Ga0163161_10182473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1610 | Open in IMG/M |
| 3300017966|Ga0187776_10046200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2466 | Open in IMG/M |
| 3300017966|Ga0187776_10339432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 988 | Open in IMG/M |
| 3300018429|Ga0190272_12534481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 559 | Open in IMG/M |
| 3300018476|Ga0190274_10000661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 20196 | Open in IMG/M |
| 3300019265|Ga0187792_1547562 | Not Available | 619 | Open in IMG/M |
| 3300019361|Ga0173482_10049061 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300019377|Ga0190264_10000061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 16218 | Open in IMG/M |
| 3300019871|Ga0193702_1028413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 716 | Open in IMG/M |
| 3300019881|Ga0193707_1005223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4555 | Open in IMG/M |
| 3300019889|Ga0193743_1015477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4106 | Open in IMG/M |
| 3300019889|Ga0193743_1071840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1395 | Open in IMG/M |
| 3300020001|Ga0193731_1061880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 981 | Open in IMG/M |
| 3300020021|Ga0193726_1340965 | Not Available | 557 | Open in IMG/M |
| 3300020027|Ga0193752_1041854 | All Organisms → cellular organisms → Bacteria | 2035 | Open in IMG/M |
| 3300020034|Ga0193753_10174481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 1005 | Open in IMG/M |
| 3300020077|Ga0206351_10380487 | Not Available | 541 | Open in IMG/M |
| 3300021181|Ga0210388_10113091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2334 | Open in IMG/M |
| 3300021339|Ga0193706_1026845 | Not Available | 1735 | Open in IMG/M |
| 3300021401|Ga0210393_11280870 | Not Available | 588 | Open in IMG/M |
| 3300021404|Ga0210389_10613017 | Not Available | 855 | Open in IMG/M |
| 3300021406|Ga0210386_11649455 | Not Available | 531 | Open in IMG/M |
| 3300021418|Ga0193695_1000023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 38800 | Open in IMG/M |
| 3300021475|Ga0210392_10122240 | Not Available | 1744 | Open in IMG/M |
| 3300021559|Ga0210409_10007985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10834 | Open in IMG/M |
| 3300021976|Ga0193742_1155531 | Not Available | 683 | Open in IMG/M |
| 3300022880|Ga0247792_1019048 | Not Available | 1130 | Open in IMG/M |
| 3300023268|Ga0247765_1013967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1811 | Open in IMG/M |
| 3300024347|Ga0179591_1104507 | All Organisms → cellular organisms → Bacteria | 2395 | Open in IMG/M |
| 3300024978|Ga0209941_1000907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 26147 | Open in IMG/M |
| 3300024983|Ga0207420_1011744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 2917 | Open in IMG/M |
| 3300025321|Ga0207656_10002220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6502 | Open in IMG/M |
| 3300025504|Ga0208356_1000003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 183985 | Open in IMG/M |
| 3300025505|Ga0207929_1006264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81 | 2335 | Open in IMG/M |
| 3300025625|Ga0208219_1001038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 9796 | Open in IMG/M |
| 3300025634|Ga0208589_1012730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2524 | Open in IMG/M |
| 3300025780|Ga0210100_1000094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 18297 | Open in IMG/M |
| 3300025792|Ga0210143_1052508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 724 | Open in IMG/M |
| 3300025792|Ga0210143_1092017 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300025792|Ga0210143_1099175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 537 | Open in IMG/M |
| 3300025878|Ga0209584_10055166 | Not Available | 1416 | Open in IMG/M |
| 3300025893|Ga0207682_10000034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 56869 | Open in IMG/M |
| 3300025898|Ga0207692_10233779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 1095 | Open in IMG/M |
| 3300025899|Ga0207642_10000473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 12319 | Open in IMG/M |
| 3300025900|Ga0207710_10000154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 73881 | Open in IMG/M |
| 3300025900|Ga0207710_10200964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 984 | Open in IMG/M |
| 3300025900|Ga0207710_10641014 | Not Available | 556 | Open in IMG/M |
| 3300025900|Ga0207710_10644274 | Not Available | 555 | Open in IMG/M |
| 3300025903|Ga0207680_10439728 | Not Available | 925 | Open in IMG/M |
| 3300025911|Ga0207654_10011343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4547 | Open in IMG/M |
| 3300025911|Ga0207654_11348838 | Not Available | 520 | Open in IMG/M |
| 3300025912|Ga0207707_10141603 | Not Available | 2103 | Open in IMG/M |
| 3300025914|Ga0207671_10499588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 970 | Open in IMG/M |
| 3300025915|Ga0207693_10940438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 662 | Open in IMG/M |
| 3300025916|Ga0207663_10894682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 710 | Open in IMG/M |
| 3300025917|Ga0207660_10541292 | Not Available | 947 | Open in IMG/M |
| 3300025921|Ga0207652_10007488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 8795 | Open in IMG/M |
| 3300025923|Ga0207681_10277555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1318 | Open in IMG/M |
| 3300025924|Ga0207694_10000004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 967075 | Open in IMG/M |
| 3300025924|Ga0207694_10531851 | Not Available | 986 | Open in IMG/M |
| 3300025927|Ga0207687_10004229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 9596 | Open in IMG/M |
| 3300025927|Ga0207687_10012948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 5449 | Open in IMG/M |
| 3300025928|Ga0207700_10054138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3010 | Open in IMG/M |
| 3300025928|Ga0207700_11628449 | Not Available | 571 | Open in IMG/M |
| 3300025929|Ga0207664_10057178 | All Organisms → cellular organisms → Bacteria | 3100 | Open in IMG/M |
| 3300025929|Ga0207664_10400455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. W3-3-2 | 1221 | Open in IMG/M |
| 3300025931|Ga0207644_11226140 | Not Available | 631 | Open in IMG/M |
| 3300025934|Ga0207686_10000033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 143602 | Open in IMG/M |
| 3300025934|Ga0207686_10000815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 19044 | Open in IMG/M |
| 3300025934|Ga0207686_10089709 | Not Available | 2027 | Open in IMG/M |
| 3300025936|Ga0207670_10315489 | Not Available | 1229 | Open in IMG/M |
| 3300025937|Ga0207669_10000003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 252239 | Open in IMG/M |
| 3300025937|Ga0207669_10817773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 774 | Open in IMG/M |
| 3300025938|Ga0207704_10000079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 58183 | Open in IMG/M |
| 3300025938|Ga0207704_10753392 | Not Available | 810 | Open in IMG/M |
| 3300025938|Ga0207704_11485634 | Not Available | 581 | Open in IMG/M |
| 3300025944|Ga0207661_10001795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 14672 | Open in IMG/M |
| 3300025961|Ga0207712_10000007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 539589 | Open in IMG/M |
| 3300025961|Ga0207712_10308193 | Not Available | 1302 | Open in IMG/M |
| 3300025961|Ga0207712_10404198 | Not Available | 1148 | Open in IMG/M |
| 3300025981|Ga0207640_10000094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 70117 | Open in IMG/M |
| 3300025981|Ga0207640_10029655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3361 | Open in IMG/M |
| 3300026035|Ga0207703_10000310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 52770 | Open in IMG/M |
| 3300026035|Ga0207703_10000577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 37419 | Open in IMG/M |
| 3300026035|Ga0207703_10239005 | Not Available | 1632 | Open in IMG/M |
| 3300026041|Ga0207639_10010610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6381 | Open in IMG/M |
| 3300026041|Ga0207639_10364507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1294 | Open in IMG/M |
| 3300026067|Ga0207678_10266954 | Not Available | 1467 | Open in IMG/M |
| 3300026067|Ga0207678_11663045 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300026078|Ga0207702_10029555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4561 | Open in IMG/M |
| 3300026078|Ga0207702_10365250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 1384 | Open in IMG/M |
| 3300026088|Ga0207641_10000170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 91128 | Open in IMG/M |
| 3300026911|Ga0209620_1022615 | Not Available | 564 | Open in IMG/M |
| 3300027002|Ga0209110_1003718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1572 | Open in IMG/M |
| 3300027037|Ga0209005_1046320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 535 | Open in IMG/M |
| 3300027058|Ga0209111_1036604 | Not Available | 620 | Open in IMG/M |
| 3300027288|Ga0208525_1037420 | Not Available | 599 | Open in IMG/M |
| 3300027496|Ga0208987_1043819 | Not Available | 799 | Open in IMG/M |
| 3300027504|Ga0209114_1057074 | Not Available | 691 | Open in IMG/M |
| 3300027517|Ga0209113_1016431 | Not Available | 963 | Open in IMG/M |
| 3300027524|Ga0208998_1022284 | Not Available | 999 | Open in IMG/M |
| 3300027524|Ga0208998_1023562 | Not Available | 972 | Open in IMG/M |
| 3300027559|Ga0209222_1072083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
| 3300027775|Ga0209177_10001010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4755 | Open in IMG/M |
| 3300027815|Ga0209726_10304948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 776 | Open in IMG/M |
| 3300027817|Ga0209112_10079263 | Not Available | 1039 | Open in IMG/M |
| 3300027817|Ga0209112_10203639 | Not Available | 681 | Open in IMG/M |
| 3300027817|Ga0209112_10216590 | Not Available | 662 | Open in IMG/M |
| 3300027895|Ga0209624_10020575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4177 | Open in IMG/M |
| 3300028379|Ga0268266_11058629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 785 | Open in IMG/M |
| 3300028379|Ga0268266_11412905 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300028381|Ga0268264_10005373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 10850 | Open in IMG/M |
| 3300028536|Ga0137415_10251123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1578 | Open in IMG/M |
| 3300028556|Ga0265337_1000074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 46897 | Open in IMG/M |
| 3300028558|Ga0265326_10217170 | Not Available | 550 | Open in IMG/M |
| 3300028573|Ga0265334_10268257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 586 | Open in IMG/M |
| 3300028793|Ga0307299_10108178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1041 | Open in IMG/M |
| 3300028800|Ga0265338_10000441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 74208 | Open in IMG/M |
| 3300028802|Ga0307503_10000027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 137045 | Open in IMG/M |
| 3300028802|Ga0307503_10448023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81 | 685 | Open in IMG/M |
| 3300028875|Ga0307289_10112106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 1115 | Open in IMG/M |
| 3300028875|Ga0307289_10451211 | Not Available | 528 | Open in IMG/M |
| 3300030336|Ga0247826_11072722 | Not Available | 642 | Open in IMG/M |
| 3300031003|Ga0074003_13505997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1083 | Open in IMG/M |
| 3300031170|Ga0307498_10443603 | Not Available | 519 | Open in IMG/M |
| 3300031184|Ga0307499_10067338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 916 | Open in IMG/M |
| 3300031198|Ga0307500_10009779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 3 | 1957 | Open in IMG/M |
| 3300031226|Ga0307497_10232800 | Not Available | 814 | Open in IMG/M |
| 3300031712|Ga0265342_10361718 | Not Available | 754 | Open in IMG/M |
| 3300031715|Ga0307476_10002146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 11798 | Open in IMG/M |
| 3300031740|Ga0307468_101365090 | Not Available | 649 | Open in IMG/M |
| 3300031918|Ga0311367_11318886 | Not Available | 713 | Open in IMG/M |
| 3300031996|Ga0308176_11937240 | Not Available | 629 | Open in IMG/M |
| 3300032205|Ga0307472_100107993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 1934 | Open in IMG/M |
| 3300032205|Ga0307472_100733894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 893 | Open in IMG/M |
| 3300032205|Ga0307472_101385060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 681 | Open in IMG/M |
| 3300032770|Ga0335085_10367805 | Not Available | 1680 | Open in IMG/M |
| 3300032805|Ga0335078_11125431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 915 | Open in IMG/M |
| 3300032829|Ga0335070_10000184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 71249 | Open in IMG/M |
| 3300032829|Ga0335070_10418552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1279 | Open in IMG/M |
| 3300032829|Ga0335070_10497871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1155 | Open in IMG/M |
| 3300032829|Ga0335070_12090720 | Not Available | 508 | Open in IMG/M |
| 3300032896|Ga0335075_10036738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6985 | Open in IMG/M |
| 3300032896|Ga0335075_11383189 | Not Available | 595 | Open in IMG/M |
| 3300032954|Ga0335083_10000500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 59898 | Open in IMG/M |
| 3300032955|Ga0335076_11532745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 554 | Open in IMG/M |
| 3300033433|Ga0326726_10850148 | Not Available | 884 | Open in IMG/M |
| 3300034268|Ga0372943_0277517 | Not Available | 1059 | Open in IMG/M |
| 3300034965|Ga0370497_0000441 | All Organisms → cellular organisms → Bacteria | 7331 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.07% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.78% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.49% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.62% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.62% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.74% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 1.74% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.45% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.16% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.16% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.16% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.16% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.16% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.16% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.87% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.87% |
| Wastewater Bioreactor | Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor | 0.87% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.58% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.58% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.58% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.58% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.58% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Industrial Wastewater | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater | 0.58% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.29% |
| Concrete Drainage Pipe Biofilm | Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm | 0.29% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.29% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.29% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.29% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.29% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.29% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.29% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.29% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.29% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.29% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.29% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.29% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2046860001 | Concrete drainage pipe biofilm microbial communities from Ohio, US - sample 12382 | Environmental | Open in IMG/M |
| 2124908009 | Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2 | Environmental | Open in IMG/M |
| 2124908028 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 2124908039 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4 | Environmental | Open in IMG/M |
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 2140918008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001405 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 | Environmental | Open in IMG/M |
| 3300001633 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF007 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300003402 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_solids_1 | Engineered | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007822 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-8-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010051 | Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196 | Engineered | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011418 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL038 MetaG | Host-Associated | Open in IMG/M |
| 3300012070 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL047 MetaG | Host-Associated | Open in IMG/M |
| 3300012090 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL040 MetaG | Host-Associated | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012942 | Miracle-Growth compost microbial communities from Emeryville, California, USA - Original compost - Miracle growth compost (MG) | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300014323 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015067 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7A, Adjacent to main proglacial river, mid transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015085 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015090 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5A, Northern proglacial tributary margin, adjacent to top of river) | Environmental | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019265 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019871 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a1 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020027 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021339 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021976 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c1 | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300023268 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L106-311C-6 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024978 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_solids_1 (SPAdes) | Engineered | Open in IMG/M |
| 3300024983 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_biof (SPAdes) | Engineered | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025780 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026911 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027002 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027037 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027058 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027496 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027504 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027517 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027524 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
| 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Host-Associated | Open in IMG/M |
| 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031003 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| 3300034965 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MiccSOB_15450370 | 2046860001 | Concrete Drainage Pipe Biofilm | VLFLADIFPGGGGPLADVFSLVLAVAMFALLYWLVGLIDRI |
| FWIRA_05523880 | 2124908009 | Soil | LSFLADIFPGGGSPAADVFAIAIAVVLFALLYWAIDLIDRI |
| beta3_all_01163270 | 2124908028 | Soil | MIVAMLSAADIFPGGGGPLADVFAIAIAVGLFALLYWAIDLIDRI |
| B3_v_00333180 | 2124908039 | Soil | MIVAMLSAADIFPGGGGPLADVFAIAIAVGLFALLYWAIGLIDRI |
| A5_c1_00725380 | 2124908044 | Soil | LFTPADIFPGGGSPIADVFAIAIAVGIFALLYWAIDLIDRI |
| Bog_all_C_05671240 | 2140918008 | Soil | PVTFLADIFPGGGSPLADVFAIAIAVGLFALLYWAIDLIDRI |
| FG2_07743460 | 2189573004 | Grass Soil | VVSFADIFPGGGGPIADVFAIALSVGLFALVYWAIDLIDRI |
| CNAas_10184661 | 3300000532 | Quercus Rhizosphere | VPFLADIFPGGGGPLADLFAVAIAVGLFALLYWAIDLIDRI* |
| JGIcombinedJ13530_1014349092 | 3300001213 | Wetland | MISAVLVPADIFPGGGSPIADVFAIVLSVGLFALIFWAIDLIDRI* |
| JGIcombinedJ13530_1092986121 | 3300001213 | Wetland | VLYVLADLFPGGGSPVADVFAIAIAVALFALLYWAIDLIERI* |
| JGI20186J14852_10000269 | 3300001405 | Arctic Peat Soil | VLVVLSDIFPGGGGPLADVFAIAIAVALFALLYWAIDLIDRI* |
| JGI20241J16302_1006702 | 3300001633 | Forest Soil | VLFLADIFPGGGSPIADVFSIAIAIAMFALLYWLISLIDRI* |
| JGI12627J18819_102206713 | 3300001867 | Forest Soil | VLFLADIFPGGGSPLADVFSIAIAIAMFALLYWLISLIDRI* |
| JGI24740J21852_101344963 | 3300001979 | Corn Rhizosphere | RVLFLADIFPGGDSPIADVCAIGIALVLFALLFCAIDLIDRI* |
| C688J35102_1208647772 | 3300002568 | Soil | VFVLADIFPGGGSPLADAFSIAIAIVLFALLYLSIELIDRV* |
| JGI25614J43888_100384972 | 3300002906 | Grasslands Soil | VLFVLADLFPGGGSPLADVFAIAIAVALFALLYWAIDLIDRI* |
| JGI26528J50254_10304221 | 3300003402 | Wastewater Bioreactor | VLFLADIFPGGGSPVADVFAIAIALFLFALLFWVIDLIDRI* |
| JGI25404J52841_101366962 | 3300003659 | Tabebuia Heterophylla Rhizosphere | VLFLADIFPGGGGPAADVFSIAIAIAMFALLYWLISLIDRI* |
| JGI25405J52794_100617682 | 3300003911 | Tabebuia Heterophylla Rhizosphere | VLLSANIFPGGGGIPADLFAIFCAVVLFALLLWAIDLIDRI* |
| Ga0055470_100003104 | 3300003992 | Natural And Restored Wetlands | VFAPADIFPGGGSPIADVFAIVVSVALFALVYWAIDRIDRI* |
| Ga0055467_101391852 | 3300003996 | Natural And Restored Wetlands | VLFVFADIFPGGGSPIADVFAIALSVGLFALVYWAIDLIDRI* |
| Ga0055466_100888082 | 3300003997 | Natural And Restored Wetlands | VISVLADLFPGGGSPLADLFAIVVSAALFALILWAVDLIDRI* |
| Ga0055472_101330711 | 3300003998 | Natural And Restored Wetlands | MIAVVLVLADIFPGGGSPIADVFAIALSVGLFALVYWAIDLIDRI* |
| Ga0062389_1012590872 | 3300004092 | Bog Forest Soil | VLFLADIFPGGGGPLADLFAVALAVVLFALLYWAIDLIDRI* |
| Ga0062388_1025354951 | 3300004635 | Bog Forest Soil | LFWSANIFPGGGGPLADAFAIAIAVVIFALLYWAIDLIDRI* |
| Ga0066815_100131742 | 3300005164 | Soil | VLSFADIFPGGGSPIADAFAIALSVGLFGLVYWAIDLIDRI |
| Ga0070683_1000032734 | 3300005329 | Corn Rhizosphere | VLSFADIFPGGGGLPADLLALAIAVALFALLYWAIELIDRI* |
| Ga0070683_1000317825 | 3300005329 | Corn Rhizosphere | VLLLADIFPGGGSPIADVCAIGIALVLFALLFCAIDLIDRI* |
| Ga0066388_1025569362 | 3300005332 | Tropical Forest Soil | VLSVLADVFPGGGGPLADAFAIAIAVGIFALLYWAIDLIDRI* |
| Ga0066388_1052232452 | 3300005332 | Tropical Forest Soil | VLSILDIAPLADLFPGGGGPLADAFAIALAVALFALLYWAIDLIDRI* |
| Ga0070677_1000000198 | 3300005333 | Miscanthus Rhizosphere | VNDGPVLSSADIFPGGGGPLADLVAIALAVGLFALLYWAIDLIDRI* |
| Ga0070666_100167171 | 3300005335 | Switchgrass Rhizosphere | VLFLADIFPGGGSPVADVFAIAIAFVLFALLFWAIDLIDRI* |
| Ga0070666_100964122 | 3300005335 | Switchgrass Rhizosphere | VSSFAHLLSAADIFPGGGSPVADLFSIVLAIAMFALLYWLISLIDRI* |
| Ga0070680_1000463413 | 3300005336 | Corn Rhizosphere | VPSFADIFSGGGGLPADLFAVAVATALFTLLCWAIELIDRI* |
| Ga0070682_100000026114 | 3300005337 | Corn Rhizosphere | VLLFANLFPGGGGPLADVFSVGIAIVLFALLYWAVELIDRI* |
| Ga0070682_1012918562 | 3300005337 | Corn Rhizosphere | VGAHDARVSSFAHLLSAADIFPGGGSPVADLFSIAIAVVMFAALYWLISLIDRI* |
| Ga0070682_1016463712 | 3300005337 | Corn Rhizosphere | VLSIVPLADLFPGGGTPVADVFAIALAIGLFALLYWAIDLVDRI* |
| Ga0070682_1016823272 | 3300005337 | Corn Rhizosphere | VLFLADIFPGGGGPLADVLAIAIALVLFALLYWAIDLIERI* |
| Ga0070689_1003832362 | 3300005340 | Switchgrass Rhizosphere | VVPFANLFPGGGSPVADVFSIALAVVLFALLYWAIDLIDRI* |
| Ga0070668_1013275791 | 3300005347 | Switchgrass Rhizosphere | VLVIANIFPGGGGVPADLVAVVVALVTFAVLYLAIDLIDRI* |
| Ga0070671_1005579512 | 3300005355 | Switchgrass Rhizosphere | VLFLADIFPGGGGPLADVLAIAIAVGLFAVLYWAIDLIDRI* |
| Ga0070674_10000000244 | 3300005356 | Miscanthus Rhizosphere | VLSFADIFPGGGGPLADAVAISLSVCLFGLVYWAIDLIDRI* |
| Ga0070667_10000129117 | 3300005367 | Switchgrass Rhizosphere | VFVGADIFPGGGSPIADLFSILLAVGLFALLYWAIGLIDRI* |
| Ga0070667_1012315573 | 3300005367 | Switchgrass Rhizosphere | VLFLADIFPGGGGIAADAFSIAIAIAMFAVLYWLIGLIDRI* |
| Ga0070714_1002246692 | 3300005435 | Agricultural Soil | VFVCADLFPGGGGPLADAFSIALAVILFALLYWAIDLIDRI* |
| Ga0070714_1006007362 | 3300005435 | Agricultural Soil | VVSVADIFPGGGGPLADVFAIAIAIGLFALLYWAIDLIDRI* |
| Ga0070713_1004125172 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VVPFANLFPGGGSPLADVFSIALAVILFALLYWAIDLIDRI* |
| Ga0070710_113416731 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVPADIFPGGGGPVADVFAIALSVALFALIFWAIDLIDRI* |
| Ga0070711_1000840943 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VVPFANLFPGGGSPLADVFSIALAVVLFALLYWAIDLIDRI* |
| Ga0070711_1016175592 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VVPFANLFPGGGSPVADVFSIVLAVILFALLYWAIDLIDRI* |
| Ga0070663_1000022505 | 3300005455 | Corn Rhizosphere | VLFLADIFPGGDSPIADVCAIGIALVLFALLFCAIDLIDRI* |
| Ga0070663_1002022282 | 3300005455 | Corn Rhizosphere | VLSVLADIFPGGGGPLADVFSVAIAIGLFALLYWAIDLIDRV* |
| Ga0068867_1013777742 | 3300005459 | Miscanthus Rhizosphere | VFVFSDLFPGGGSPLADLFSVALAVVLFALLYWAIDLIDRI* |
| Ga0070684_1003396742 | 3300005535 | Corn Rhizosphere | VLVRLADIFPGGGGPLADVFSVALALVLFALLYWAIDLIDRI* |
| Ga0068853_1000024034 | 3300005539 | Corn Rhizosphere | VLSFADIFPGGGGLPADLFALAIAVALFALLYGAIELIDRI* |
| Ga0068853_1008302622 | 3300005539 | Corn Rhizosphere | VFVCGNIFPGGGSPLADLFSIALAVILFALLYWAIDLIDRI* |
| Ga0070686_1000247112 | 3300005544 | Switchgrass Rhizosphere | VLSVLADIFPGGGGPLADVFAIAIAVGLFALLYWAIDLIDRI* |
| Ga0070693_1010414662 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VFVCADLFPGGGGLLADAFSIALAVGLFALLYWAIDLIDRI* |
| Ga0070665_100000068183 | 3300005548 | Switchgrass Rhizosphere | VLSFADILPGGGGLPADLLAVAIAVALFALLYWAIELIDRI* |
| Ga0070665_1002134731 | 3300005548 | Switchgrass Rhizosphere | VLFLADIFPGGGGPVADVFSIAIAVAMFAVLYWLISLIDRI* |
| Ga0070665_1003161111 | 3300005548 | Switchgrass Rhizosphere | VLFVLADIFPGGGGPAADAFAIAIALALFALLYWAIDLIDRI* |
| Ga0070665_1014559271 | 3300005548 | Switchgrass Rhizosphere | VLLLADIFPGGGGPVADVFSIAIAIAMFAVLYWLISLIDRI* |
| Ga0068855_1006526753 | 3300005563 | Corn Rhizosphere | VPSFADIFSGGGGLPADLFAIAVATALFALLYWAIELIDRI* |
| Ga0068854_10000004483 | 3300005578 | Corn Rhizosphere | VFVCADLFPGGGSPVADVFSIALAVILFALLYWAVELIDRI* |
| Ga0066654_100004134 | 3300005587 | Soil | VPSFADIFPGGGGLPADLFAVAIAVALFALLYWAIELIDRI* |
| Ga0068856_1000467283 | 3300005614 | Corn Rhizosphere | VLSLADIFPGGGGPAADFLAVAIAVALFALLYGAIELIDRI* |
| Ga0068856_1006051482 | 3300005614 | Corn Rhizosphere | VLFLADIFPGGGSPIADVFAIAIALVLFALLFWAIDLIDRI* |
| Ga0068859_1002455683 | 3300005617 | Switchgrass Rhizosphere | VLFLADIFPGGGGPLADVLAIAIAVGLFALLYWAIDLIDRI* |
| Ga0068851_100031903 | 3300005834 | Corn Rhizosphere | VLLFANLFPGGGGPLADVFSIAIAVVLFVALYWAVELIDRI* |
| Ga0068863_100000004159 | 3300005841 | Switchgrass Rhizosphere | VLSFADIFPGGSGVLADLFAVAIAVALFAFLYWAIDLIERI* |
| Ga0068858_10000003341 | 3300005842 | Switchgrass Rhizosphere | VLSVLADIFPGGGGPLADVFSIAIAIGLFALLYWAIELIDRV* |
| Ga0068860_1000074635 | 3300005843 | Switchgrass Rhizosphere | VLSFIADIFPGGGSPLADAFAIALSVGLFALVFWAIDLIDRI* |
| Ga0081455_101012403 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VLFLADIFPGGGSPVADVFSIAIAVAMFAVLYWLISLIDRI* |
| Ga0081540_12290851 | 3300005983 | Tabebuia Heterophylla Rhizosphere | VFVLANLFPGGGSPVADAFSIALAVALFALLYWAIDLIDRI* |
| Ga0070715_100711821 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSFANLFPGGGGPLADVFSVAIAVVLFAALYWAVELIDRI* |
| Ga0070716_1003827213 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSFADIFPGGGGLSADLFSIAIAVGLFALLYWAIDLID |
| Ga0070712_1020101961 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VFVCADLFPGGGGPLADVFSIALAVILFALLYWAIELIDRI* |
| Ga0074059_114609533 | 3300006578 | Soil | LFADIFPGGGGLAADLFAVAIAVALFALLYWAIELIDRI* |
| Ga0074054_120779253 | 3300006579 | Soil | VLSFADIFPGGGSPIADAFAIALSVGLFGLVYWAIDLIDRI* |
| Ga0074060_114173862 | 3300006604 | Soil | MLLLADLFPGGGPLADLFAVAIAVALFALLYWAIDLIERI* |
| Ga0075521_102684483 | 3300006642 | Arctic Peat Soil | VLVLSDIFPGGGGPLADVFAVAIAIGLFALLYWAIDLIDRI* |
| Ga0075521_103672812 | 3300006642 | Arctic Peat Soil | VIFLSDIFPGGGGPLADVFAIAIALVLFALLYWAIDLID |
| Ga0075521_106933032 | 3300006642 | Arctic Peat Soil | VLFLADIFPGGGGPLADVLAVAIALVLFALLYWAIDLIDRI* |
| Ga0075425_1000981793 | 3300006854 | Populus Rhizosphere | VFSFADIFPGGGSPIADVFAIALSVGLFALVYWAIDLIDRI* |
| Ga0075434_1006483453 | 3300006871 | Populus Rhizosphere | VLSLADIFPGGGGPLADLFAIALAAGLFALLYWAIDLIDRI* |
| Ga0068865_1010506712 | 3300006881 | Miscanthus Rhizosphere | VPSFADIFPGGGGLPADFLAVAIAVALFALLYWAIDLIERI* |
| Ga0075426_104216302 | 3300006903 | Populus Rhizosphere | VFVCADLFPGGGGPFADVFSIALAVVLFALLYWAIELIDRI* |
| Ga0079219_100031105 | 3300006954 | Agricultural Soil | VLSFADIFPGGGSPVADVISIALALLMFALLYWGIDLIDRI* |
| Ga0104325_1106222 | 3300007822 | Soil | LSTAADIFPGGGGLPADLFAVAIAVALFALLYWAIGLIDRI* |
| Ga0105240_105102933 | 3300009093 | Corn Rhizosphere | VSSFAHLLSAADIFPGGGSPAADLFSIAIAVVMFAALYWLISLIDRI* |
| Ga0105245_100027549 | 3300009098 | Miscanthus Rhizosphere | VFVCADLFPGGGSPVADVFSIALAVILFALLYWAIELIDRI* |
| Ga0105245_100156805 | 3300009098 | Miscanthus Rhizosphere | VPSFADIFPGSGGLPADLLALAIAVALFALLYWAIELIDRI* |
| Ga0105245_101473072 | 3300009098 | Miscanthus Rhizosphere | MLTIANIFPGGGGVPADIFAVVVALVTFAVLYVAIDLIDRI* |
| Ga0105247_1000111322 | 3300009101 | Switchgrass Rhizosphere | VLVRLADIFPGGGGPLADVLAIAIAVALFALLYWAIDLIERI* |
| Ga0105243_131028553 | 3300009148 | Miscanthus Rhizosphere | IFPSGGGLPADLLAVAIAVALFALLYWAIELIDRI* |
| Ga0105241_100162464 | 3300009174 | Corn Rhizosphere | VFVCADLFPGGGGPLADVFSIALAVALFALLYWAIELIDRI* |
| Ga0105241_106475642 | 3300009174 | Corn Rhizosphere | VSSFAHLLSAADIFPGGGSPVADLFSIAIAVVMFAALYWLISLIDRI* |
| Ga0105242_1000043021 | 3300009176 | Miscanthus Rhizosphere | VLLFADIFPGGGGPLADLLAVAIALVLFALLYWAIDLIERI* |
| Ga0105242_100013923 | 3300009176 | Miscanthus Rhizosphere | VLVCLADIFPGGGGPLADVLAIVLAVALFALLYWAIDLIDRI* |
| Ga0105242_100171591 | 3300009176 | Miscanthus Rhizosphere | VLSVLADIFPGGGGPLADAFSIAIAIGLFALIYWAIDLIDRV* |
| Ga0105242_102812011 | 3300009176 | Miscanthus Rhizosphere | VLSFADIFPGGGGLPADIFAVAIAVALFALLYWAIELIDRI* |
| Ga0105237_101559903 | 3300009545 | Corn Rhizosphere | VSSFAHLLSVADIFPGGGSPVADLFSIAIAVVMFAALYWLVSLIDRI* |
| Ga0105238_1000002387 | 3300009551 | Corn Rhizosphere | VLSLADIFPGGGGPIADVFAIALSVGLFALVSWAIELIDRI* |
| Ga0105238_110326502 | 3300009551 | Corn Rhizosphere | VSSFAHLLSAADIFPGGGSPVADLFSIAIAVVMFAALYWLVSLIDRI* |
| Ga0105238_127425372 | 3300009551 | Corn Rhizosphere | VNDGLVLSFADIFPGGGGPPADAFAIALAVGLFGLLYWAIDLIDRI* |
| Ga0105238_127642173 | 3300009551 | Corn Rhizosphere | LADIFPGGGGPVADVFSIAIAIAMFALLYWLISLIDRI* |
| Ga0105249_1000007435 | 3300009553 | Switchgrass Rhizosphere | VLSFADIFPGGGGPLADLFAIALAVGLFALLYWAIDLIDRV* |
| Ga0105249_101285883 | 3300009553 | Switchgrass Rhizosphere | VLSLADIFPGGGGLPADLFAVAIAVGLFALLYWAIELIDRI* |
| Ga0105249_105615461 | 3300009553 | Switchgrass Rhizosphere | VLSVLADIFPGGGSPVADVFAVAIAVALFALLYWAIDLIDRI* |
| Ga0105249_113648612 | 3300009553 | Switchgrass Rhizosphere | VLFLADIFPGGGSPVADLFSIVLAIAMFALLYWLISLIDRI* |
| Ga0123355_109643843 | 3300009826 | Termite Gut | VLSLAHLTTLADIFPGGGSPVADLFAIVLAVLMFGFLYWLIALIDRI* |
| Ga0126304_100437991 | 3300010037 | Serpentine Soil | DIFPGGGSPLADAVAIAIAVALFALLYLSIELIDHV* |
| Ga0126380_109749522 | 3300010043 | Tropical Forest Soil | VFVCADLFPGGGSPVADVFSIALAVVLFALLYWAIELIDRI* |
| Ga0126373_101232802 | 3300010048 | Tropical Forest Soil | VLVPANLFPGGGGPVADVFSIALAVVLFALLYWRIELIDRI* |
| Ga0133939_10305424 | 3300010051 | Industrial Wastewater | VLLSADIFPGGGGIPADLFSIFCAVVLFALLYWAIDLIDRI* |
| Ga0133939_11197711 | 3300010051 | Industrial Wastewater | VLFGADIFPGGGGVPADAFAILCAVVLFALLFWAIELIDRI* |
| Ga0099796_102890262 | 3300010159 | Vadose Zone Soil | VLLFADIFPGGGSPLADVFAVVVALILFALLYWAIDLIDRI* |
| Ga0126377_104642023 | 3300010362 | Tropical Forest Soil | VLSFADIFPGGGSPLADLFSVALAVGLFALLYWAIDLIDRI* |
| Ga0126377_105338551 | 3300010362 | Tropical Forest Soil | FADIFPGGGSPLADVFAIALSVGLFALVYWAIELIDRL* |
| Ga0134125_1000154820 | 3300010371 | Terrestrial Soil | VLYLADIFPGGGSPVADLFSIVLAIAMFALLYWLVSLIDRI* |
| Ga0134125_106884901 | 3300010371 | Terrestrial Soil | VLFLADIFPGGGSPVADLFSIVLGIAMFALLYWLISLIDRI* |
| Ga0134125_107494992 | 3300010371 | Terrestrial Soil | VLSFADIFPGGGGPLADVISIALAVGLFALLYWAIELIDRI* |
| Ga0134125_114741941 | 3300010371 | Terrestrial Soil | VLIGADIFPGGGGLPADLFAILCAVVLFALLFWAIDLIDRI* |
| Ga0105239_109756082 | 3300010375 | Corn Rhizosphere | VLSFADIFPGGGGPIADVFAVALSVGLFALVYWAIELIDRI* |
| Ga0134126_105387023 | 3300010396 | Terrestrial Soil | LLADIFPGGGSPIADVFSIAIAIAMFALLYWLISLIDRI* |
| Ga0134124_125694831 | 3300010397 | Terrestrial Soil | VLFLADIFPGGGGPFADVFSIAIAIAMFALLYWLVSLIDRI* |
| Ga0134127_103594622 | 3300010399 | Terrestrial Soil | VPFLGDIFPGGGGPAADVFSIAIAVGMFAVLYWLISLIDRI* |
| Ga0134122_131564573 | 3300010400 | Terrestrial Soil | VIANIFPGVGGVPADLVAVVVALVTFAVLYLAIDLIDRI* |
| Ga0134121_118569972 | 3300010401 | Terrestrial Soil | VLFLADIFPGGGGPVADVFSIAIAIAMFALLYWLISLIDRI* |
| Ga0153954_10736401 | 3300011418 | Attine Ant Fungus Gardens | VLFLADIFPGGGSPLADVFSIALAIAMFALLYWLIALIDRI* |
| Ga0153954_10781392 | 3300011418 | Attine Ant Fungus Gardens | VLFLADIFPGGGSPVADLFSIALAVIMFALLYWLIGLIDRI* |
| Ga0153954_11622942 | 3300011418 | Attine Ant Fungus Gardens | VLSLADIFPGGGSPIADMFSIALAVVMFALLYWLVSLIDRI* |
| Ga0153963_10053933 | 3300012070 | Attine Ant Fungus Gardens | VNDGLVLSLADIFPGGGSPLADAFSIALAVGLFALLYWAIDLIDRI* |
| Ga0153956_10049572 | 3300012090 | Attine Ant Fungus Gardens | VLFLADIFPGGGSPLADVFAIVIALVLFALLFWAIDLIDRI* |
| Ga0153956_10070952 | 3300012090 | Attine Ant Fungus Gardens | VTSFAHLLSAADIFPGGGSPVADLFSVALAVVMFALLYWLIGLIDRI* |
| Ga0157352_10551513 | 3300012519 | Unplanted Soil | RSVFVLADIFPGGGSPLADAFAIAIAVLLFAFVYLSIELIDRV* |
| Ga0157302_100441502 | 3300012915 | Soil | VVHDRYVSLFADLFPSGGFQADALAIGIAVCLFGLVYWAIDLIDRI* |
| Ga0137413_103775652 | 3300012924 | Vadose Zone Soil | VLFLADIFPGGGSPVADLFAIVLAVLLFALLYWAIDLIDRI* |
| Ga0137413_104689783 | 3300012924 | Vadose Zone Soil | VLLFADIFPGGGGPLADVFAVVVALILFGLLYWAIDLIDRI* |
| Ga0137413_108568723 | 3300012924 | Vadose Zone Soil | VLLGADIFPGGGGPLADALSVVIALVLFALLYWAIDLIDRV* |
| Ga0137404_107019202 | 3300012929 | Vadose Zone Soil | LSILADIFPGGGSPAADVFAIAIAIGLFALLYWAIDLIDRI* |
| Ga0137407_119310382 | 3300012930 | Vadose Zone Soil | VLFLADIFPGGGGPVADLFAIVLAVLLFALLYWAIDLIDRI* |
| Ga0164242_100026549 | 3300012942 | Compost | VLFLADIFPGGGSPFADVFSIAIAIAMFALLYWLISLIDRI* |
| Ga0164242_103553083 | 3300012942 | Compost | VLFLADIFPGGGGPVADVFSLALAIAMFALLYWLVGLIDRI* |
| Ga0164242_104325913 | 3300012942 | Compost | VSTFAHLLSAADIFPGGGSPVADLFSIAIAIAMFSVLYWLISLIDRI* |
| Ga0164241_100214595 | 3300012943 | Soil | VLYVLADLFPGGGSPVADVFAVAIALVLFALLYWAIDLIERI* |
| Ga0164241_101095182 | 3300012943 | Soil | VLFLADIFPGGGSPVADVFAVAIALVLFALLYWAIDLIDRI* |
| Ga0137410_102480194 | 3300012944 | Vadose Zone Soil | LVLSVLADIFPGGGGPLADVFSIAIAVGLFALLYWAIDLIDRI* |
| Ga0164300_100297363 | 3300012951 | Soil | VADIFPGGGGPIADFFSIAIAVGIFALLYWAIDLIERI* |
| Ga0164298_100037145 | 3300012955 | Soil | VLSFADIFPGGGGPVADVFAIALSVGLFALVYWAIDLIDRI* |
| Ga0164303_109815903 | 3300012957 | Soil | LSLLADIFPGGGSPVADVFAIAIAVGLFALLYWAIDLIDRI* |
| Ga0164303_110701073 | 3300012957 | Soil | LADIFPGGGGPLADVFAIAIAIGIFALLYWAIDLIDRI* |
| Ga0164303_112164201 | 3300012957 | Soil | LVLFVLADIFPGGGSPVADVFAIAIAVALFALLYWAIDLIDRV* |
| Ga0164301_101087453 | 3300012960 | Soil | VLNAADIFPGGGGVPADVFAIALSILLFALVYWAIDLIDRI* |
| Ga0164309_112232161 | 3300012984 | Soil | VLSFADIFPGGGGLPADLFAVAIAVGLFALLYWAIELIDRI* |
| Ga0164308_107977771 | 3300012985 | Soil | VPSFADIFPGGGGLPADLFAVAIAVALFAILYWAIELIDRI* |
| Ga0164304_116132822 | 3300012986 | Soil | VLFFADIFAGGGGPLADVLAIAIAVALFALLYWAIDLIDRI* |
| Ga0164307_100255852 | 3300012987 | Soil | VVPFANLFPGGGSPLADVFSIVLAVILFALLYWAIDLIDRI* |
| Ga0164306_101968513 | 3300012988 | Soil | LSFLADIFPGGGSPAADVFAIAIAVGLFALLYWAIDLIDRI* |
| Ga0164306_107370922 | 3300012988 | Soil | VLLFADIFPGGGGLPADALAVVIAFVLFALLYWAIDLIERI* |
| Ga0157371_100021589 | 3300013102 | Corn Rhizosphere | VFVLADIFPGGGSPLADAVAIAIAIVLFALLYFSIELIDRV* |
| Ga0157370_100022433 | 3300013104 | Corn Rhizosphere | VLSVLADIFPGGGGPLADAFSIALAIGLFALLYWAIELIDRI* |
| Ga0157370_105654933 | 3300013104 | Corn Rhizosphere | VPSFADIFSGGGGLPADLFAVAIAVALFALLCWAVELIDRI* |
| Ga0157369_125650832 | 3300013105 | Corn Rhizosphere | VLFLADIFPGGGGPLADVLSIAIAIAMFAVLYWLISLIDRI* |
| Ga0157374_100451445 | 3300013296 | Miscanthus Rhizosphere | LLADIFPGGGSPLADLFAIALAVGLFALLYWAIDLIDRI* |
| Ga0157378_111596352 | 3300013297 | Miscanthus Rhizosphere | VLVWLADIFPGGGGPLADVLAVAIAVVLFALLYWAIDLIDRI* |
| Ga0157378_115135061 | 3300013297 | Miscanthus Rhizosphere | GVHDRAVLSFADIFAGGGGVPADVFAIAIAVGLFALLYWAIELIDRI* |
| Ga0163162_104960713 | 3300013306 | Switchgrass Rhizosphere | VLFLADIFPGGGGLAADFFAIAIAVAMFALLYWLIGLIDRI* |
| Ga0163162_111403943 | 3300013306 | Switchgrass Rhizosphere | FPGGGGPLADVLAIAIAVGLFALLYWAIDLIDRI* |
| Ga0157372_1000092329 | 3300013307 | Corn Rhizosphere | VFVCADLFPGGGGPVADLFSIALAVILFALLYWAIELIDRI* |
| Ga0157375_1000010944 | 3300013308 | Miscanthus Rhizosphere | VLSVLADIFPGGGGPLADAFSIAIAVGLFALLYWAIDLIDRI* |
| Ga0157375_117700283 | 3300013308 | Miscanthus Rhizosphere | VLLLADIFPGGGGPVADVFSVAIAIAMFAVLYWLVSLIDRI* |
| Ga0157375_121594993 | 3300013308 | Miscanthus Rhizosphere | VLFLADIFPGGGSPFADVFSIAIAIGMFALLYWLVSLIDRI* |
| Ga0157375_123946822 | 3300013308 | Miscanthus Rhizosphere | LSFLADIFPGGGSPAADVLAIAIAVGLFALLYWAIDLIDRI* |
| Ga0157375_127220571 | 3300013308 | Miscanthus Rhizosphere | LSFLADIFPGGGSPAADVFAIAIAVGLIALLYWAIDLIDRI* |
| Ga0120127_100011295 | 3300013503 | Permafrost | MADIFPGGGGPLADLFSIAIAVGLFALLYWAIDLIDRI* |
| Ga0075324_100000894 | 3300014263 | Natural And Restored Wetlands | VDDRSVFAPADIFPGGGSPIADVFAIVVSVALFALVYWAIDRIDRI* |
| Ga0075323_10690492 | 3300014301 | Natural And Restored Wetlands | LFPLADIFPGGGGPLADVFAIALSVGLFALVYWAIDLIDRI* |
| Ga0075316_11212401 | 3300014314 | Natural And Restored Wetlands | IFAGGSAFADVFAVALSVGLFALVYLAIELIDRI* |
| Ga0075356_10051083 | 3300014323 | Natural And Restored Wetlands | VLSFADIFPGGGGPLADIFAIALSVGLFALVYWAIDLIDRI* |
| Ga0163163_102808163 | 3300014325 | Switchgrass Rhizosphere | VLFLADIFPGGGSPVADVFAIAVAFVLFALLFWAIDLIDRI* |
| Ga0157380_133523581 | 3300014326 | Switchgrass Rhizosphere | VLSVLLANLFPGGGGPLADVFSLVLAFALFALLYAAIELIDRV* |
| Ga0182019_101512682 | 3300014498 | Fen | MLSIPDPAVLADIFPGGGGPLADVFAIAIAVGLFALLYWAIDLIDRI* |
| Ga0182021_102318483 | 3300014502 | Fen | VLSFADIFPGGGGLPADLLAVAIAVALFALLYWAIELIDRI* |
| Ga0157379_100155091 | 3300014968 | Switchgrass Rhizosphere | VNDGLVSSFADIFPGGGGPLADLFAIALAVGLFGLLYWAIELIDRI* |
| Ga0157376_103251323 | 3300014969 | Miscanthus Rhizosphere | VLFLADIFPGGGSPIADVFSIALAIAMFALLYWLIGLIDRI* |
| Ga0167640_1095071 | 3300015067 | Glacier Forefield Soil | VPSFADIFPGGGGLPADLFALAIAVGLFALLYWAIELIDRI* |
| Ga0167632_10041651 | 3300015085 | Glacier Forefield Soil | VLSVLADIIPGGGGPLADVFAIAIAVGIFALLYWAIDLIDRI* |
| Ga0167632_10250582 | 3300015085 | Glacier Forefield Soil | MPFPADIFPGGGPLADVFAIAIAVGLFALLYWAIDLIDRV* |
| Ga0167634_10194003 | 3300015090 | Glacier Forefield Soil | VLSVLADIFPGGGGPLADVFSVAIAVGLFAILYWALDLIARICAP |
| Ga0167638_11134832 | 3300015197 | Glacier Forefield Soil | MLSVPDPSALADIFPGGGSPVADVLAIAIAVALFALLYWAIDLIDRI* |
| Ga0137403_107267461 | 3300015264 | Vadose Zone Soil | VLLGADIFPGGGGPLADALSVVIALVLFALLYWAIELIDRI* |
| Ga0132258_109980932 | 3300015371 | Arabidopsis Rhizosphere | VLSFADVFPGGGGPIADVFAIALSVGLFALVYWAIDLIDRI* |
| Ga0132257_1025639863 | 3300015373 | Arabidopsis Rhizosphere | VLSFADVFPGGGGPIADVFAIALSGGVFALVYWAIDLIDRI* |
| Ga0163161_101046493 | 3300017792 | Switchgrass Rhizosphere | VLSVLADIFPGGGGPLADVFSIAIAVGLFALLYWAIDLIDRV |
| Ga0163161_101824733 | 3300017792 | Switchgrass Rhizosphere | VLSFGDIFPGGGGVPADLLAVAIAVGLFALLYWAIDLIERI |
| Ga0187776_100462003 | 3300017966 | Tropical Peatland | MIVAVLVPADIFPGGGSPIADVFAIALSVGLFALVFWAIDLIDRI |
| Ga0187776_103394322 | 3300017966 | Tropical Peatland | MIAAMLPVADLFPGGGSPVADAFAIALSVAVFALILWAIDLIDRI |
| Ga0190272_125344812 | 3300018429 | Soil | VLFLADIFPGGGGPIADAFSMILASGLFALLYWAIDLIDRI |
| Ga0190274_100006617 | 3300018476 | Soil | LSVLADIFPGGGSPAADLLSVALAVGLFGLLYWAIELIDRI |
| Ga0187792_15475621 | 3300019265 | Peatland | ADLFPGGGSPIADVFAIVLAVVLFALLYWSIDLIDRI |
| Ga0173482_100490613 | 3300019361 | Soil | MLLLADIFPGGGSPLADVFAIAIALVLFALLYWAIDLIDRV |
| Ga0190264_1000006113 | 3300019377 | Soil | VLLFADLFPGGGSPLADAFSIAIALALFALLYWAIDLIERV |
| Ga0193702_10284133 | 3300019871 | Soil | VLFLADIFPGGGSPVADLFSIALAILMFALLYWLIGLIDRI |
| Ga0193707_10052234 | 3300019881 | Soil | VLSFADIFPGGGGLPADLFALAIAVALFAFLYWAIELIDRI |
| Ga0193743_10154774 | 3300019889 | Soil | VLLVLADIFPGGGSPVADVFAIALAIVLFALLYWAIDLIERI |
| Ga0193743_10718402 | 3300019889 | Soil | LLSIADILPGGGSPVADLVAVVIALVLFALLYWAIDLIDRI |
| Ga0193731_10618802 | 3300020001 | Soil | VLSVLADIFPGGGGPLADVFSIAIAVGLFALLYWAIDLIDRI |
| Ga0193726_13409653 | 3300020021 | Soil | VLVFADIFSGGGSPVADLFSIVLGIAMFALLYWLISLIDRI |
| Ga0193752_10418543 | 3300020027 | Soil | VLLGADIFPGGGSPVADVFSIVIAIALFALLYWAIDLIDRI |
| Ga0193753_101744811 | 3300020034 | Soil | ADIFPGGGSPIADVFAVFVAIILFALLYWAIDLIDRI |
| Ga0206351_103804871 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | DIFPGGGSPVADAFAIVLALVLFALLFWAIELIDRI |
| Ga0210388_101130913 | 3300021181 | Soil | VLFLADIFPGGGSPVADLFSIVLAIAMFALLYWLISLIDRI |
| Ga0193706_10268452 | 3300021339 | Soil | VLFLADIFPGGGSPLADLFAVVLAIALFALLYWAIDLIDRI |
| Ga0210393_112808702 | 3300021401 | Soil | VLSILQPAVLADVFPGGGGPLADVFAVAIAVVLFALLCWAIDLIDRI |
| Ga0210389_106130173 | 3300021404 | Soil | VLFLADIFPGGGSPVADLFSIALAIVMFALLYWLISLIDRI |
| Ga0210386_116494551 | 3300021406 | Soil | VLVFADIFPGGGSPLADAFAVVLAVILFALLYWAIDLIDRI |
| Ga0193695_100002339 | 3300021418 | Soil | VLSVLADIFPGSGGPLADVFAIAIAVGLFALLYWAIDLIDRI |
| Ga0210392_101222401 | 3300021475 | Soil | VLFLADIFPGGGGPVADVFSIAIAIAMFAVLYWLISLIDRI |
| Ga0210409_100079858 | 3300021559 | Soil | VLLAADIFPGGGGPLADAFAIAIAVALFALLYWAIDLIDRI |
| Ga0193742_11555313 | 3300021976 | Soil | ARLDDPTALFSIADILPGGGSPVADLVAVVIALVLFALLYWAIDLIDRI |
| Ga0247792_10190481 | 3300022880 | Soil | VSHAALVLLFANLFPGGGSPVADFFSIALAVILFALLYWAIDLIDRI |
| Ga0247765_10139672 | 3300023268 | Plant Litter | VLLFANLFPGGGSPVADFFSIALAVILFALLYWAIDLIDRI |
| Ga0179591_11045076 | 3300024347 | Vadose Zone Soil | VLFLADIFPGGGSPVADLFAIVLAVLLFALLYWAIDLIDRI |
| Ga0209941_10009079 | 3300024978 | Wastewater Bioreactor | VLFLADIFPGGGSPVADVFAIAIALFLFALLFWVIDLIDRI |
| Ga0207420_10117442 | 3300024983 | Wastewater Bioreactor | VPFLADIFPGGGGPLADVFSIVIAIAMFAVLYWLISLIDRI |
| Ga0207656_100022202 | 3300025321 | Corn Rhizosphere | VLLFANLFPGGGGPLADVFSIAIAVVLFVALYWAVELIDRI |
| Ga0208356_1000003159 | 3300025504 | Arctic Peat Soil | VLVVLSDIFPGGGGPLADVFAIAIAVALFALLYWAIDLIDRI |
| Ga0207929_10062641 | 3300025505 | Arctic Peat Soil | VLCLADIFPGGGGPLADVFAIAIAVALFALLYWAIDLIERI |
| Ga0208219_10010383 | 3300025625 | Arctic Peat Soil | VLVFADIFPGGGSPVADVFAVAIALAVFALLYWAIDLIDRI |
| Ga0208589_10127303 | 3300025634 | Arctic Peat Soil | MQSMLILADIFPGGGSPLADVFAVVLALILFALLYWAIDLIDRI |
| Ga0210100_100009413 | 3300025780 | Natural And Restored Wetlands | VFAPADIFPGGGSPIADVFAIVVSVALFALVYWAIDRIDRI |
| Ga0210143_10525082 | 3300025792 | Natural And Restored Wetlands | VLVRLADIFPGGGGPLADVFSIALAVALFALLYWAIELIDRI |
| Ga0210143_10920171 | 3300025792 | Natural And Restored Wetlands | HDPPVLFVFADIFPGGGSPIADVFAIALSVGLFALVYWAIDLIDRI |
| Ga0210143_10991752 | 3300025792 | Natural And Restored Wetlands | MLVLADLFPGGGGPLADAFAIAIAVGLFALLYWAMDLIDRI |
| Ga0209584_100551663 | 3300025878 | Arctic Peat Soil | VIFLSDIFPGGGGPLADVFAIAIALVLFALLYWAIDLIDRV |
| Ga0207682_1000003451 | 3300025893 | Miscanthus Rhizosphere | VLSSADIFPGGGGPLADLVAIALAVGLFALLYWAIDLIDRI |
| Ga0207692_102337791 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LFTPADIFPGGGGPLADVFAIVLAVALFALLYWAIDLIDRI |
| Ga0207642_100004735 | 3300025899 | Miscanthus Rhizosphere | VLSFADIFPGGGGPLADAVAISLSVCLFGLVYWAIDLIDRI |
| Ga0207710_1000015435 | 3300025900 | Switchgrass Rhizosphere | VLVRLADIFPGGGGPLADVLAIAIAVALFALLYWAIDLIERI |
| Ga0207710_102009643 | 3300025900 | Switchgrass Rhizosphere | VLFLADIFPGGGSPVADVFAIAIAFVLFALLFWAIDLIDRI |
| Ga0207710_106410143 | 3300025900 | Switchgrass Rhizosphere | ADIFPGGGGIAADAIAIAIAIAMFAVLYWLIGLIDRI |
| Ga0207710_106442741 | 3300025900 | Switchgrass Rhizosphere | VLFLADIFPGGGGPLADVLAIAIAVGLFALLYWAIDLIDRI |
| Ga0207680_104397283 | 3300025903 | Switchgrass Rhizosphere | VSSFAHLLSAADIFPGGGSPVADLFSIVLAIAMFALLYWLISLIDRI |
| Ga0207654_100113433 | 3300025911 | Corn Rhizosphere | VFVCADLFPGGGGPLADVFSIALAVALFALLYWAIELIDRI |
| Ga0207654_113488383 | 3300025911 | Corn Rhizosphere | VSSFAHLLSAADIFPGGGSPVADLFSIAIAVVMFAALYWLISLIDRI |
| Ga0207707_101416033 | 3300025912 | Corn Rhizosphere | VPSFADIFSGGGGLPADLFAVAVATALFTLLCWAIELIDRI |
| Ga0207671_104995882 | 3300025914 | Corn Rhizosphere | VSSFAHLLSVADIFPGGGSPVADLFSIAIAVVMFAALYWLVSLIDRI |
| Ga0207693_109404382 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVPADIFPGGGGPVADVFAIALSVALFALIFWAIDLIDRI |
| Ga0207663_108946822 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VVPFANLFPGGGSPVADVFSIVLAVILFALLYWAIDLIDRI |
| Ga0207660_105412923 | 3300025917 | Corn Rhizosphere | VLLLADIFPGGGSPIADVCAIGIALVLFALLFCAIDLIDRI |
| Ga0207652_100074883 | 3300025921 | Corn Rhizosphere | VLFLADIFPGGDSPIADVCAIGIALVLFALLFCAIDLIDRI |
| Ga0207681_102775552 | 3300025923 | Switchgrass Rhizosphere | VFVGADIFPGGGSPIADLFSILLAVGLFALLYWAIGLIDRI |
| Ga0207694_10000004775 | 3300025924 | Corn Rhizosphere | VLSLADIFPGGGGPIADVFAIALSVGLFALVSWAIELIDRI |
| Ga0207694_105318513 | 3300025924 | Corn Rhizosphere | VSSFAHLLSAADIFPGGGSPVADLFSIAIAVVMFAALYWLVSLIDRI |
| Ga0207687_100042298 | 3300025927 | Miscanthus Rhizosphere | VPSFADIFPGSGGLPADLLALAIAVALFALLYWAIELIDRI |
| Ga0207687_100129482 | 3300025927 | Miscanthus Rhizosphere | VFVCADLFPGGGSPVADVFSIALAVILFALLYWAIELIDRI |
| Ga0207700_100541382 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VVPFANLFPGGGSPLADVFSIALAVILFALLYWAIDLIDRI |
| Ga0207700_116284491 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VDSDLFFPADIFPGGGSPLADLFAIAVAIGLFGLLYWAIDLIDRI |
| Ga0207664_100571783 | 3300025929 | Agricultural Soil | VFVCADLFPGGGGPLADAFSIALAVILFALLYWAIDLIDRI |
| Ga0207664_104004552 | 3300025929 | Agricultural Soil | VVSVADIFPGGGGPLADVFAIAIAIGLFALLYWAIDLIDRI |
| Ga0207644_112261403 | 3300025931 | Switchgrass Rhizosphere | LFLADIFPGGGSPVADVFAIAIAFVLFALLFWAIDLIDRI |
| Ga0207686_1000003327 | 3300025934 | Miscanthus Rhizosphere | VLLFADIFPGGGGPLADLLAVAIALVLFALLYWAIDLIERI |
| Ga0207686_1000081524 | 3300025934 | Miscanthus Rhizosphere | VLVCLADIFPGGGGPLADVLAIVLAVALFALLYWAIDLIDRI |
| Ga0207686_100897093 | 3300025934 | Miscanthus Rhizosphere | VLVIANIFPGGGGVPADLVAVVVALVTFAVLYLAIDLIDRI |
| Ga0207670_103154892 | 3300025936 | Switchgrass Rhizosphere | VVPFANLFPGGGSPVADVFSIALAVVLFALLYWAIDLIDRI |
| Ga0207669_10000003251 | 3300025937 | Miscanthus Rhizosphere | VLSFADIFPGGGGPLADAVAISLSVCLFGLVRWAIDLIDRI |
| Ga0207669_108177731 | 3300025937 | Miscanthus Rhizosphere | VLFLADIFPGGGSPVADVFAVVLALILFALLYWAIDLIDRI |
| Ga0207704_100000793 | 3300025938 | Miscanthus Rhizosphere | VFVFSDLFPGGGSPLADLFSVALAVVLFALLYWAIDLIDRI |
| Ga0207704_107533923 | 3300025938 | Miscanthus Rhizosphere | VPSFADIFPGGGGLPADFLAVAIAVALFALLYWAIDLIERI |
| Ga0207704_114856341 | 3300025938 | Miscanthus Rhizosphere | LSFLADIFPGGGSPAADVFAIAIAVALFALLYWAIDLIDRI |
| Ga0207661_100017955 | 3300025944 | Corn Rhizosphere | VLSFADIFPGGGGLPADLLALAIAVALFALLYWAIELIDRI |
| Ga0207712_1000000737 | 3300025961 | Switchgrass Rhizosphere | VLSFADIFPGGGGPLADLFAIALAVGLFALLYWAIDLIDRV |
| Ga0207712_103081933 | 3300025961 | Switchgrass Rhizosphere | VLSLADIFPGGGGLPADLFAVAIAVGLFALLYWAIELIDRI |
| Ga0207712_104041981 | 3300025961 | Switchgrass Rhizosphere | VLSVLADIFPGGGSPVADVFAVAIAVALFALLYWAIDLIDRI |
| Ga0207640_1000009433 | 3300025981 | Corn Rhizosphere | VFVCADLFPGGGSPVADVFSIALAVILFALLYWAVELIDRI |
| Ga0207640_100296555 | 3300025981 | Corn Rhizosphere | VNDGLVLSFADIFPGGGGPLTDLFAVALAVGFFGLLYWAIDLIDRI |
| Ga0207703_1000031021 | 3300026035 | Switchgrass Rhizosphere | VLSFADILPGGGGLPADLLAVAIAVALFALLYWAIELIDRI |
| Ga0207703_1000057725 | 3300026035 | Switchgrass Rhizosphere | VLSVLADIFPGGGGPLADVFSIAIAIGLFALLYWAIELIDRV |
| Ga0207703_102390053 | 3300026035 | Switchgrass Rhizosphere | IFPGGGGPLADVLAIAIAVGLFALLYWAIDLIDRI |
| Ga0207639_100106102 | 3300026041 | Corn Rhizosphere | VLSFADIFPGGGGLPADLFALAIAVALFALLYGAIELIDRI |
| Ga0207639_103645073 | 3300026041 | Corn Rhizosphere | VFVCGNIFPGGGSPLADLFSIALAVILFALLYWAIDLIDRI |
| Ga0207678_102669543 | 3300026067 | Corn Rhizosphere | VLSVLADIFPGGGGPLADVFSVAIAIGLFALLYWAIDLIDRV |
| Ga0207678_116630452 | 3300026067 | Corn Rhizosphere | VLFLADIFPGGGGIAADAFSIAIAIAMFAVLYWLIGLIDRI |
| Ga0207702_100295554 | 3300026078 | Corn Rhizosphere | VLSLADIFPGGGGPAADFLAVAIAVALFALLYGAIELIDRI |
| Ga0207702_103652501 | 3300026078 | Corn Rhizosphere | VLFLADIFPGGGSPIADVFAIAIALVLFALLFWAIDLIDRI |
| Ga0207641_1000017010 | 3300026088 | Switchgrass Rhizosphere | VLSFADIFPGGSGVLADLFAVAIAVALFAFLYWAIDLIERI |
| Ga0209620_10226151 | 3300026911 | Forest Soil | MGAQDARVLFLADIFPGGGSPIADVFSIALAIAMFALLYWLISLIDRI |
| Ga0209110_10037182 | 3300027002 | Forest Soil | VLFLADIFPGGGSPIADVFSIAIAIAMFALLYWLISLIDRI |
| Ga0209005_10463201 | 3300027037 | Forest Soil | VLFFADIFPGGGSPVADLFSIAIAVVMFAALYWLISLIDRI |
| Ga0209111_10366041 | 3300027058 | Forest Soil | VLFLADIFPGGGGPAADVFAIAIAIVMFAILYWLISLIDRI |
| Ga0208525_10374202 | 3300027288 | Soil | LFADIFPGGGGLAADLFAVAIAVALFALLYWAIDLIERI |
| Ga0208987_10438193 | 3300027496 | Forest Soil | VPSFADIFPGGGGLPADLFAVAIAVVLFALLYWAIELIDRI |
| Ga0209114_10570743 | 3300027504 | Forest Soil | VLLLANIFPGGGSPLADVFSIAIAIAMFALLYWLISLIDRI |
| Ga0209113_10164313 | 3300027517 | Forest Soil | VLFLADIFPGGGSPLADVFSIAIAIAMFALLYWLISLIDRI |
| Ga0208998_10222842 | 3300027524 | Forest Soil | VLFLADIFPGGGGPFADVFSIAIAIAMFAVLYWLVSLIDRI |
| Ga0208998_10235621 | 3300027524 | Forest Soil | VPSFADIFPGGGGLPADLFAVAIAVALFALLYWAIELIDRI |
| Ga0209222_10720832 | 3300027559 | Forest Soil | VLLLANIFPGGGSPIADVFSIAIAIAMFALLYWLISLIDRI |
| Ga0209177_100010102 | 3300027775 | Agricultural Soil | VLSFADIFPGGGSPVADVISIALALLMFALLYWGIDLIDRI |
| Ga0209726_103049482 | 3300027815 | Groundwater | VLFLADIFAGGGSPLADVFAVAIALGLFALLYWAIELIDRI |
| Ga0209112_100792631 | 3300027817 | Forest Soil | GGAHDACVLFLADIFPGGGSPIADVLSIAIAVAMFAVLYWLISLIDRI |
| Ga0209112_102036393 | 3300027817 | Forest Soil | VGAHDAAVLLFADIFPGGGSPVADLLSVAIAIVMFALLYWLISLIDRI |
| Ga0209112_102165903 | 3300027817 | Forest Soil | IFPGGGGIAADAFSIAIAIAMFAVLYWLISLIDRI |
| Ga0209624_100205753 | 3300027895 | Forest Soil | VLFLADIFPGGGGLLADAFAVAIALAIFALLYWAIDLIDRV |
| Ga0268266_110586292 | 3300028379 | Switchgrass Rhizosphere | VLLLADIFPGGGGPVADVFSIAIAIAMFAVLYWLISLIDRI |
| Ga0268266_114129052 | 3300028379 | Switchgrass Rhizosphere | VLFVLADIFPGGGGPAADAFAIAIALALFALLYWAIDLIDRI |
| Ga0268264_1000537311 | 3300028381 | Switchgrass Rhizosphere | VLSFIADIFPGGGSPLADAFAIALSVGLFALVFWAIDLIDRI |
| Ga0137415_102511232 | 3300028536 | Vadose Zone Soil | VLLGADIFPGGGGPLADALSVVIALVLFALLYWAIDLIDRV |
| Ga0265337_100007433 | 3300028556 | Rhizosphere | VLVFADIFPGGGGPLADVFAIAIAVALFALLYWAIDLIDRI |
| Ga0265326_102171702 | 3300028558 | Rhizosphere | MLSIPDPAVLADIFPGGGGPLADVFAIAIAVGLFALLYWAIDLIDRI |
| Ga0265334_102682572 | 3300028573 | Rhizosphere | LFADIFPGGGGPLADVFAIAIAVVLFALLYWAIDLIDRI |
| Ga0307299_101081782 | 3300028793 | Soil | LLADIFPGGGGPLADLFAVALAVAIFALLLWAIDLIDRI |
| Ga0265338_1000044142 | 3300028800 | Rhizosphere | MPLADIFPGGGGPLADLLAIAIAVGLFALLYWAIDLIDRI |
| Ga0307503_1000002783 | 3300028802 | Soil | VVSFADIFPGGGGPFADVFAIALSVVLFALVYWAIDLIDRI |
| Ga0307503_104480233 | 3300028802 | Soil | SVLADIFPGGGGPLADILAIAIAVGIFALLYWAIDLIDRI |
| Ga0307289_101121063 | 3300028875 | Soil | LVLFTLADIFPGGGGPVADVFAIAIAVALFALLYWAIDLIDRI |
| Ga0307289_104512111 | 3300028875 | Soil | ADIFPGGGGPLADVFAIAIAVGLFALLYWAIDLIERI |
| Ga0247826_110727223 | 3300030336 | Soil | VVSFADIFPGGGPLADVFAIALSVGLFGLVYWAIDLIDRI |
| Ga0074003_135059972 | 3300031003 | Soil | VLLFADIFPGGGGPLADVVSVVLALVLFALLFWAIDLIDRI |
| Ga0307498_104436033 | 3300031170 | Soil | VLSFADIFPGGGGPIADVFAIALSVGLFALVYWAIDLIDRI |
| Ga0307499_100673381 | 3300031184 | Soil | MVSFADVFPGGGGVPADLFAVAIAVGIFALLYWAIDLIE |
| Ga0307500_100097791 | 3300031198 | Soil | VLVPADIFPGGGGPLADVFAIAVAVALFALLYWAIDLIDRI |
| Ga0307497_102328001 | 3300031226 | Soil | VLSVLADIFPGGGGPLADAFAIALSVGLFALLYWAIDLIDRI |
| Ga0265342_103617181 | 3300031712 | Rhizosphere | QSVLVFADIFPGGGGPLADVFAIAIAVALFALLYWAIDLIDRI |
| Ga0307476_100021465 | 3300031715 | Hardwood Forest Soil | VLVPADIFPGGGGPVADLFSIVLAVALLALLYWAIDLIDRI |
| Ga0307468_1013650903 | 3300031740 | Hardwood Forest Soil | VISFADIFPGGGSPIADVFAIALSVGLFALVYWAIDLIDRI |
| Ga0311367_113188863 | 3300031918 | Fen | MNSLADIFPGGGGVPADVFAIAIALIIFALLYWAIDLIGRI |
| Ga0308176_119372401 | 3300031996 | Soil | LADIFPGGGGPAADFLAVAIAVALFALLYGAIELIDRI |
| Ga0307472_1001079931 | 3300032205 | Hardwood Forest Soil | VFVCSDIFPGGGGPLADLFSIALAVVLFALLYWAIDLID |
| Ga0307472_1007338942 | 3300032205 | Hardwood Forest Soil | VLSVLADIFPGGGGPLADVFAVAIAVGIFALLYWAIDLIDRI |
| Ga0307472_1013850601 | 3300032205 | Hardwood Forest Soil | VNDGLVLSFADIFPGGGGPLADLFSIALAVGLFGLLYWAIDVIDRI |
| Ga0335085_103678052 | 3300032770 | Soil | VLVPADVFPGGGGPLADVFAIALSVGLFALIFWAIDLIDRI |
| Ga0335078_111254312 | 3300032805 | Soil | LFPAANIFPGGGSPVADVFAIAIAIGIFALLYWAIDLIDRI |
| Ga0335070_1000018432 | 3300032829 | Soil | VLVLDSIQTFADIFPGGGSPLADAFSIALAVALFALLLWAIDLIDRI |
| Ga0335070_104185523 | 3300032829 | Soil | VLSVLADIFPGGGSPVADVFAIALSVFLFALIYWAIDLIDRI |
| Ga0335070_104978713 | 3300032829 | Soil | MIAAVLVPADIFPGGGSPIADVFAIALSVGLFALVFWAIDLIDRI |
| Ga0335070_120907202 | 3300032829 | Soil | VLFVLADLFPGGGGPLADVVAIAIAVALFALLYWAIDLIDRI |
| Ga0335075_100367381 | 3300032896 | Soil | VLFLADIFPGGGSPVADLFSIAIAVAMFALLYWLIGLIDRI |
| Ga0335075_113831893 | 3300032896 | Soil | VLFLADIFPGGGSPVADLFSIVLAIAMFAVLYWLISLIDRI |
| Ga0335083_1000050039 | 3300032954 | Soil | VLLLADIFPGGGSPVADVFSIALAIAMFALLYWLIALIDRI |
| Ga0335076_115327452 | 3300032955 | Soil | VLSPADIFPGGGGVPADVFAIALSVLLFALVYWAIDLIDRI |
| Ga0326726_108501481 | 3300033433 | Peat Soil | LADIFPGGGSPLADAFAIAISVALFALIYWAIDLIDRI |
| Ga0372943_0277517_51_176 | 3300034268 | Soil | VPSFADIFPGAGGLPADLFAVAIAVGLFALLYWAIELIDRI |
| Ga0370497_0000441_664_789 | 3300034965 | Untreated Peat Soil | LSFLADIFPGGGSPAADVFAIAIAVCLFALLYWAIDLIDRI |
| ⦗Top⦘ |