3300020071: Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-3 (Metagenome Metatranscriptome) (v2)

Overview

Basic Information

• IMG/M Taxon OID: 3300020071
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0090294 | Gp0175827 | Ga0206348
• Sample Name: Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-3 (Metagenome Metatranscriptome) (v2)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 7213148
• Sequencing Scaffolds: 1
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → rhizosphere → soil
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere

Location Information

• Location: USA: Michigan
• Coordinates
  • Lat. (^o): 42.3948
  • Long. (^o): -85.3738
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002974	Metagenome / Metatranscriptome	516	Y
F078550	Metagenome / Metatranscriptome	116	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0206348_108127	All Organisms → cellular organisms → Bacteria	692

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0206348_108127	Ga0206348_1081271	F078550	VTAKDREGVNPRLQGGVWETPLAEEIRVSPECSAYMGAWKDQDWM
Ga0206348_116366	Ga0206348_1163661	F002974	GIIRRPENVKRGRGRPTLTWTEAVKRDLKEWNIDKELAVDRKGWKCAIHVPEP