| Basic Information | |
|---|---|
| Family ID | F032897 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 178 |
| Average Sequence Length | 53 residues |
| Representative Sequence | VDASFTRSHCHQNTIALQYVPSELQLADFFTKAQTREQHRLHMLKLNASDPPPPP |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 178 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 65.73 % |
| % of genes from short scaffolds (< 2000 bps) | 68.54 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (65.730 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (75.843 % of family members) |
| Environment Ontology (ENVO) | Unclassified (93.820 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (49.438 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.60% β-sheet: 0.00% Coil/Unstructured: 49.40% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 178 Family Scaffolds |
|---|---|---|
| PF07727 | RVT_2 | 3.93 |
| PF14223 | Retrotran_gag_2 | 2.25 |
| PF13966 | zf-RVT | 1.69 |
| PF00931 | NB-ARC | 0.56 |
| PF02732 | ERCC4 | 0.56 |
| PF00102 | Y_phosphatase | 0.56 |
| PF00271 | Helicase_C | 0.56 |
| PF00916 | Sulfate_transp | 0.56 |
| PF00113 | Enolase_C | 0.56 |
| PF00941 | FAD_binding_5 | 0.56 |
| PF00625 | Guanylate_kin | 0.56 |
| PF01652 | IF4E | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
|---|---|---|---|
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 0.56 |
| COG0194 | Guanylate kinase | Nucleotide transport and metabolism [F] | 0.56 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.56 |
| COG1948 | ERCC4-type crossover junction endonuclease | Replication, recombination and repair [L] | 0.56 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.56 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.56 |
| COG2453 | Protein-tyrosine phosphatase | Signal transduction mechanisms [T] | 0.56 |
| COG5599 | Protein tyrosine phosphatase | Signal transduction mechanisms [T] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.73 % |
| Unclassified | root | N/A | 34.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005347|Ga0070668_101556732 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 605 | Open in IMG/M |
| 3300005355|Ga0070671_102060785 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 508 | Open in IMG/M |
| 3300005841|Ga0068863_100640540 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa | 1054 | Open in IMG/M |
| 3300009995|Ga0105139_1021471 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 969 | Open in IMG/M |
| 3300010371|Ga0134125_12079062 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum tuberosum | 617 | Open in IMG/M |
| 3300012069|Ga0153965_1072162 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → Dioscoreales → Dioscoreaceae → Dioscorea → Dioscorea cayenensis → Dioscorea cayenensis subsp. rotundata | 527 | Open in IMG/M |
| 3300014486|Ga0182004_10014073 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 6298 | Open in IMG/M |
| 3300015278|Ga0182099_1001719 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1358 | Open in IMG/M |
| 3300015278|Ga0182099_1036563 | All Organisms → cellular organisms → Eukaryota | 615 | Open in IMG/M |
| 3300015280|Ga0182100_1019346 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 856 | Open in IMG/M |
| 3300015283|Ga0182156_1006184 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1062 | Open in IMG/M |
| 3300015284|Ga0182101_1038328 | All Organisms → cellular organisms → Eukaryota | 694 | Open in IMG/M |
| 3300015284|Ga0182101_1049407 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa | 641 | Open in IMG/M |
| 3300015284|Ga0182101_1073123 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum tuberosum | 562 | Open in IMG/M |
| 3300015288|Ga0182173_1055669 | All Organisms → cellular organisms → Eukaryota | 573 | Open in IMG/M |
| 3300015293|Ga0182103_1050605 | All Organisms → cellular organisms → Eukaryota | 637 | Open in IMG/M |
| 3300015294|Ga0182126_1086783 | Not Available | 519 | Open in IMG/M |
| 3300015301|Ga0182184_1032395 | All Organisms → cellular organisms → Eukaryota | 737 | Open in IMG/M |
| 3300015310|Ga0182162_1083420 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales | 594 | Open in IMG/M |
| 3300015311|Ga0182182_1014224 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1020 | Open in IMG/M |
| 3300015312|Ga0182168_1018725 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1004 | Open in IMG/M |
| 3300015321|Ga0182127_1093993 | All Organisms → cellular organisms → Eukaryota | 551 | Open in IMG/M |
| 3300015324|Ga0182134_1030111 | All Organisms → cellular organisms → Eukaryota | 893 | Open in IMG/M |
| 3300015326|Ga0182166_1142443 | All Organisms → cellular organisms → Eukaryota | 506 | Open in IMG/M |
| 3300015327|Ga0182114_1137097 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum tuberosum | 540 | Open in IMG/M |
| 3300015330|Ga0182152_1005295 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1530 | Open in IMG/M |
| 3300015330|Ga0182152_1029619 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 921 | Open in IMG/M |
| 3300015332|Ga0182117_1139753 | Not Available | 548 | Open in IMG/M |
| 3300015335|Ga0182116_1049607 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 848 | Open in IMG/M |
| 3300015335|Ga0182116_1097755 | All Organisms → cellular organisms → Eukaryota | 654 | Open in IMG/M |
| 3300015335|Ga0182116_1179655 | All Organisms → cellular organisms → Eukaryota | 500 | Open in IMG/M |
| 3300015336|Ga0182150_1107628 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 601 | Open in IMG/M |
| 3300015337|Ga0182151_1036078 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 887 | Open in IMG/M |
| 3300015337|Ga0182151_1069947 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 706 | Open in IMG/M |
| 3300015338|Ga0182137_1007354 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1530 | Open in IMG/M |
| 3300015338|Ga0182137_1142441 | All Organisms → cellular organisms → Eukaryota | 556 | Open in IMG/M |
| 3300015340|Ga0182133_1098640 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 668 | Open in IMG/M |
| 3300015340|Ga0182133_1112094 | All Organisms → cellular organisms → Eukaryota | 635 | Open in IMG/M |
| 3300015340|Ga0182133_1184128 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 512 | Open in IMG/M |
| 3300015343|Ga0182155_1179421 | Not Available | 547 | Open in IMG/M |
| 3300015343|Ga0182155_1202126 | Not Available | 523 | Open in IMG/M |
| 3300015344|Ga0182189_1132433 | Not Available | 619 | Open in IMG/M |
| 3300015345|Ga0182111_1037600 | All Organisms → cellular organisms → Eukaryota | 1004 | Open in IMG/M |
| 3300015346|Ga0182139_1001889 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 2353 | Open in IMG/M |
| 3300015347|Ga0182177_1049107 | Not Available | 921 | Open in IMG/M |
| 3300015347|Ga0182177_1050660 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 911 | Open in IMG/M |
| 3300015348|Ga0182115_1042678 | All Organisms → cellular organisms → Eukaryota | 1295 | Open in IMG/M |
| 3300015348|Ga0182115_1117870 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 841 | Open in IMG/M |
| 3300015348|Ga0182115_1133247 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 792 | Open in IMG/M |
| 3300015348|Ga0182115_1162395 | All Organisms → cellular organisms → Eukaryota | 716 | Open in IMG/M |
| 3300015348|Ga0182115_1163506 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 713 | Open in IMG/M |
| 3300015350|Ga0182163_1029543 | All Organisms → cellular organisms → Eukaryota | 1430 | Open in IMG/M |
| 3300015350|Ga0182163_1263899 | All Organisms → cellular organisms → Eukaryota | 539 | Open in IMG/M |
| 3300015352|Ga0182169_1067324 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa | 1108 | Open in IMG/M |
| 3300017411|Ga0182208_1000488 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 2525 | Open in IMG/M |
| 3300017412|Ga0182199_1023551 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1092 | Open in IMG/M |
| 3300017414|Ga0182195_1185025 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa | 542 | Open in IMG/M |
| 3300017421|Ga0182213_1209580 | All Organisms → cellular organisms → Eukaryota | 556 | Open in IMG/M |
| 3300017440|Ga0182214_1090479 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 645 | Open in IMG/M |
| 3300017685|Ga0182227_1048553 | Not Available | 752 | Open in IMG/M |
| 3300017686|Ga0182205_1145254 | All Organisms → cellular organisms → Eukaryota | 532 | Open in IMG/M |
| 3300017690|Ga0182223_1104274 | Not Available | 528 | Open in IMG/M |
| 3300020077|Ga0206351_10585402 | All Organisms → cellular organisms → Eukaryota | 646 | Open in IMG/M |
| 3300020077|Ga0206351_10856682 | All Organisms → cellular organisms → Eukaryota | 608 | Open in IMG/M |
| 3300020082|Ga0206353_10968780 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 620 | Open in IMG/M |
| 3300022465|Ga0213505_113699 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 667 | Open in IMG/M |
| 3300025912|Ga0207707_11482316 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 538 | Open in IMG/M |
| 3300026095|Ga0207676_10583790 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa | 1072 | Open in IMG/M |
| 3300028051|Ga0268344_1024854 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 513 | Open in IMG/M |
| 3300028055|Ga0268338_1005995 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 908 | Open in IMG/M |
| 3300028058|Ga0268332_1069977 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa | 527 | Open in IMG/M |
| 3300028061|Ga0268314_1007384 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 981 | Open in IMG/M |
| 3300028151|Ga0268308_1003122 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 1065 | Open in IMG/M |
| 3300028154|Ga0268341_1021932 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 567 | Open in IMG/M |
| 3300028248|Ga0268312_1014263 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 688 | Open in IMG/M |
| 3300028251|Ga0268324_1003001 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 937 | Open in IMG/M |
| 3300032464|Ga0214492_1060311 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 733 | Open in IMG/M |
| 3300032465|Ga0214493_1002816 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 2653 | Open in IMG/M |
| 3300032466|Ga0214503_1229508 | All Organisms → cellular organisms → Eukaryota | 575 | Open in IMG/M |
| 3300032490|Ga0214495_1063204 | All Organisms → cellular organisms → Eukaryota | 864 | Open in IMG/M |
| 3300032490|Ga0214495_1064350 | All Organisms → cellular organisms → Eukaryota | 856 | Open in IMG/M |
| 3300032490|Ga0214495_1084308 | All Organisms → cellular organisms → Eukaryota | 738 | Open in IMG/M |
| 3300032502|Ga0214490_1034087 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum tuberosum | 1121 | Open in IMG/M |
| 3300032514|Ga0214502_1013508 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 2487 | Open in IMG/M |
| 3300032551|Ga0321339_1118786 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 595 | Open in IMG/M |
| 3300032591|Ga0214484_1040917 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 973 | Open in IMG/M |
| 3300032591|Ga0214484_1110513 | Not Available | 559 | Open in IMG/M |
| 3300032689|Ga0214497_1022622 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1303 | Open in IMG/M |
| 3300032699|Ga0214494_1001745 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 2642 | Open in IMG/M |
| 3300032699|Ga0214494_1100416 | All Organisms → cellular organisms → Eukaryota | 540 | Open in IMG/M |
| 3300032757|Ga0314753_1010267 | All Organisms → cellular organisms → Eukaryota | 1561 | Open in IMG/M |
| 3300032758|Ga0314746_1030833 | Not Available | 1198 | Open in IMG/M |
| 3300032760|Ga0314754_1023287 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 974 | Open in IMG/M |
| 3300032761|Ga0314733_1104413 | All Organisms → cellular organisms → Eukaryota | 529 | Open in IMG/M |
| 3300032789|Ga0314725_1002494 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1837 | Open in IMG/M |
| 3300032791|Ga0314748_1008931 | All Organisms → cellular organisms → Eukaryota | 1789 | Open in IMG/M |
| 3300032791|Ga0314748_1040438 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 985 | Open in IMG/M |
| 3300032812|Ga0314745_1010091 | All Organisms → cellular organisms → Eukaryota | 1746 | Open in IMG/M |
| 3300032812|Ga0314745_1032613 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1102 | Open in IMG/M |
| 3300032823|Ga0314723_1053454 | All Organisms → cellular organisms → Eukaryota | 773 | Open in IMG/M |
| 3300032823|Ga0314723_1100811 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 536 | Open in IMG/M |
| 3300032824|Ga0314735_1059525 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida | 724 | Open in IMG/M |
| 3300032824|Ga0314735_1071932 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 651 | Open in IMG/M |
| 3300032825|Ga0314724_121465 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 635 | Open in IMG/M |
| 3300032844|Ga0314743_1116911 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa | 604 | Open in IMG/M |
| 3300032844|Ga0314743_1130991 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 561 | Open in IMG/M |
| 3300032890|Ga0314747_1050166 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 613 | Open in IMG/M |
| 3300032890|Ga0314747_1055441 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 577 | Open in IMG/M |
| 3300032913|Ga0314739_1090258 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa | 564 | Open in IMG/M |
| 3300032915|Ga0314749_1101793 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum tuberosum | 617 | Open in IMG/M |
| 3300032916|Ga0314734_1077074 | All Organisms → cellular organisms → Eukaryota | 668 | Open in IMG/M |
| 3300032916|Ga0314734_1102281 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 563 | Open in IMG/M |
| 3300032934|Ga0314741_1041064 | All Organisms → cellular organisms → Eukaryota | 1059 | Open in IMG/M |
| 3300032953|Ga0314729_111799 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 706 | Open in IMG/M |
| 3300032959|Ga0314738_1030793 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 965 | Open in IMG/M |
| 3300032966|Ga0314722_1068588 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 549 | Open in IMG/M |
| 3300032970|Ga0314716_112835 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 986 | Open in IMG/M |
| 3300033526|Ga0314761_1071045 | All Organisms → cellular organisms → Eukaryota | 774 | Open in IMG/M |
| 3300033526|Ga0314761_1146527 | All Organisms → cellular organisms → Eukaryota | 519 | Open in IMG/M |
| 3300033526|Ga0314761_1150119 | Not Available | 512 | Open in IMG/M |
| 3300033530|Ga0314760_1050301 | All Organisms → cellular organisms → Eukaryota | 1029 | Open in IMG/M |
| 3300033531|Ga0314756_1023574 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 1088 | Open in IMG/M |
| 3300033531|Ga0314756_1077343 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa | 580 | Open in IMG/M |
| 3300033533|Ga0314770_1302272 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 501 | Open in IMG/M |
| 3300033535|Ga0314759_1061080 | All Organisms → cellular organisms → Eukaryota | 1142 | Open in IMG/M |
| 3300033535|Ga0314759_1078895 | All Organisms → cellular organisms → Eukaryota | 1018 | Open in IMG/M |
| 3300033538|Ga0314755_1156413 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa | 580 | Open in IMG/M |
| 3300033539|Ga0314762_1108879 | All Organisms → cellular organisms → Eukaryota | 512 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 75.84% |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 8.99% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 5.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.12% |
| Root | Host-Associated → Plants → Roots → Unclassified → Unclassified → Root | 1.12% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.12% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 1.12% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 1.12% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300012069 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL049 MetaG | Host-Associated | Open in IMG/M |
| 3300012089 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaG | Host-Associated | Open in IMG/M |
| 3300014486 | Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12JUL2016_LR1 MT pilot (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028051 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028153 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028248 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028251 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032464 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032469 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032490 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032514 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032548 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032551 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032589 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032591 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032592 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032625 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032698 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032699 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032757 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032758 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032760 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032761 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032789 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032791 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032812 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032823 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032824 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032825 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032844 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032890 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032913 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032915 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032916 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032934 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032953 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032959 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032966 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032970 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033526 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033530 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033531 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033532 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033533 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033535 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033538 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033539 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070668_1015567322 | 3300005347 | Switchgrass Rhizosphere | HCHQKTIDLQYVPSELQVADFFTKAQTQEQHWFNMLKLNASDPPLPP* |
| Ga0070671_1020607851 | 3300005355 | Switchgrass Rhizosphere | LTKHIGVDASFTRSHCHQNTIALQYVPSELQVADFFTKAQTREQHRLHMLKLNASDPPPPP* |
| Ga0068863_1006405401 | 3300005841 | Switchgrass Rhizosphere | VKHELTKHIGVDAAFTRSHCHQKTIALEYVSSEQQLADFFTKAQTREHHRLHLLKLNALDPP* |
| Ga0105139_10214713 | 3300009995 | Switchgrass Associated | HIGVDSASIRSHCQNFTIDLKYVPSELQVADFFTKAQTKEQHRFYISKLNVSDS* |
| Ga0105139_10841571 | 3300009995 | Switchgrass Associated | IALEYVSLEQQLADFFTKAQTREHHRLHLLKLNASDPP* |
| Ga0134125_120790621 | 3300010371 | Terrestrial Soil | IQIANDPVKHELTKHIGVDASFTRSHCHQKTIDLQYVPSELQLTDFFTKAQTPEQHRLHLLKLNASNPPFPP* |
| Ga0153965_10721621 | 3300012069 | Attine Ant Fungus Gardens | PVKHELTKHIGVDTHFTRCSVQDQTVTLSYLPSELQVVDFFTKAQTREQHLFLLSKLKTFDPP* |
| Ga0153924_10902671 | 3300012089 | Attine Ant Fungus Gardens | YLPSELQVADFFTKAQTRKQHLFMLSKLKTFDPP* |
| Ga0182004_100140736 | 3300014486 | Root | GVDAFFTRSHCHQKTIALRYVPSELQLADFFTKAQTQEQHRLHLIKLNASDPPIPP* |
| Ga0182004_100843251 | 3300014486 | Root | QKTISLQYVPSELQLADFFTKAQTREQHRLHLIKLNASNPLLPP* |
| Ga0182099_10017192 | 3300015278 | Switchgrass Phyllosphere | SHCQQNTIALQYMPSELQVADFFTKAQTQEQHRLHLLKLNASDPPLPP* |
| Ga0182099_10365632 | 3300015278 | Switchgrass Phyllosphere | SHCQNSTIDIKYVPSELQVADFFTKAQTKEQHRFYISKLNVSDS* |
| Ga0182100_10193461 | 3300015280 | Switchgrass Phyllosphere | ASFTRSHCHQKTIDLQYVPSELQVADFFTKAQTQEQHWFNMLKLNASDHPLPP* |
| Ga0182156_10061842 | 3300015283 | Miscanthus Phyllosphere | TRSHCHQKTISLQYVPSELQLADFFTKAQTREQHRLHLIKLNALDPPLSP* |
| Ga0182101_10369671 | 3300015284 | Switchgrass Phyllosphere | VKHELIKHIGVDAFFTRSYCHQKTIALQYAPSELQLADFFTKIQTRKQH |
| Ga0182101_10383281 | 3300015284 | Switchgrass Phyllosphere | ELTKYIGVDASFTRSHCQQQTIALYYVSSELQVADFFTKAQTREQHQLHLLKLNASNPPPPP* |
| Ga0182101_10494071 | 3300015284 | Switchgrass Phyllosphere | IGVDASFTRSHCHQQTIALQYVPSELQVADFFTKAQTQEQHRLHLLKLNASDPPPPP* |
| Ga0182101_10731231 | 3300015284 | Switchgrass Phyllosphere | IQIANDPVKHELTKHIGVDASFTRSHCHQKTIALQYVPSELQLVDFFTKAQTREHHRLHLLKLNASDPP* |
| Ga0182173_10556691 | 3300015288 | Miscanthus Phyllosphere | KHIGVDAFFTRSHCHQQTIALRYVPSELQLADFFTKAQTREQHRPHLIKPNVSDPPLPP* |
| Ga0182105_10697322 | 3300015290 | Switchgrass Phyllosphere | VPSELQVADFFTKAQTREQHRLHMLKLNASDPPPPP* |
| Ga0182103_10506051 | 3300015293 | Switchgrass Phyllosphere | SFTRSHCQQSTIDLQYVPSEVQVADFFTKAQTQDQHHFHLSKLNVSDLISSHPP* |
| Ga0182126_10867832 | 3300015294 | Miscanthus Phyllosphere | YSMKHELTTYIGVNAFFTRSHCHKKTIALQYVPSELQLADFFIKAQTREQHQLHLIKPNAPPLPH* |
| Ga0182184_10323952 | 3300015301 | Switchgrass Phyllosphere | ASFTRSHCQQQTIALQYVPSELQVADFFTKAQTREQHRLHLLKLNASNPPPPP* |
| Ga0182162_10834201 | 3300015310 | Switchgrass Phyllosphere | KHELTKHIGVDASFTRSHCHQKTIDLQYVPSELQLAVFTKAQTREQHRFHLLKLNASNPPLPP* |
| Ga0182182_10142241 | 3300015311 | Switchgrass Phyllosphere | VDASFTRSHCQQKTIDLQYVPSELQLADFFTKAQTREHHRLHLLKLNASDPP* |
| Ga0182168_10187252 | 3300015312 | Switchgrass Phyllosphere | LTKHIGVDAFFTRSHCHQKTIALQYVPSELQLADFFTKVQTREQHRLHLLKLNASDPPLPP* |
| Ga0182130_10038951 | 3300015319 | Switchgrass Phyllosphere | SELQVADFFTKAQTREQHRLHLLKINASDPPLPL* |
| Ga0182127_10939932 | 3300015321 | Miscanthus Phyllosphere | MNLTKHIGVNAFFTRSHCHQKTIALQHVPSELQLADFFIKAQAREQHQLHLIKPNAPPLPH* |
| Ga0182134_10301111 | 3300015324 | Switchgrass Phyllosphere | AAFTWSHCHQKTIALEYVSSEQQLADFFTKAQTREHHRLHLLKLNASNPP* |
| Ga0182148_10003013 | 3300015325 | Switchgrass Phyllosphere | PSELQVADFFTKAQTQEQHWFNMLKLNASDPPLPP* |
| Ga0182166_11424431 | 3300015326 | Switchgrass Phyllosphere | IGVDAFFTRSYCHQKTIALQYAPSELQLADFFTKIQTRKQYRLHLLKLNASDPPLPPWV* |
| Ga0182114_10767471 | 3300015327 | Switchgrass Phyllosphere | RQKTVDLQYVPSEAQLADFFTKAQTRAQHQFHLIKLNVSDPPLPP* |
| Ga0182114_11370971 | 3300015327 | Switchgrass Phyllosphere | KHELTKHIGVDASFTRSHCHQQTIALQYVPSELQVADFFTKAQTREQHRLHLLKLNASDPPPPP* |
| Ga0182135_11564482 | 3300015329 | Switchgrass Phyllosphere | QKTIDLQYVPSELQLADFFTKAQTREQHRLHLLKLNASNPPFPP* |
| Ga0182152_10052952 | 3300015330 | Switchgrass Phyllosphere | FTRSHCHQKTIALEYVSSEQQLAYFFTKAQTRKHHRLHLLKLNASDPP* |
| Ga0182152_10296191 | 3300015330 | Switchgrass Phyllosphere | HIGVDASFTWSHCHQKTIALQYVPSELQVADFFTKAQTREQHRLHLLKLNASDPPSPP* |
| Ga0182117_10443621 | 3300015332 | Switchgrass Phyllosphere | LQYVPSELQVADFFTKAQTREQHRLHLLKLNASDPPSPP* |
| Ga0182117_11397531 | 3300015332 | Switchgrass Phyllosphere | VKHELTKHIGVDAAFTRSHCHQKTIALEYVSSEQQLADFFTKAQTREHHRLHLLKLNASDPP* |
| Ga0182132_10291432 | 3300015334 | Switchgrass Phyllosphere | CHQKTIALQYVPSELQVADFFTKAQTREQHRLHLLKLNASDPPFPP* |
| Ga0182132_10677041 | 3300015334 | Switchgrass Phyllosphere | RCHKKTIALQYVLFELQLADFFTKAQTREQHWLHLLKLNASDPPHPP* |
| Ga0182116_10107381 | 3300015335 | Switchgrass Phyllosphere | TIALQYVPSELQLADLFTKAQTREQHRLHLLKLNASDPPRPP* |
| Ga0182116_10496071 | 3300015335 | Switchgrass Phyllosphere | HQKTIALEYVSSEQQLADFFTKAQTREHHRLHLLKLNASDPP* |
| Ga0182116_10977551 | 3300015335 | Switchgrass Phyllosphere | DPVKRELTKHIGVDISFTRSHCHQKTIDLKYVPSETQFADFFTKAQTRAQHQFHLFILNVSDPPLPP* |
| Ga0182116_11796551 | 3300015335 | Switchgrass Phyllosphere | VDASFTQSHCHLKTIALQYVPSELQLADLFTKAQTREQHRLHLLKLNPSDPPLPP* |
| Ga0182150_11076281 | 3300015336 | Switchgrass Phyllosphere | SFTRSHCHEKTIDLQYVPSELQLADFFTKAQIREQHRLHLLKLNASNPPLPP* |
| Ga0182151_10360781 | 3300015337 | Switchgrass Phyllosphere | DASFTRSNCHHNTIALRYVPSKLQLADFFTKAQTREQQRLHMLKLNASDPPPRS* |
| Ga0182151_10649042 | 3300015337 | Switchgrass Phyllosphere | ALQYVPSELQLADFFTKAQTREHHRLYLLKLNASDPP* |
| Ga0182151_10699472 | 3300015337 | Switchgrass Phyllosphere | QKTIALEYVSSEQQLADFFTKAQTREHHCLHLLKLNASDPS* |
| Ga0182137_10073542 | 3300015338 | Switchgrass Phyllosphere | GVDASFTRSHCQQKTIDLQYVPSELQLADFFTKAQTREHHRLHLLKLNASDPP* |
| Ga0182137_11424411 | 3300015338 | Switchgrass Phyllosphere | HELTKHIGVDASFIRSHCQLSTVDLQYTPSELQLADFFTKAQTRDQHQFHVFKLNVSDSVISQPPLV* |
| Ga0182133_10986401 | 3300015340 | Switchgrass Phyllosphere | CHQKTIALEYVSSEQQLADFFTKAQTREHHRLHLLKLNASDPP* |
| Ga0182133_11120941 | 3300015340 | Switchgrass Phyllosphere | RSHCHQKTIALEYVSSEQQLADFFTKAQTREHHRLHLLKLNASDPP* |
| Ga0182133_11750541 | 3300015340 | Switchgrass Phyllosphere | IALQYVPSELQVADFFTKAQTREQHQLHLLKLNASNPPFPP* |
| Ga0182133_11841282 | 3300015340 | Switchgrass Phyllosphere | HCHQKTIALQYVPSELQLADFFTKAQIREHHRLHLLKLNASDPP* |
| Ga0182155_11794211 | 3300015343 | Miscanthus Phyllosphere | KHEPTKHIGVDAFFTRSHCHQKTSSLKYVPLELQLPDFFTKAQTREQHQLHLIKLNALNQLLPP* |
| Ga0182155_12021262 | 3300015343 | Miscanthus Phyllosphere | FDGYSMILVFLVMHPHLLQIASDPVKHELTKHIGVDAFFTSSHRHQKTIYLQYVTSELQLADFLTKAQTREQHRLHLIKLNASDPPLPP* |
| Ga0182189_11324331 | 3300015344 | Miscanthus Phyllosphere | MKHELTKHIGVDAFFTRSHCNQHTIALQYVPSELKLADFTKAQTREQHRLHLLKLNASDPPLPP* |
| Ga0182111_10363102 | 3300015345 | Miscanthus Phyllosphere | TVDLQYVPSELQLADFFTKAQTREQHRLHLIKLNASDHPLPP* |
| Ga0182111_10376001 | 3300015345 | Miscanthus Phyllosphere | HIGVDAFFTRFHCNQHTIALQYVPSELKLADFTKAQTREQHRLHLLKLNASDPPLPP* |
| Ga0182139_10018892 | 3300015346 | Miscanthus Phyllosphere | GVDAFFTRSHCHQKTISLQYVPSELQLADFFTKAQTREQHRLHLIKLNALDPPLSP* |
| Ga0182177_10491071 | 3300015347 | Miscanthus Phyllosphere | KHELTKHIGVNAFFTRSHCHQKTIALQHVPSELQLADFFIKAQAREQHQLHLIKPNAPPLPH* |
| Ga0182177_10506602 | 3300015347 | Miscanthus Phyllosphere | NTRAIQIANDPVKRELTKHFFTRSYFNQHTIALQYVPSELQLADFFTRAQTREKHWLHLLKLNASDLPLLP* |
| Ga0182115_10155961 | 3300015348 | Switchgrass Phyllosphere | IALQYVPSELQVADFFTKAQTQEQHRLHLIKLNASDPPLPP* |
| Ga0182115_10426781 | 3300015348 | Switchgrass Phyllosphere | VDASFTRYHCQQSTIDLQYVPSELQVADFFTKAQTHNQHLFHLSKLNVSDVESLHPP* |
| Ga0182115_11178701 | 3300015348 | Switchgrass Phyllosphere | KHIGVDASFTRSHCHQKTIALQYVPSELQVADLFTKAQTREQHRLHTLKLNASDPPPPP* |
| Ga0182115_11332471 | 3300015348 | Switchgrass Phyllosphere | VDASFTRSHCHQKTIALEYVSSEQQLAYFFTKAQTRKHHRLHLLKLNASDPP* |
| Ga0182115_11623951 | 3300015348 | Switchgrass Phyllosphere | SFTRSHCHQKTIALQYVPSELQLADFFTKAQTREHHRLHLLKLNASDPP* |
| Ga0182115_11635061 | 3300015348 | Switchgrass Phyllosphere | QKTIALEYVSSEQQLADFFTKAQTREHHRLHLLKLNASDLP* |
| Ga0182185_11370011 | 3300015349 | Switchgrass Phyllosphere | LQYVPSELQLADFFTKAQTREHHRLHLLKLNASDPP* |
| Ga0182185_12374692 | 3300015349 | Switchgrass Phyllosphere | QKTVDLQYVPSEAQLADFFTKAQTRAQHQFHLIKVNASDPPLPP* |
| Ga0182163_10295431 | 3300015350 | Switchgrass Phyllosphere | TGAIQIANDPVKHELTKHIGVDASFTRSHCHQKTIDLQYVPSELQLTDFFTKAQTPEQHRLHLLKLNASNPPLPP* |
| Ga0182163_12638991 | 3300015350 | Switchgrass Phyllosphere | KHIGVDASFTRSHCHQQTIALQYVPSELQVADFFTKAQTRVHHQLHLLKLNAFNPPPPP* |
| Ga0182169_10673241 | 3300015352 | Switchgrass Phyllosphere | LTKHIGVDASFTRSHCHQNTIALQYVPSELQVADFFTKAQTQEQHRLHLIKLNISYPSLPP* |
| Ga0182167_10800021 | 3300015354 | Switchgrass Phyllosphere | VPSELQVADFFTKVQTREQHRLHLLKLNASDPPLPP* |
| Ga0182167_13029851 | 3300015354 | Switchgrass Phyllosphere | SELQVADFFTKAQTREQHRLHLLKLNASDPPLPP* |
| Ga0182167_13117081 | 3300015354 | Switchgrass Phyllosphere | HCHQKTIDLQYVPSELQLADFFTKAQTREQHRLHLLKLNASNPLFPP* |
| Ga0182167_13535311 | 3300015354 | Switchgrass Phyllosphere | QYVPSELQVADFFTKAQTQEQHRLHLIKLNISDPSLPP* |
| Ga0182208_10004881 | 3300017411 | Miscanthus Phyllosphere | MKHELTKHIGVDAFFTWSHCHQHTIDLQYVPSELQLADFFTKAQTREQHQLHLLKLNALDPPLPP |
| Ga0182199_10235511 | 3300017412 | Switchgrass Phyllosphere | VDSASIRSHCQNFTIDLKYVPSELQVADFFTKAQTKEQHRFYISKLNVSDS |
| Ga0182195_11850252 | 3300017414 | Switchgrass Phyllosphere | GVDASFTRSHCHQNTIALQYVPSELQVTDFFTKAQTREQYQLHMLKLNASDPLPPP |
| Ga0182213_12095802 | 3300017421 | Switchgrass Phyllosphere | VDAAFSRSHCHQKTIALEYVSSEQQLADFFTKAQTREHHCLHLLKLNASDPP |
| Ga0182214_10904791 | 3300017440 | Switchgrass Phyllosphere | KHELTKHIGVDASFTRSHCHQKTIDLQYVPSELQVADFFTKAQTQEQHWFNMLKLNASDPPLPP |
| Ga0182227_10485532 | 3300017685 | Miscanthus Phyllosphere | MKHELTKHIGVDAFFTRSYCNQHTIALQYVPSELKLADFTKAQTREQHRLHLLKLNASDPPLPP |
| Ga0182205_11452541 | 3300017686 | Miscanthus Phyllosphere | GVDAFFTRSHCHQKTISLQYVPSELQLADFFTKAQTREQHRLHLIKLNALDPPLSP |
| Ga0182223_11042741 | 3300017690 | Miscanthus Phyllosphere | PTPMKHELTKHIGVDAFFTQSYCNQHTIALQYVSSKQQLFDFFTKAQTREQHRLHLLKLSTLDPPLLS |
| Ga0206351_105854021 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHELTKQIGVDALFTWSHCHQKTIDLQHVPSESQMDDSFTKVQTRAQHHFHLIKLNASDPPLPP |
| Ga0206351_108566823 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | KHELTKQIGVDALFTWSHCHQKTIDLQYVPSESQLTDFFTKAQTIAQLQFHLIKLNASDPPLPP |
| Ga0206350_105476652 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | CQQKTIDLQYVPSESQLADFFSKAQTRAQHQFHLIKLNASDPPFPH |
| Ga0206353_109687801 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | RELTKHIGVDVSFTRSHCHQKTIALQYVPSELQLADFFTKAQTRAQHQFHLIKLNASNPPLPP |
| Ga0213505_1136991 | 3300022465 | Switchgrass Phyllosphere | RSHCHQKTIDLQYVPSELQVADFFTRAQTQEQHWFNMLKLNASDPPLPP |
| Ga0224712_105142951 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | QKTIDLQYVPSELQLADFFTKAQTKAQHQFHLIKLNASNPPLPP |
| Ga0207707_114823162 | 3300025912 | Corn Rhizosphere | IGVDVSFTRSHCHQKTIDLQYVPSELQLADFFTKAQTRAQHLFHLIKLNASNPPLPP |
| Ga0207676_105837901 | 3300026095 | Switchgrass Rhizosphere | VKHELTKHIGVDAAFTRSHCHQKTIALEYVSSEQQLADFFTKAQTREHHRLHLLKLNASDPP |
| Ga0268344_10248541 | 3300028051 | Phyllosphere | VKHELTKHIGVDASFTRSHCHQKTIDLQYVPSELQVADFFTKAQTQEQHWFNMLKLNASDPPLPP |
| Ga0268338_10059952 | 3300028055 | Phyllosphere | KHELTKHIGVDASFTRSHCHQKTIALEYVSSEQQLADFFTKAQTREHHRLHLLKLNASDP |
| Ga0268332_10699771 | 3300028058 | Phyllosphere | IANDPAKHELTKHIGVDAFFTRSHCHQKTIALQYVPSELQLAYFFTKAQTREQHRLHLLKLNASDPPLPP |
| Ga0268314_10073841 | 3300028061 | Phyllosphere | TWSHCHQKTIALEYVSSEQQLADFFTKAQTREHHRLHLLKLNASDPP |
| Ga0268308_10031223 | 3300028151 | Phyllosphere | VKHELTKHIGVDASFTRSHCHQNTVALQYVPSELQVADLFTKAQTREQHRLHTLKLNASDPPPPP |
| Ga0268320_10081131 | 3300028153 | Phyllosphere | QYVPSELQLADLFTKAQTREQHRLHLLKLNASDSPLPP |
| Ga0268320_10158762 | 3300028153 | Phyllosphere | RHKTIDLQYVPSEAQLADFFTKAQTRAQHQFHLIKLNASDPPFPP |
| Ga0268341_10219321 | 3300028154 | Phyllosphere | SHCHQNTIALQYVPSELQLADFFTKAQTREQHRLHMLKLNASDPPPPP |
| Ga0268312_10142631 | 3300028248 | Phyllosphere | ASFTRSHCHQKTIALQYVPSELQLADFFTKAQTREHHRLHLLKLNASDPP |
| Ga0268324_10030011 | 3300028251 | Phyllosphere | GVDASFTRSHCHQKTIALQYVPSELQLADFFTKAQTREHHRLHLLKLNASDPP |
| Ga0214492_10603111 | 3300032464 | Switchgrass Phyllosphere | VKHELIKHIGVDAFFTWSNCHQKTIALQYVPSELQLPDFFSKAQTREQHRFHLLKLNASDPPLPP |
| Ga0214492_11084111 | 3300032464 | Switchgrass Phyllosphere | PSELQVADFFTKAQTREQHRLHLLKLNDSDPPPQP |
| Ga0214493_10028161 | 3300032465 | Switchgrass Phyllosphere | TRYHCRQKTIDLQYVPSEAQLADFFTKAQTRAQHQFHLIKLDASDPPLPP |
| Ga0214503_12295081 | 3300032466 | Switchgrass Phyllosphere | KHIGVDASFIRSHCQLSTVDLQYTPSELQLADFFTKAQTREQHQFHVFKLNVSESVISQPPLV |
| Ga0214503_12612002 | 3300032466 | Switchgrass Phyllosphere | VPSELQVADFFTKAQTREQHRLHLLKLNASDPPSPP |
| Ga0214488_10072311 | 3300032467 | Switchgrass Phyllosphere | VPSELQVADFFTKAQTQEQHRLHLLKLNASDPPLPP |
| Ga0214491_10656831 | 3300032469 | Switchgrass Phyllosphere | IALQYVPLELQVADFFTKAQTQEQHRLHLLKLNASDPPLPP |
| Ga0214495_10632041 | 3300032490 | Switchgrass Phyllosphere | SHCHQKTIALQYVPSELQLADFFTKAQTREHHRLHLLKLNASDPP |
| Ga0214495_10643501 | 3300032490 | Switchgrass Phyllosphere | HCHQHTIALQYVPSELQVADFFTKAQTREQHQLHLLKLNASNPPPPP |
| Ga0214495_10795491 | 3300032490 | Switchgrass Phyllosphere | VPSELQVADFFTKAQTREQHRLHLLKLNASDPPFPP |
| Ga0214495_10843082 | 3300032490 | Switchgrass Phyllosphere | VDASFTRSHCQQQTIALQYVPSELQVADFFTKAQTREQHRLHLLKLNASNPPPPP |
| Ga0214490_10001821 | 3300032502 | Switchgrass Phyllosphere | TIALQYVPSELQVADFFTKAQTREQHQLHLLKLNASNPPPPP |
| Ga0214490_10340871 | 3300032502 | Switchgrass Phyllosphere | QIAKDPVKHELTKHIGVDAFFTRSHCHQNTIALQYVPSELQVVDFFTKSQIREQHRLHMLKLNASDPPPPP |
| Ga0214502_10135082 | 3300032514 | Switchgrass Phyllosphere | VKHELTKHIGVDAAFTRSHCHQKTIALEYVSSEQQLADFFTKAQTREHHRLHLLKLNASDLP |
| Ga0214483_10086422 | 3300032548 | Switchgrass Phyllosphere | IDLQYVPSELQLADFFTKAQTREQHRLHLLKLNASNPLFPP |
| Ga0321339_11187861 | 3300032551 | Switchgrass Phyllosphere | ASFTRSNCHHNTIALRYVPSKLQLADFFTKAQTREQQRLHMLKLNASDPPPRS |
| Ga0214500_12029511 | 3300032589 | Switchgrass Phyllosphere | IALQYVPSELQVADFFTKAQTREQHRLHLLKLNASDPPFPP |
| Ga0214484_10409171 | 3300032591 | Switchgrass Phyllosphere | HCHQNTIALQYVPSELQVADFFTKAQTREQHRLHMLKLNASDPPPPP |
| Ga0214484_11105132 | 3300032591 | Switchgrass Phyllosphere | VKHGLTKHIGVDASFTRSHHHQKTIALQYVPSELQLADFFTKAQTREQHRLYLPKLNASD |
| Ga0214504_10710431 | 3300032592 | Switchgrass Phyllosphere | TIALQYVPSELQLADFFTKAQTREHHRLHLLKLNASDPP |
| Ga0214501_11641261 | 3300032625 | Switchgrass Phyllosphere | ALQYVPSELQVADFFTKAQTREQHRLHLLKLNASYPPSPP |
| Ga0214497_10072062 | 3300032689 | Switchgrass Phyllosphere | CHQKTIALQYVPSELQVADFFTKAQTREQHRLHLLKLNASDPPSPP |
| Ga0214497_10226222 | 3300032689 | Switchgrass Phyllosphere | GVDASFTRSHCHQNTIALQYVPSELQVADFFTKAQIREQHRLHMLKLNASDPPPPP |
| Ga0214497_10439721 | 3300032689 | Switchgrass Phyllosphere | QKTIDLQYVPSELQLADFFTKAQTREQHRLHLLKLNASNPPFPP |
| Ga0214485_10271751 | 3300032698 | Switchgrass Phyllosphere | RSHCHQKTIALQYVPSELQVADFFTKAQTREQHQLHLLKLNA |
| Ga0214485_10596761 | 3300032698 | Switchgrass Phyllosphere | QKTIDLQYVPSELQLADFFTKAQTREQHRLHLLKLNASNPLFPP |
| Ga0214494_10017452 | 3300032699 | Switchgrass Phyllosphere | VKHELTKHIGVDAAFTRSHCHQKTIALEYVSSEQQLADFFTKAQTREHHHLHLLKLNASDPP |
| Ga0214494_11004161 | 3300032699 | Switchgrass Phyllosphere | LTKHIGVDVSFTRYHCRQKTIDLQYVPSEAQLADFFTKAQSRAQHQVHLIKLDASDPPLP |
| Ga0314753_10102671 | 3300032757 | Switchgrass Phyllosphere | KHELTKHIGVDASFIRSHCQLSTVDLQYTPSELQLADFFTKAQTREQHQFHVFKLNVSESVISQPPLV |
| Ga0314746_10308332 | 3300032758 | Switchgrass Phyllosphere | VKHGLTKHIGVDASFTRSHHHQKTIALQYVPSELQLADFFTKAQTREQHRLYLPKLNALD |
| Ga0314754_10232872 | 3300032760 | Switchgrass Phyllosphere | RSHCHQKTIALEYVSSEQQLADFFTKAQTREHHHLHLLKLNASDPP |
| Ga0314733_11044131 | 3300032761 | Switchgrass Phyllosphere | FTRSHCHQNTIALQYVPSELQLADFFTKAQTREQHRLHMLKLNASDPPPPP |
| Ga0314725_10024942 | 3300032789 | Switchgrass Phyllosphere | HIGVDAFFTRSHCQQNTIALQHVPSELQVADFFTKAQTQEQHRLHLLKLNASDPPLPP |
| Ga0314748_10089312 | 3300032791 | Switchgrass Phyllosphere | FTRSHCHQKTIALEYVSSEQQLADFFTKAQTREHHRLHLLKLNASDPP |
| Ga0314748_10404382 | 3300032791 | Switchgrass Phyllosphere | SFTRSHCHQNTIALQYVPSELQVADFFTKAQIREPHRLHMLKLNASDPPPPP |
| Ga0314745_10100912 | 3300032812 | Switchgrass Phyllosphere | VDASFTRSHCHQKTIALQYVPSELQLADFFTKAQTREHHRLHLLKLNASYPP |
| Ga0314745_10326131 | 3300032812 | Switchgrass Phyllosphere | SFTRSHCHQNTIALQYVPSELQVADFFTKAQIREQHRLHMLKLNASDPPPPP |
| Ga0314745_10833871 | 3300032812 | Switchgrass Phyllosphere | HQKTIALQYVPSELQLPDFFSKAQTREQHRFHLLKLNASDPPLPP |
| Ga0314723_10534541 | 3300032823 | Switchgrass Phyllosphere | PVKHELTKHIGVDAAFTRSHCHQKTIALEYVSSEQQLADFFTKAQTREHHRLHLLKLNASDPP |
| Ga0314723_11008111 | 3300032823 | Switchgrass Phyllosphere | QELTKHIGVDASFTRSHCHQNTIALQYVPSELQVADLFTKAQTREQHRLHTLKLNASDPPPPP |
| Ga0314735_10222852 | 3300032824 | Switchgrass Phyllosphere | DLQYVPSEAQLADFFTKAQTRAQHQFHLIKLDASDPPLPP |
| Ga0314735_10595252 | 3300032824 | Switchgrass Phyllosphere | IAKDPVKHELTKHIGVDASFTRSHCHQNTIALQYVPSELQVTDFFTKTQTREQHRLHMLKLNASDPPPPP |
| Ga0314735_10719321 | 3300032824 | Switchgrass Phyllosphere | KHELIKHIGVDASFTRSNCHQNTIALQYVPSKLQLADFFTKAQTREQQRLHMLKLNASDPPPRS |
| Ga0314724_1214652 | 3300032825 | Switchgrass Phyllosphere | VDASFTRSHCHQKTIALQYVPSKLQLADLFTKAQTREQHRLHLLKLNASDPPLPP |
| Ga0314743_10096081 | 3300032844 | Switchgrass Phyllosphere | HCHQKTIALQYVPSELQVADFFTKAQTREQHRLHLLKLNASDPPSPP |
| Ga0314743_11169112 | 3300032844 | Switchgrass Phyllosphere | GAIQIAKDPVKHELTKHIGVDASFTRSHCHQNTIALQYVPSELQVTDFFTKTQTREQHRLHMLKLNASDPPPPP |
| Ga0314743_11174211 | 3300032844 | Switchgrass Phyllosphere | PSELQVADFFTKAQTREQHRLHLLKLNASNPPSPP |
| Ga0314743_11309911 | 3300032844 | Switchgrass Phyllosphere | VKHELTKHIGVDASFTRSHCHQKTIALQYVPSELQLADFFTKAQTREHHRLHLL |
| Ga0314747_10501661 | 3300032890 | Switchgrass Phyllosphere | CHQKTIALEYVSSEQQLADFFTKAQTREHHRLHLLKLNASDPP |
| Ga0314747_10554412 | 3300032890 | Switchgrass Phyllosphere | ELTKHIGVDVSFTRYHCRQKTVDIQYVPSEAQLADFFTKAQTRAQHQFHLLKLNASDPPLPP |
| Ga0314739_10902581 | 3300032913 | Switchgrass Phyllosphere | GVDASFTRSHCHQNTIALQYVPSELQVTDFFTKAQTREQHRLHMLKLNASDPPPPP |
| Ga0314749_11017931 | 3300032915 | Switchgrass Phyllosphere | DPVKHELTKHIGVDASFTRSHCHQQTIALQYVPSELQVVDFFTKAQTQEQHRLHLLKLNTSDPPPPP |
| Ga0314734_10770742 | 3300032916 | Switchgrass Phyllosphere | TKHIGVDASFIRSHCQLSTVDLQYTPSELQLADFFTKAQTREQHQFHVFKLNVSESVISQPPLV |
| Ga0314734_11022812 | 3300032916 | Switchgrass Phyllosphere | DVSFTRYHCRQKTVDIQYVPSEAQLADFFTKAQTRAQHQFHLLKLNASDPPLPP |
| Ga0314741_10410641 | 3300032934 | Switchgrass Phyllosphere | SFTRSHCHQKTIALEYVSSEQQLADFFTKAQTREHHRLHLLKLNASDLP |
| Ga0314729_1117991 | 3300032953 | Switchgrass Phyllosphere | AFFTRSHCQQNTIALQHVPSELQVADFFTKAQTQEQHRLHLLKLNASDPPLPP |
| Ga0314738_10244201 | 3300032959 | Switchgrass Phyllosphere | KTIALQYVPSEMQLADFFTKAQTREQHRLHLLKLNASDPPRPP |
| Ga0314738_10307932 | 3300032959 | Switchgrass Phyllosphere | VKHELTKHIGVDASFTRSHCHQKTIALEYVSSEQQLADFFTKAQTREHHRLHLLKLNASDPP |
| Ga0314722_10685881 | 3300032966 | Switchgrass Phyllosphere | VKHELTKHIGVDASFTWSHCQQKTIDLQYVPSELQLADFFTKAQTREHHRLHLLKLNASDPP |
| Ga0314716_1128351 | 3300032970 | Switchgrass Phyllosphere | VDASFTRSHCHQNTIALQYVPSELQLADFFTKAQTREQHRLHMLKLNASDPPPPP |
| Ga0314761_10485751 | 3300033526 | Switchgrass Phyllosphere | YVPSELQVADFFTKAQIREQHRLHMLKLNASDPPPPP |
| Ga0314761_10710451 | 3300033526 | Switchgrass Phyllosphere | GVDASFTRSHCHQQTIALQYVPSELQVADFFTKAQTREQHRLHLLKLNASNPPPPP |
| Ga0314761_11465271 | 3300033526 | Switchgrass Phyllosphere | GVDAAFTRSHCHQKTIALEYVSSEQQLADFFTKAQTREHHHLHLLKLNASDPP |
| Ga0314761_11501191 | 3300033526 | Switchgrass Phyllosphere | HELIKHIGVDAFFTWSNCHQKTIALQYVPSELQLADFFTKAQTREQHRLYLPKLNASDPPLPP |
| Ga0314760_10503011 | 3300033530 | Switchgrass Phyllosphere | KHIGVDASFTRSHCHQQTIALQYVPSELQVADFFTKAQTREQHRLHLLKLNASNPPPPP |
| Ga0314756_10235742 | 3300033531 | Switchgrass Phyllosphere | GVDAFFTRSHCQQNTIALQYVPSELQVADFFTKAQTQEQHRLHLLKLNASDPPLPP |
| Ga0314756_10773431 | 3300033531 | Switchgrass Phyllosphere | VDASFTRSHCHQQTIALQYVPSELQVADFFTKAQTQEQHRLHLLKLNTSDPPPPP |
| Ga0314767_10535331 | 3300033532 | Switchgrass Phyllosphere | QKTIALQYVPSELQLADFFTKAQTREHHRLHLLKLNASDPP |
| Ga0314770_13022722 | 3300033533 | Switchgrass Phyllosphere | VKHGLTKHIGVDASFTRSHHHQKTIALQYVPSELQLPDFFSKAQTREQHRFHLLKLNASDPPLP |
| Ga0314759_10610801 | 3300033535 | Switchgrass Phyllosphere | VRAIKIANDLVKHELIKHIGVDAFFTWSNCHQKTIALQYVPSELQLPDFFSKAQTREQYRLHLLKLNASDPPLPP |
| Ga0314759_10788952 | 3300033535 | Switchgrass Phyllosphere | VDASFTRSHCHQKTIALEYVSSEQQLADFFTKAQTREHHRLHLLKLNASDPP |
| Ga0314759_10992172 | 3300033535 | Switchgrass Phyllosphere | IALQYVPSELQVADFFTKAQTREQHRLHLLKLNASNPPPPP |
| Ga0314759_11084841 | 3300033535 | Switchgrass Phyllosphere | QYVPSEAQLADFFTKAQTRAQHQFHLIKLNASDPPLPP |
| Ga0314755_11564131 | 3300033538 | Switchgrass Phyllosphere | VDASFTRSHCHQQTIALQYVPSELQVAVFFTKAQTQEQHRLHLLKLNASDPPPPP |
| Ga0314762_11088792 | 3300033539 | Switchgrass Phyllosphere | SHCHQQTIALQYVPYELQVADFFTKAQTQEQHRLHLLKLNASDPPPPP |
| ⦗Top⦘ |