NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300023100

3300023100: Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L013-104B-2



Overview

Basic Information
IMG/M Taxon OID3300023100 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0095510 | Gp0290908 | Ga0247738
Sample NamePlant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L013-104B-2
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size593146743
Sequencing Scaffolds10
Novel Protein Genes10
Associated Families10

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeagricultural fieldplant litter
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Wisconsin
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012659Metagenome / Metatranscriptome278Y
F013935Metagenome / Metatranscriptome267Y
F031153Metagenome / Metatranscriptome183Y
F069784Metagenome123N
F082505Metagenome / Metatranscriptome113Y
F086058Metagenome / Metatranscriptome111Y
F090630Metagenome108N
F091422Metagenome / Metatranscriptome107Y
F099558Metagenome / Metatranscriptome103Y
F100548Metagenome / Metatranscriptome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0247738_10013753All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2753Open in IMG/M
Ga0247738_10057508All Organisms → cellular organisms → Bacteria → Proteobacteria1293Open in IMG/M
Ga0247738_10063689All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1222Open in IMG/M
Ga0247738_10071015All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1152Open in IMG/M
Ga0247738_10101213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria947Open in IMG/M
Ga0247738_10197288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae652Open in IMG/M
Ga0247738_10283897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales530Open in IMG/M
Ga0247738_10307687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae506Open in IMG/M
Ga0247738_10310455All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium504Open in IMG/M
Ga0247738_10312876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium501Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0247738_10013753Ga0247738_100137532F091422MLMVLDDARDALRRLGGERLHPRYMPGASELMMTSVKLHHATSEQDFEDVHALATSELGSGLASLAEIKRVDGLTDAAIWVVRRNDQVTGFLAPLALTSAGVAALTDGTFDAANIDQKWVARMGQPLAGFYCWCYAGKDQVSRGALVLALRTLIDKHFPDLPFFGKDTTEAGAKIMRHLGFFPFDGVQHLFWRCRSVMEAA
Ga0247738_10057508Ga0247738_100575082F082505MWPFESRRKKAVVVFHIDQNGLAKGAYFRGEADVLIIDERDPKNRVYRMGQETADDELRRKIGKHPLGRILEEKASDDRHASPVLNLHWDGAGARAS
Ga0247738_10063689Ga0247738_100636893F012659MQTQTEQKLLEVLVEMRNWLRVAVREPVKSALVAALPDTKSRAAYQMLDGNASFEQVRVTCKMSPNAVVALAARCTSMGLMEVTPDKKRVRLFNLQDFGLQSSIESSDLGSK
Ga0247738_10071015Ga0247738_100710151F069784QPLTVRLDPESKKLFAEEAEKCGLEPGVAARQILELYVQRLRESGDYIQTLSDFSQALKKTA
Ga0247738_10101213Ga0247738_101012132F100548MTEPEPPPETHFFQTSQPRELLACVEFAAERADKAAEDHGAWRWLCISMTLAVQNACLCALDTGDEYGTKGMTRTDAREVVRWTKAGRKGPTPLAVREPRIVSPLELLRRTGDPFFLRPPYQLPLNRQINDSFDALVDLRNTFLHFSVDGWTTDLREIPPLIITACNIVRHLAVTQPIYLKRAGRHHRERVAAALDRIAAAMEHYPDLPA
Ga0247738_10197288Ga0247738_101972882F013935IVPEIGIFSELVQLGKARRGLIDVKDASSAARQTA
Ga0247738_10283897Ga0247738_102838971F099558MSLSNTTYNSLVPSISRRDRNIVGRLMSAVLSQWPERTRGSPPTDAYLRRDIGLNPLESSRKYWDHQ
Ga0247738_10307687Ga0247738_103076871F090630LLVMLPFATTEVRPLVVVPGMGLVLGVFAAIIILWSKSLRWSATTGEMMSAIRAEGGADSGAISWTLRENHEGENGSYWTREVSFSDFCSLNRPQIVRTWIVDGLIGILGWSVAFLLFSGPSFALTVTLAGLLAGHIARIAWLIRQRNLMLTLYQSTVTIVVGGVAGA
Ga0247738_10310455Ga0247738_103104551F031153RTLEKKEQGLSPAPKIVSTLNFLENVDLILIVEATLLVRVRAPPETWTTKLEPLGQPELELVDHLFRLVTIFGNLCSKFQQSAK
Ga0247738_10312876Ga0247738_103128761F086058MTTYRAYRVDSRRHIQSAAWLDAPNDDVAREKAAELCDEGTPAVELWQATRLVDEIECAEEDA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.