NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F013935

Metagenome / Metatranscriptome Family F013935

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F013935
Family Type Metagenome / Metatranscriptome
Number of Sequences 267
Average Sequence Length 48 residues
Representative Sequence RGALLHQLLGLLGIVPEIGIFGELVQLGEPRRGLFDVKDASSAARLTA
Number of Associated Samples 238
Number of Associated Scaffolds 267

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.75 %
% of genes near scaffold ends (potentially truncated) 98.50 %
% of genes from short scaffolds (< 2000 bps) 94.01 %
Associated GOLD sequencing projects 225
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.382 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(10.487 % of family members)
Environment Ontology (ENVO) Unclassified
(36.330 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(42.322 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 267 Family Scaffolds
PF00905Transpeptidase 34.08
PF17092PCB_OB 6.37
PF03462PCRF 1.12
PF13417GST_N_3 0.75
PF01520Amidase_3 0.75
PF12680SnoaL_2 0.75
PF00005ABC_tran 0.75
PF00912Transgly 0.37
PF11953DUF3470 0.37
PF08546ApbA_C 0.37
PF03466LysR_substrate 0.37

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 267 Family Scaffolds
COG0216Protein chain release factor RF1Translation, ribosomal structure and biogenesis [J] 1.12
COG1186Protein chain release factor PrfBTranslation, ribosomal structure and biogenesis [J] 1.12
COG0860N-acetylmuramoyl-L-alanine amidaseCell wall/membrane/envelope biogenesis [M] 0.75
COG0744Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidaseCell wall/membrane/envelope biogenesis [M] 0.37
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.37
COG4953Membrane carboxypeptidase/penicillin-binding protein PbpCCell wall/membrane/envelope biogenesis [M] 0.37
COG5009Membrane carboxypeptidase/penicillin-binding proteinCell wall/membrane/envelope biogenesis [M] 0.37


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.51 %
UnclassifiedrootN/A4.49 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001593|JGI12635J15846_10772052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria552Open in IMG/M
3300002568|C688J35102_120007083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria844Open in IMG/M
3300003215|JGI25153J46596_10071279All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium898Open in IMG/M
3300003771|Ga0055526_1069076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria723Open in IMG/M
3300005163|Ga0066823_10152203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria513Open in IMG/M
3300005334|Ga0068869_101374219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria624Open in IMG/M
3300005334|Ga0068869_102003833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria520Open in IMG/M
3300005339|Ga0070660_101250526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria630Open in IMG/M
3300005341|Ga0070691_11085168All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria504Open in IMG/M
3300005345|Ga0070692_10486989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria797Open in IMG/M
3300005353|Ga0070669_100678657All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium869Open in IMG/M
3300005355|Ga0070671_100575280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria972Open in IMG/M
3300005355|Ga0070671_100666248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria901Open in IMG/M
3300005440|Ga0070705_101875029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria510Open in IMG/M
3300005451|Ga0066681_10913711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria526Open in IMG/M
3300005455|Ga0070663_100308782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1268Open in IMG/M
3300005456|Ga0070678_100069982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2621Open in IMG/M
3300005513|Ga0077120_1078841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1563Open in IMG/M
3300005539|Ga0068853_101080234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria774Open in IMG/M
3300005539|Ga0068853_102054817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria554Open in IMG/M
3300005541|Ga0070733_10431200All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium879Open in IMG/M
3300005543|Ga0070672_100760677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium851Open in IMG/M
3300005546|Ga0070696_101559231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria567Open in IMG/M
3300005548|Ga0070665_100481074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1252Open in IMG/M
3300005548|Ga0070665_101456775All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium693Open in IMG/M
3300005548|Ga0070665_101976449All Organisms → cellular organisms → Bacteria → Proteobacteria588Open in IMG/M
3300005555|Ga0066692_11032827All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300005560|Ga0066670_10704586All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria612Open in IMG/M
3300005576|Ga0066708_10618507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria692Open in IMG/M
3300005586|Ga0066691_10813554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria551Open in IMG/M
3300005587|Ga0066654_10468334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria689Open in IMG/M
3300005598|Ga0066706_10455485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1019Open in IMG/M
3300005614|Ga0068856_100827093All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium945Open in IMG/M
3300005614|Ga0068856_101552480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae675Open in IMG/M
3300005764|Ga0066903_106751357All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria597Open in IMG/M
3300005841|Ga0068863_101638502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria653Open in IMG/M
3300005843|Ga0068860_102460003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae540Open in IMG/M
3300005844|Ga0068862_100171379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1943Open in IMG/M
3300005844|Ga0068862_102749935All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300005937|Ga0081455_10842937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium573Open in IMG/M
3300005952|Ga0080026_10273995All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria513Open in IMG/M
3300005983|Ga0081540_1048590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2124Open in IMG/M
3300005983|Ga0081540_1134688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1002Open in IMG/M
3300005985|Ga0081539_10356589All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria614Open in IMG/M
3300005994|Ga0066789_10172591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria915Open in IMG/M
3300006034|Ga0066656_10487711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria804Open in IMG/M
3300006038|Ga0075365_10096421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2021Open in IMG/M
3300006038|Ga0075365_10131204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1734Open in IMG/M
3300006038|Ga0075365_10711436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae709Open in IMG/M
3300006051|Ga0075364_10092527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2007Open in IMG/M
3300006102|Ga0075015_100098187Not Available1467Open in IMG/M
3300006172|Ga0075018_10721516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria541Open in IMG/M
3300006174|Ga0075014_100668641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium601Open in IMG/M
3300006183|Ga0097677_1090378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium579Open in IMG/M
3300006186|Ga0075369_10392649All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria653Open in IMG/M
3300006354|Ga0075021_10203898All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1208Open in IMG/M
3300006354|Ga0075021_10353554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria917Open in IMG/M
3300006755|Ga0079222_10856341All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria754Open in IMG/M
3300006852|Ga0075433_11064740All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria704Open in IMG/M
3300006944|Ga0099823_1060982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1957Open in IMG/M
3300006953|Ga0074063_10040429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria711Open in IMG/M
3300006953|Ga0074063_10109298All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria711Open in IMG/M
3300007076|Ga0075435_100104113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2354Open in IMG/M
3300009088|Ga0099830_10445708All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1051Open in IMG/M
3300009089|Ga0099828_10599945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium991Open in IMG/M
3300009092|Ga0105250_10308335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae686Open in IMG/M
3300009100|Ga0075418_10832085All Organisms → cellular organisms → Bacteria → Proteobacteria997Open in IMG/M
3300009101|Ga0105247_10099704All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1855Open in IMG/M
3300009101|Ga0105247_10242243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1229Open in IMG/M
3300009137|Ga0066709_103722501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium553Open in IMG/M
3300009148|Ga0105243_11414595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae716Open in IMG/M
3300009156|Ga0111538_12083200All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium713Open in IMG/M
3300009174|Ga0105241_10316643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1344Open in IMG/M
3300009176|Ga0105242_10947630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae865Open in IMG/M
3300009176|Ga0105242_11820374All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae648Open in IMG/M
3300009545|Ga0105237_11219777All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae759Open in IMG/M
3300009545|Ga0105237_12161853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium566Open in IMG/M
3300009551|Ga0105238_10159292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2233Open in IMG/M
3300009551|Ga0105238_11024331All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium847Open in IMG/M
3300009551|Ga0105238_11333749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium744Open in IMG/M
3300009553|Ga0105249_10199905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1955Open in IMG/M
3300009792|Ga0126374_10331014All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae1036Open in IMG/M
3300009803|Ga0105065_1011956All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae924Open in IMG/M
3300009840|Ga0126313_10353650All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1158Open in IMG/M
3300010041|Ga0126312_11305886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae537Open in IMG/M
3300010043|Ga0126380_10538729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium905Open in IMG/M
3300010166|Ga0126306_10442084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1022Open in IMG/M
3300010366|Ga0126379_12890472All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium575Open in IMG/M
3300010371|Ga0134125_10447867Not Available1432Open in IMG/M
3300010373|Ga0134128_10431355Not Available1471Open in IMG/M
3300010375|Ga0105239_10880706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1027Open in IMG/M
3300010397|Ga0134124_11022872All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus839Open in IMG/M
3300010400|Ga0134122_10588192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1026Open in IMG/M
3300010403|Ga0134123_10368793All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1304Open in IMG/M
3300010854|Ga0126360_1030603All Organisms → cellular organisms → Bacteria → Proteobacteria666Open in IMG/M
3300010858|Ga0126345_1064404All Organisms → cellular organisms → Bacteria → Proteobacteria743Open in IMG/M
3300011120|Ga0150983_12230747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae810Open in IMG/M
3300011422|Ga0137425_1165167All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae552Open in IMG/M
3300011438|Ga0137451_1269283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium536Open in IMG/M
3300012189|Ga0137388_11920874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae522Open in IMG/M
3300012206|Ga0137380_10084426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2904Open in IMG/M
3300012207|Ga0137381_11022486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae712Open in IMG/M
3300012209|Ga0137379_10417058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1252Open in IMG/M
3300012211|Ga0137377_11238360All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae676Open in IMG/M
3300012212|Ga0150985_113188182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae843Open in IMG/M
3300012356|Ga0137371_10962719All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae648Open in IMG/M
3300012469|Ga0150984_114835772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae664Open in IMG/M
3300012493|Ga0157355_1027309All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium569Open in IMG/M
3300012502|Ga0157347_1054922All Organisms → cellular organisms → Bacteria → Proteobacteria557Open in IMG/M
3300012917|Ga0137395_10549057All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium834Open in IMG/M
3300012922|Ga0137394_10869598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae753Open in IMG/M
3300012923|Ga0137359_11175240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae655Open in IMG/M
3300012924|Ga0137413_10854319All Organisms → cellular organisms → Bacteria → Proteobacteria703Open in IMG/M
3300012924|Ga0137413_11794960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium506Open in IMG/M
3300012929|Ga0137404_11626452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium599Open in IMG/M
3300012941|Ga0162652_100018987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria943Open in IMG/M
3300012951|Ga0164300_11214326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium501Open in IMG/M
3300012957|Ga0164303_10114764Not Available1362Open in IMG/M
3300012957|Ga0164303_11421258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium520Open in IMG/M
3300012976|Ga0134076_10606808All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae511Open in IMG/M
3300012986|Ga0164304_10807505All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae724Open in IMG/M
3300012986|Ga0164304_11838644All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium507Open in IMG/M
3300012987|Ga0164307_10495338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium922Open in IMG/M
3300012988|Ga0164306_11437598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae588Open in IMG/M
3300012989|Ga0164305_10953176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae725Open in IMG/M
3300012989|Ga0164305_12058625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium522Open in IMG/M
3300013297|Ga0157378_10317892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1512Open in IMG/M
3300013754|Ga0120183_1022085All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium547Open in IMG/M
3300014166|Ga0134079_10249292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae767Open in IMG/M
3300014326|Ga0157380_13163077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium525Open in IMG/M
3300014658|Ga0181519_10455998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium788Open in IMG/M
3300014658|Ga0181519_10745378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium605Open in IMG/M
3300014745|Ga0157377_10747824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae715Open in IMG/M
3300014968|Ga0157379_12209381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae547Open in IMG/M
3300014969|Ga0157376_12459952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae560Open in IMG/M
3300015089|Ga0167643_1032322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium811Open in IMG/M
3300015160|Ga0167642_1068500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium511Open in IMG/M
3300015241|Ga0137418_10363884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1190Open in IMG/M
3300015371|Ga0132258_12209580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1381Open in IMG/M
3300015372|Ga0132256_101562729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium770Open in IMG/M
3300016270|Ga0182036_11697703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium533Open in IMG/M
3300016357|Ga0182032_10569075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium939Open in IMG/M
3300016371|Ga0182034_12041019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium506Open in IMG/M
3300017544|Ga0182735_1211384All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium511Open in IMG/M
3300017652|Ga0182746_1152133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae782Open in IMG/M
3300017966|Ga0187776_10627990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium752Open in IMG/M
3300018061|Ga0184619_10454760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium571Open in IMG/M
3300018075|Ga0184632_10132840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1096Open in IMG/M
3300018088|Ga0187771_11261180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium627Open in IMG/M
3300018431|Ga0066655_10725831All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae673Open in IMG/M
3300018468|Ga0066662_10999252All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium828Open in IMG/M
3300019377|Ga0190264_10587241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium790Open in IMG/M
3300020034|Ga0193753_10256012All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae775Open in IMG/M
3300020579|Ga0210407_10771109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae743Open in IMG/M
3300020582|Ga0210395_10898751All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium658Open in IMG/M
3300021088|Ga0210404_10097597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1476Open in IMG/M
3300021171|Ga0210405_10223269All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1492Open in IMG/M
3300021361|Ga0213872_10423283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium538Open in IMG/M
3300021377|Ga0213874_10116394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium904Open in IMG/M
3300021404|Ga0210389_10353578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1154Open in IMG/M
3300021405|Ga0210387_10736931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae872Open in IMG/M
3300021405|Ga0210387_11003137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae731Open in IMG/M
3300021420|Ga0210394_10017034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei6847Open in IMG/M
3300021432|Ga0210384_11100768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae698Open in IMG/M
3300021474|Ga0210390_10688633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium852Open in IMG/M
3300021477|Ga0210398_10409416All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1106Open in IMG/M
3300021559|Ga0210409_10392366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1243Open in IMG/M
3300021559|Ga0210409_11218147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium628Open in IMG/M
3300021560|Ga0126371_13534841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium527Open in IMG/M
3300022225|Ga0187833_10563902All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria573Open in IMG/M
3300022715|Ga0242678_1032998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium690Open in IMG/M
3300022722|Ga0242657_1064783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria834Open in IMG/M
3300022726|Ga0242654_10221283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae667Open in IMG/M
3300022726|Ga0242654_10403196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium525Open in IMG/M
3300022756|Ga0222622_10191752All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1350Open in IMG/M
3300022896|Ga0247781_1018892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2181Open in IMG/M
3300022897|Ga0247764_1179811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae643Open in IMG/M
3300022911|Ga0247783_1132470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium694Open in IMG/M
3300023068|Ga0224554_1089717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae722Open in IMG/M
3300023079|Ga0247758_1069298All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium964Open in IMG/M
3300023100|Ga0247738_10197288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae652Open in IMG/M
3300023169|Ga0247762_1076870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium926Open in IMG/M
3300024288|Ga0179589_10061540Not Available1446Open in IMG/M
(restricted) 3300024520|Ga0255047_10536002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae588Open in IMG/M
3300025261|Ga0209233_1050875All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae843Open in IMG/M
3300025273|Ga0209673_1078720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae761Open in IMG/M
3300025304|Ga0209257_1095344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae735Open in IMG/M
3300025711|Ga0207696_1163457All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae592Open in IMG/M
3300025905|Ga0207685_10084885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1319Open in IMG/M
3300025907|Ga0207645_10294063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1080Open in IMG/M
3300025908|Ga0207643_10849053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae592Open in IMG/M
3300025908|Ga0207643_11126484All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae506Open in IMG/M
3300025915|Ga0207693_10832824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae710Open in IMG/M
3300025919|Ga0207657_10256229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1393Open in IMG/M
3300025919|Ga0207657_10418374Not Available1053Open in IMG/M
3300025923|Ga0207681_10117213All Organisms → cellular organisms → Bacteria1947Open in IMG/M
3300025929|Ga0207664_11988918All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae504Open in IMG/M
3300025931|Ga0207644_11616123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium544Open in IMG/M
3300025942|Ga0207689_10101297Not Available2366Open in IMG/M
3300025945|Ga0207679_11204599All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium695Open in IMG/M
3300025986|Ga0207658_10741895All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae889Open in IMG/M
3300026023|Ga0207677_10903152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae796Open in IMG/M
3300026023|Ga0207677_11426071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium638Open in IMG/M
3300026067|Ga0207678_10730870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium872Open in IMG/M
3300026078|Ga0207702_11257985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium734Open in IMG/M
3300026121|Ga0207683_10548165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1069Open in IMG/M
3300026121|Ga0207683_11343363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae661Open in IMG/M
3300026142|Ga0207698_11509777All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae687Open in IMG/M
3300026323|Ga0209472_1300036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium514Open in IMG/M
3300026343|Ga0209159_1194062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae669Open in IMG/M
3300026542|Ga0209805_1107244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1329Open in IMG/M
3300026551|Ga0209648_10018176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium6140Open in IMG/M
3300027603|Ga0209331_1165514All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae519Open in IMG/M
3300027736|Ga0209190_1301774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum611Open in IMG/M
3300027862|Ga0209701_10511228All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium651Open in IMG/M
3300027866|Ga0209813_10496679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium506Open in IMG/M
3300027869|Ga0209579_10498532All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae661Open in IMG/M
3300028379|Ga0268266_10313021All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1467Open in IMG/M
3300028536|Ga0137415_10930841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae679Open in IMG/M
3300028558|Ga0265326_10186158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp.595Open in IMG/M
3300028590|Ga0247823_10840962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae689Open in IMG/M
3300028652|Ga0302166_10114717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae609Open in IMG/M
3300028762|Ga0302202_10453227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium586Open in IMG/M
3300028784|Ga0307282_10128570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1190Open in IMG/M
3300028811|Ga0307292_10137051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium982Open in IMG/M
3300028813|Ga0302157_10510475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria628Open in IMG/M
3300029911|Ga0311361_11333939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium558Open in IMG/M
3300029956|Ga0302150_10103246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1095Open in IMG/M
3300029986|Ga0302188_10303047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium660Open in IMG/M
3300030051|Ga0302195_10043275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2583Open in IMG/M
3300030620|Ga0302046_10404388Not Available1121Open in IMG/M
3300031184|Ga0307499_10224877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae588Open in IMG/M
3300031198|Ga0307500_10202498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium593Open in IMG/M
3300031366|Ga0307506_10056044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1166Open in IMG/M
3300031446|Ga0170820_15937084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium502Open in IMG/M
3300031455|Ga0307505_10362572Not Available686Open in IMG/M
3300031456|Ga0307513_10609702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae800Open in IMG/M
3300031573|Ga0310915_11124561All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium545Open in IMG/M
3300031708|Ga0310686_113379984All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium505Open in IMG/M
3300031715|Ga0307476_10121313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1861Open in IMG/M
3300031718|Ga0307474_11526053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium525Open in IMG/M
3300031770|Ga0318521_10540152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae702Open in IMG/M
3300031798|Ga0318523_10588576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium548Open in IMG/M
3300031805|Ga0318497_10533222All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus658Open in IMG/M
3300031823|Ga0307478_10255448Not Available1425Open in IMG/M
3300031824|Ga0307413_10685554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium849Open in IMG/M
3300031831|Ga0318564_10015703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3082Open in IMG/M
3300031833|Ga0310917_10026277All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3401Open in IMG/M
3300031879|Ga0306919_10101221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2027Open in IMG/M
3300031890|Ga0306925_11087050All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae809Open in IMG/M
3300031901|Ga0307406_10826868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium783Open in IMG/M
3300031912|Ga0306921_11512462Not Available733Open in IMG/M
3300031942|Ga0310916_10814125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium786Open in IMG/M
3300031947|Ga0310909_11512902All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium534Open in IMG/M
3300031954|Ga0306926_11384481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae817Open in IMG/M
3300031995|Ga0307409_101567728All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae686Open in IMG/M
3300032005|Ga0307411_10719605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium871Open in IMG/M
3300032009|Ga0318563_10434781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium710Open in IMG/M
3300032059|Ga0318533_11258270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium541Open in IMG/M
3300032074|Ga0308173_10519706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1068Open in IMG/M
3300032076|Ga0306924_11082123All Organisms → cellular organisms → Bacteria → Proteobacteria875Open in IMG/M
3300032094|Ga0318540_10389662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae673Open in IMG/M
3300032205|Ga0307472_100997081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae784Open in IMG/M
3300032770|Ga0335085_11151833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae827Open in IMG/M
3300032892|Ga0335081_12748467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium501Open in IMG/M
3300032893|Ga0335069_11120845All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae866Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.12%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.12%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.62%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.62%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.62%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.25%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.25%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter2.25%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.25%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere2.25%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.87%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.87%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.50%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.50%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.50%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.12%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.12%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.12%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.12%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.12%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.12%
Arabidopsis RootHost-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root1.12%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.12%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.12%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.75%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.75%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.75%
CompostEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Compost0.75%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.75%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.75%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.75%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.75%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.37%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.37%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.37%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.37%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.37%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.37%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.37%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.37%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.37%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.37%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.37%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.37%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.37%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.37%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.37%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.37%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.37%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.37%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.37%
Arabidopsis RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere0.37%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.37%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.37%
Root NodulesHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules0.37%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.37%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.37%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.37%
Wastewater BioreactorEngineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor0.37%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003215Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMFHost-AssociatedOpen in IMG/M
3300003771Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2Host-AssociatedOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005513Combined assembly of arab plate scrape CL_Cvi (Combined Assembly)Host-AssociatedOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006183Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_500_biof - 1398105537950 (version 2)EngineeredOpen in IMG/M
3300006186Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006944Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BWHost-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009803Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010854Boreal forest soil eukaryotic communities from Alaska, USA - W4-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010858Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011422Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012493Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610EnvironmentalOpen in IMG/M
3300012502Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610Host-AssociatedOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013754Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep2EnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015089Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river))EnvironmentalOpen in IMG/M
3300015160Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7C, Adjacent to main proglacial river, mid transect (Watson river))EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017544Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 5th pass 30_C Kraft MG (version 2)EnvironmentalOpen in IMG/M
3300017652Enriched Organic Plus compost microbial communities from Emeryville, California, USA - eDNA 3rd pass 30_C BE-Lig OP (version 2)EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021361Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2Host-AssociatedOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022225Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300022715Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022896Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L184-509B-5EnvironmentalOpen in IMG/M
3300022897Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L051-202B-4EnvironmentalOpen in IMG/M
3300022911Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5EnvironmentalOpen in IMG/M
3300023068Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24EnvironmentalOpen in IMG/M
3300023079Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L156-409C-4EnvironmentalOpen in IMG/M
3300023100Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L013-104B-2EnvironmentalOpen in IMG/M
3300023169Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L081-202R-4EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024520 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1EnvironmentalOpen in IMG/M
3300025261Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes)Host-AssociatedOpen in IMG/M
3300025273Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025304Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025711Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028558Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaGHost-AssociatedOpen in IMG/M
3300028590Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30EnvironmentalOpen in IMG/M
3300028652Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028813Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3EnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029956Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2EnvironmentalOpen in IMG/M
3300029986Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1EnvironmentalOpen in IMG/M
3300030051Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI12635J15846_1077205213300001593Forest SoilRILQRGAFLHQLLRFLWIVPEIGVFGELVQLRQACGGFFDVKDASSAARLTA*
C688J35102_12000708323300002568SoilILQRGAFLHQLLRLLGVVPEIGIFRELVQLGEPRRGLIDVKDASSAARLTA*
JGI25153J46596_1007127923300003215Arabidopsis RhizosphereLGLLGIVPEIGIFGELVQLGEASRGLFDVKDASSAARLTA*
Ga0055526_106907613300003771Arabidopsis RootLDLADARQRVLKRGSLLHQLLGLLGIVPEVGIFCELVQLGEACRRFLDVKDASSAARLTA
Ga0066823_1015220323300005163SoilLQRGALLHQLLGLLGIVPEIGIFGELVQLGEPRRGLFDVKDASSAARLTA*
Ga0068869_10137421923300005334Miscanthus RhizosphereRILQRGALLHQLLGLLGIVPEIGIFGELVQLGEPCRGLFNVKDASSAARQTA*
Ga0068869_10200383313300005334Miscanthus RhizosphereHQRGALLHQLLGLLGIVPEIGIFGELIQLGKASRGCLDVKDASSAARLTA*
Ga0070660_10125052613300005339Corn RhizosphereELACDFADAAERILQRGPLLHELLRLLRIVPEVGVFCELVQLRKAGRGFLDVKDASSAARLTA*
Ga0070691_1108516813300005341Corn, Switchgrass And Miscanthus RhizosphereRILQRGALLHQLLGLLGIVPEVGVFGELVQLREACRRFLDVKDASSAARQTA*
Ga0070692_1048698923300005345Corn, Switchgrass And Miscanthus RhizosphereALLHQLLGLLGIVPEIGIFGELVQLGEPSRGFLDVKDASSAARLTA*
Ga0070669_10067865713300005353Switchgrass RhizosphereALLHQLLGLLGIVPEIGIFGELVQLGKASRGCLDVKDASSAARLTA*
Ga0070671_10057528023300005355Switchgrass RhizosphereRGALLHQLLGLLGIVPEIGIFGELVQLGEPRRGLFDVKDASSAARLTA*
Ga0070671_10066624813300005355Switchgrass RhizosphereALDLADALERIHQRGALLHQLLGLLGIVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA*
Ga0070705_10187502923300005440Corn, Switchgrass And Miscanthus RhizosphereERVHQRGALLHQLLGFLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA*
Ga0066681_1091371113300005451SoilRVLQRGALLHQLLRFLRIVPEIGIFRELVQLGEPRRRFLDVKDASSAARPTA*
Ga0070663_10030878223300005455Corn RhizosphereDLADALQRIHQRGALLHQLLGLLGIVPEIGIFGELVQLGETSRGLFDVKDASSAARLTA*
Ga0070678_10006998223300005456Miscanthus RhizosphereLADALQRIHQRGALLHQLLGLLGIVPEIGIFGELVQLGETSRGLFDVKDASSAARLTA*
Ga0077120_107884133300005513Arabidopsis RhizosphereLADARERILQRGALLHQLLGLLGVVPEIGIFCELVQLSEARRRCLDVKDASSAARLTA*
Ga0068853_10108023413300005539Corn RhizosphereDALQRILQRGALLHQLLGLLGIVPEIGIFGELVQLGKPCRGFLDVKDASSAARLTA*
Ga0068853_10205481713300005539Corn RhizospherePLLHQLLGFLRIVPEIGMFGERVQFGETRRCSIDVKDASSAVRQTA*
Ga0070733_1043120013300005541Surface SoilRGSLLHQLLRLLGIVPEIGVFGKLVQLRQARGGFFDVKDASSAARPTA*
Ga0070672_10076067713300005543Miscanthus RhizosphereIVPEIGIFGELVQLGKASRGCLDVKDASSAARLTA*
Ga0070696_10155923113300005546Corn, Switchgrass And Miscanthus RhizosphereLLHQLLGLLGIVPEIGIFGELVQLGEASRGLLDVKDASSAARLTA*
Ga0070665_10048107423300005548Switchgrass RhizosphereQLLGLLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARQTA*
Ga0070665_10145677523300005548Switchgrass RhizosphereQLLGLLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA*
Ga0070665_10197644913300005548Switchgrass RhizosphereALDLADALQRIHQRGALLHQLLGLLGIVPEIGIFSELVQLGEACRGLFDVKDASSAARLTA*
Ga0066692_1103282723300005555SoilGLLGIVPEIGVFGELVQLGQTSRGLLDVKDASSAARLTA*
Ga0066670_1070458623300005560SoilRILQRGALLHQLLRLLRIVPEIGIFRELVQLRQTRRGFFNVKDASSAARLTA*
Ga0066708_1061850713300005576SoilKRILERGPLLHQLLRLLGIVPEIGVFGELVQLRKTCRGFFDVKDASSAARLTA*
Ga0066691_1081355413300005586SoilKRVLQRGALLHQLLRFLRIVPEIGIFRELVQLGEPRRRFLDVKDASSAARPTA*
Ga0066654_1046833423300005587SoilRIVPEIGIFRELVQLGEPRRRFLDVKDASSAARPTA*
Ga0066706_1045548513300005598SoilIVPEIGIFRELVQLGEPRRRFLDVKDASSAARPTA*
Ga0068856_10082709313300005614Corn RhizosphereLLGLLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA*
Ga0068856_10155248013300005614Corn RhizosphereLGLLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARQTA*
Ga0066903_10675135723300005764Tropical Forest SoilQLLGLLGIVPEIGVFGELVQLGEACRRFLDVKDASSAARLTA*
Ga0068863_10163850223300005841Switchgrass RhizosphereRGALLHQLLGFLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA*
Ga0068860_10246000313300005843Switchgrass RhizosphereLLGLLGIVPEIGIFGELVQLGEASRGLFDVKDASSAARLTA*
Ga0068862_10017137923300005844Switchgrass RhizosphereLGIVPEIGIFGELVQLGEASRGFLDVKDASSAARLTA*
Ga0068862_10274993523300005844Switchgrass RhizosphereRGALLHQLLGLLGIVPEIGIFCELVQLGEACRRFLDVKDASSAARLTA*
Ga0081455_1084293723300005937Tabebuia Heterophylla RhizosphereIVPEIGVFGELVQLGKACRRFLDVKDASSAARLTA*
Ga0080026_1027399513300005952Permafrost SoilLQRGSLLHQLLRLLGIVPEIGIFGELVQFGQTRRGCINVKDASSAARLTA*
Ga0081540_104859023300005983Tabebuia Heterophylla RhizosphereLGIVPEIGVFGELVQLGKACRRFLDVKDASSAARLTA*
Ga0081540_113468813300005983Tabebuia Heterophylla RhizosphereHQFLGLLGIVPEIGIFGETVQLGEPGRGFLDVKDASSAARLTA*
Ga0081539_1035658913300005985Tabebuia Heterophylla RhizosphereLGIVPEIGIFGELVQLGQPCRRFLDVKDASSAARLTA*
Ga0066789_1017259113300005994SoilERILQRGALLHQLLRLLRIVPEIGGLGELVQLRQTRGGFLDVKDASSAARPTA*
Ga0066656_1048771123300006034SoilDAAKRILKRGPLLHQLLRLLGIVPEIGVFGELVQLRKTCRGFFDVKDASSAARLTA*
Ga0075365_1009642113300006038Populus EndosphereQLLGLLGIVPEIGIFGEFVQLGEASRGFLDVKDASSAARLTA*
Ga0075365_1013120423300006038Populus EndosphereLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA*
Ga0075365_1071143623300006038Populus EndosphereLRVVPEIGIFSELVQLREARRGCIDVKDASSAARQTA*
Ga0075364_1009252713300006051Populus EndosphereDLADALERIHQRGALLHQLLGLLGIVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA*
Ga0075015_10009818723300006102WatershedsRILQRGPLLHQLLRLLGIVPEVGVFGELVQLRQTRGGFFDVKDASSAARLTA*
Ga0075018_1072151623300006172WatershedsRGALLHQLLGLLGVVPEIGIFGELVQLSQPRRRLLDVKDASSAARPTA*
Ga0075014_10066864113300006174WatershedsLQRGSLLHQLLRLLGIVPEIRGFGELVQFRQTRGGLFDVKDASSAARLTA*
Ga0097677_109037813300006183Wastewater BioreactorLLHQLLRLLGIVPEIWIFGEFVQFRQSRGRCFDIKDASSAARPTA*
Ga0075369_1039264913300006186Populus EndosphereQRILQRGALLHQLLGLLGIVPEIGIFGELVQLGEPGRGLFDVKDASSAARLTA*
Ga0075021_1020389823300006354WatershedsILQRGSLLHQLLRLLGIVPEIRGFGELVQFRQTRGGLFDVKDASSAARLTA*
Ga0075021_1035355413300006354WatershedsLQRGSLLHQLLRLLGIVPEIGVFCELVQLGKTRRGCIDVKDASSAARPTA*
Ga0079222_1085634123300006755Agricultural SoilLDLADACERILQRGPLLHQLLCLLRIVPEIGVFGELVQLSQTRGGFFDVKDASSAARPTA
Ga0075433_1106474023300006852Populus RhizosphereQRGALLHQLLGLLGIVPEIGVFGELVQLGEACRRFLDVKDASSAARLTA*
Ga0099823_106098223300006944Root NodulesQRGALLHQFLGFLGIVPEIGIFCELVQLSEARRRFLDVKDASSAARLTA*
Ga0074063_1004042923300006953SoilQRGALLHQLLGLLGIVPEIGVFGELVQLGQPCRRFLDVKDASSAARLTA*
Ga0074063_1010929823300006953SoilGALLHQLLGLLGIVPEIGIFGELVQLGEPRRGLFDVKDASSAARLTA*
Ga0075435_10010411313300007076Populus RhizosphereIHQRGALLHQLLGLLGIVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA*
Ga0099830_1044570823300009088Vadose Zone SoilLDIVAEFALNLADALKPILQRGALLHQFLGLLGIVPEIGIFRELVQLGEARRRFFDVKDASSAARLTA*
Ga0099828_1059994513300009089Vadose Zone SoilRGALLHQLLRLLGIVPEIGSFRELVQLGETRRGLFDVKDASSAARLTA*
Ga0105250_1030833513300009092Switchgrass RhizosphereDALERIHQRGALLHQLLGLLGIVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA*
Ga0075418_1083208513300009100Populus RhizosphereLHQFLGFLGIVPEIGVFRELVQLSESCRRLVDVKDASSAARATA*
Ga0105247_1009970423300009101Switchgrass RhizosphereIVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA*
Ga0105247_1024224313300009101Switchgrass RhizosphereRILQRGALLHQLLGLLGVVPEIGVFGELVQLGKPGRRLFDVKDASSAARLTA*
Ga0066709_10372250123300009137Grasslands SoilLGFLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA*
Ga0105243_1141459513300009148Miscanthus RhizosphereLHQLLGLLRIVPEIGIFGELVQLGEPCRGFLDVKDASSAARLTA*
Ga0111538_1208320023300009156Populus RhizosphereALLHQLLGLLGIVPEIGIFGEVVQLGETSRGFLDVKDASSAARLTA*
Ga0105241_1031664323300009174Corn RhizosphereHQLLGLLGIVPEIGIFGELVQLGETSRGLFDVKDASSAARLTA*
Ga0105242_1094763013300009176Miscanthus RhizosphereERILQRGALLHQLLGLLGIVPEIGIFGELVQLGEPRRGLFDVKDASSAARLTA*
Ga0105242_1182037413300009176Miscanthus RhizosphereDALQRIHQRGALLHQLLGLLGIVPEIGIFSELVQLGEARRGLFDVKDASSAARLTA*
Ga0105237_1121977723300009545Corn RhizosphereLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARQTA*
Ga0105237_1216185323300009545Corn RhizosphereLLHQLLGLLGIVPEIGIFSELVQLSEACRRLFDVKDASSAARLTA*
Ga0105238_1015929223300009551Corn RhizosphereGIVPEIGIFGELVQLGEPRRGLFDVKDASSAARLTA*
Ga0105238_1102433113300009551Corn RhizosphereIHQRGALLHQLLGLLGIVPEIGIFGELVQLGETSRGLFDVKDASSSARLTA*
Ga0105238_1133374913300009551Corn RhizosphereRGALLHQLLGFLGIVPEVGIFCELVQLSEARRRFIDVKDASSAARLTA*
Ga0105249_1019990523300009553Switchgrass RhizosphereIHQRGALLHQLLGLLGIVPEIGIFGELIQLGKASRGCLDVKDASSAARLTA*
Ga0126374_1033101423300009792Tropical Forest SoilALLHQLLRLLRIVPELGIFGELAQLGEARRRCLDVKDASSAVRPTA*
Ga0105065_101195623300009803Groundwater SandLDIVFELTLDLADAVERIHQRGALLHQLLGLLGIVPEIGIFGELVQLGEASCRFLDVKDGSSAARLTA*
Ga0126313_1035365023300009840Serpentine SoilLGFLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARQTA*
Ga0126312_1130588623300010041Serpentine SoilLGIVPEIAVFRELVQLGQTRRGCFDVKDASSAARLTA*
Ga0126380_1053872913300010043Tropical Forest SoilLLGLLGIVPEIGIFGELVQLGQPCRRFLDVKDASSAARLTA*
Ga0126306_1044208413300010166Serpentine SoilALERVHQRGALLHQLLGLLGIVPEIGIFGELVQLGESSRGFLDVKDASSAARLTA*
Ga0126379_1289047213300010366Tropical Forest SoilMIGKLALDPADAGQRILQRGALLHQLLCFLGVVPEIGVFGEPVQLGQSRRRFLDVKDASSAARLTA*
Ga0134125_1044786713300010371Terrestrial SoilRIHQRGALLHQLLGLLGIVPEIGIFGELVQLGETSRGLFDVKDASSAARLTA*
Ga0134128_1043135513300010373Terrestrial SoilALHLADAVERILKRGALLHHLLRLLGIIPEIGVFVEIVQLGQSRRRFLDVKDASSAARPTA*
Ga0105239_1088070613300010375Corn RhizosphereIHQRGALLHQLLGLLGIVPEIGIFGELVQLGETSRGLFDVKDASSAARLTA*
Ga0134124_1102287213300010397Terrestrial SoilLRLLGVVPEIGVFGELVQFGKTRRGFFDVKDASSAAR
Ga0134122_1058819213300010400Terrestrial SoilVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA*
Ga0134123_1036879313300010403Terrestrial SoilALERIHQRGALLHQLLGLLGIVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA*
Ga0126360_103060323300010854Boreal Forest SoilGIVPEIGIFGELVQFGQTRRGCIDVKDASSAARPTA*
Ga0126345_106440423300010858Boreal Forest SoilSSSRYLADAGQRILQRGPLLHQLLGLLGIVPEVGIFRELVQLGETRRGGIDVKDASSAARPTA*
Ga0150983_1223074713300011120Forest SoilRILQRGAFLHQLLRFLWIVPEIGVFGELVQLGEPCRRLIDVKDASSAARLTA*
Ga0137425_116516713300011422SoilIVPEIGIFGELVQLGEASCRFLDVKDASSAARLTA*
Ga0137451_126928323300011438SoilLLGIVPEIGVFGELVQFGEPRRGLFDVKDASSAARLTA*
Ga0137388_1192087423300012189Vadose Zone SoilALDLADAIERILQRGALLHQLLRLLGIVPEIGSFRELVQLGETRRGLFDVKDASSAARLTA*
Ga0137380_1008442653300012206Vadose Zone SoilHHALGAGGIIPKVGVFRELVQLGEAGRRFVDVKDASSAARATA*
Ga0137381_1102248613300012207Vadose Zone SoilRILKRGALLHQLLGLLRIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA*
Ga0137379_1041705813300012209Vadose Zone SoilLADALQRVLQRGTLLHQLLGLLGIVPEIWIFGELVQLGEPRRGLFDVKDASSAARQTA*
Ga0137377_1123836023300012211Vadose Zone SoilERILQRGALLHQLLRLLGIVPEIGIFRELVQLRQTRRGFFDVKDASSAARLTA*
Ga0150985_11318818213300012212Avena Fatua RhizosphereQLLRLLGIVPEVGVFCELVQLSEARRGFLDVKDASSAARLTA*
Ga0137371_1096271923300012356Vadose Zone SoilLRLLRIVPEIGIFRELVQLRQTRRGFFDVKDASSAARLTA*
Ga0150984_11483577213300012469Avena Fatua RhizosphereLHQLLRLLGIVPEVGVLGELVQLREARGGLFDVKDASSAARLTA*
Ga0157355_102730913300012493Unplanted SoilLADAGQRILQRGALLHQPLGLLGIVPEIGVFGELVQLGEACRRFLDVKDASSAARLTA*
Ga0157347_105492213300012502Arabidopsis RhizosphereVPEVRIFCELVQLSEARRRFLDVKDASSAARPTA*
Ga0137395_1054905723300012917Vadose Zone SoilALLHQFLRLLGVVREVGIFRELVQLGETRRGFLDVKDASSAARLTA*
Ga0137394_1086959823300012922Vadose Zone SoilALDLADALERIHQRGALLHQLLGLLGIVPEIGIFGELVQLGKASRGVLDVKDASSAARLTA*
Ga0137359_1117524023300012923Vadose Zone SoilLLHQLLRLLRIVPEIGIFRELVQLRQTRRGFFNVKDASSAARLTA*
Ga0137413_1085431923300012924Vadose Zone SoilLGFLRIVPEIGVFGELVQLGEARGGFLDVKDASSAARLTA*
Ga0137413_1179496013300012924Vadose Zone SoilRGALLHQLLGLLGIVPEIGIFRELVQLREARRGCIDVKDASSAARLTA*
Ga0137404_1162645223300012929Vadose Zone SoilIERILQRGSLLHQLLRLLGIVPEIGGFGELVQFGQTGRGLFDVKDASSAARPTA*
Ga0162652_10001898723300012941SoilIVPEIGIFGELVQFREAGRGCIDVKDASSAARQTA*
Ga0164300_1121432623300012951SoilLLHQLLGLLGIVPEIGVFGELVQLGKAGSRCLDVKDASSAAPLTA*
Ga0164303_1011476413300012957SoilLLGIVPEIGSFRELVQLGQTCRGFLDVKDASSAARLTA*
Ga0164303_1142125823300012957SoilQRGPLLHQLLRLLGIVPEIGVLSQLVQLGKTRRGCLDVKDASSAARLTA*
Ga0134076_1060680823300012976Grasslands SoilLGIVPEIGIFRELVQLGQTRRGFFDVKDASSAARLTA*
Ga0164304_1080750513300012986SoilALLHQFLRLLGIVPEIGIFRELVQLGQTRRGFLDVKDASSAARLTA*
Ga0164304_1183864413300012986SoilERILKRGSLLHQLLGFLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA*
Ga0164307_1049533813300012987SoilLDLADAIERVLQRGPLLHQLLCLLGIVPEVGVFGELVQLREACSGLFDVKDASSAARLTA
Ga0164306_1143759813300012988SoilHQLLGFLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARQTA*
Ga0164305_1095317613300012989SoilLADARERILKRGALLHQLLGFLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARQTA*
Ga0164305_1205862513300012989SoilDLADTGQRILQRGALLHQLLSLLGIVPEIGILGELVPLSQPRRRFLDVKDASSAARPTA*
Ga0157378_1031789223300013297Miscanthus RhizosphereADSLQRILQRGALLHQLLGLLGVVPELGAFGELVQLGKPGRRLFDVKDASSAARLTA*
Ga0120183_102208513300013754TerrestrialMARIRAPLLAEVLGFLGIVPEIGIFGELVQLCQPCRRFLDVKDASSAARPTA*
Ga0134079_1024929223300014166Grasslands SoilIIPEIGVFGELVQLRKARRGFFDVKDASSAARLTA*
Ga0157380_1316307723300014326Switchgrass RhizosphereLDLADALERIHQRGALLHQLLGLLGIVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA
Ga0181519_1045599823300014658BogFLGLLGIVPEIGIFGELVQLGQTRRGLIDVKDASSAARPTA*
Ga0181519_1074537813300014658BogQFLGLLGIVPEIGIFGELVQLGQTRRGLIDVKDASSAARQTA*
Ga0157377_1074782413300014745Miscanthus RhizosphereRILQRGALLHQLLGLLGIVPEIGVFGELVQFGEPRRGLFDVKDASSAARLTA*
Ga0157379_1220938123300014968Switchgrass RhizosphereQRGALLHQLLGLLGIVPEIGIFGELVQLGEPRRGLFDVKDASSAARLTA*
Ga0157376_1245995223300014969Miscanthus RhizosphereLLHQLLGLLGIVPEIWIFSELVQLLEACRRLIDVKDASSAARQTA*
Ga0167643_103232213300015089Glacier Forefield SoilQFLCLLGIVPEVGIFGELVQFGETRRGCIDVKDASSAARPTA*
Ga0167642_106850013300015160Glacier Forefield SoilRDLADALKRILQRGSLLHQLLGLLGIVPEIGIFGELVQFGQTRRGCIDVKDASSAARLTA
Ga0137418_1036388413300015241Vadose Zone SoilIVPEIGVFGELVQFGETCRGCIDVKDASSAARQTA*
Ga0132258_1220958013300015371Arabidopsis RhizosphereERIHQRGALLHQLLGLLGIVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA*
Ga0132256_10156272923300015372Arabidopsis RhizosphereLLHQLLGLLGIVPEIGVFGELVQLGQPCRRFLDVKDASSAARLTA*
Ga0182036_1169770323300016270SoilSLLHQLLRLLGIVPEPGILGELVQFRQARGGFLDVKDASSAARLTA
Ga0182032_1056907513300016357SoilGQRILQRGALLHQLLGLLRIVPEIGVFRELVQLGKPRRRCLDVKDASSAARPTA
Ga0182034_1204101913300016371SoilGQRILQRGALLHQLLGLLRIVPEIGIFSELVQLGKPRRRCLDVKDASSAARPTA
Ga0182735_121138423300017544CompostDAAKLVFERGPLLHQLLGFLRVVPEIGVFGEVIQFGETCSCGIDVKDASSAARLTA
Ga0182746_115213323300017652CompostLLHQLLGFLRIVPEIGVFGEVVQFGETCGCSIDVKDASSAARLTA
Ga0187776_1062799023300017966Tropical PeatlandLLHQFLGLLGIVPEIGVFGELVQLGKTRGGFFDVKDASSAARPTA
Ga0184619_1045476023300018061Groundwater SedimentLKLALDLADAIERILQRGSLLHQLLRLLGIVPEIGILCELVQLRETRRGFFDVKDASSAARLTA
Ga0184632_1013284023300018075Groundwater SedimentVELTLDLADALERIHQRGALLHQLLGLLGIVPEIGIFGELIQLGEPSRGFLDVKDASSAARLTA
Ga0187771_1126118013300018088Tropical PeatlandLCLLWVVPEIGVFGELVQFRQPRGGVFDVKDASSAARLTA
Ga0066655_1072583123300018431Grasslands SoilALLHQLLRFLRIVPEIGIFRELVQLGEPRRRFLDVKDASSAARPTA
Ga0066662_1099925213300018468Grasslands SoilLHQLLGLLGIGSEIGILGELVQLGEASRGFLDVKDASSAARLTA
Ga0190264_1058724123300019377SoilHQLLRLLGIVPEIWIFGELVQLGKARRGLFDVKDASSAARQTA
Ga0193753_1025601223300020034SoilGLLGIVPEIGIFGELVQLGEPGRGLFDVKDASSAARLTA
Ga0210407_1077110913300020579SoilLHQLLGLLGIVPEIGIFGELVQLGEPCRRLIDVKDASSAARLTA
Ga0210395_1089875123300020582SoilGIVPEIGVFGKLVQLRQARGGFFDVKDASSAARPTA
Ga0210404_1009759713300021088SoilGIVPEIGVFGELVELGQTRGGRIDVKDASSAARPTA
Ga0210405_1022326913300021171SoilLHQLLRFLWIVPQSGIFGELVQLRQARGGFFDVKDASSAARLTA
Ga0213872_1042328323300021361RhizosphereRILQRGAFLHQLLGLLRIVPEIGVFGELVQLSEARRRLLDVKDASSAARLTA
Ga0213874_1011639413300021377Plant RootsLHQLLRLLRIVPEVRVFGELVQLGKPRGRCLDVKDASSAVRPTA
Ga0210389_1035357823300021404SoilADAIERILQRGPLLHQFLRFLGIVPEVGILRELVQFGKPCRGCIDVKDASSAARLTA
Ga0210387_1073693123300021405SoilRGAFLHQLLRFLWIVPQSGIFGELVQLRQARGGFFDVKDASSAARLTA
Ga0210387_1100313723300021405SoilARQRVLQRGALLHQLLGLLGIVPEIGIFGELVQLGEPCRRLIDVKDASSAARLTA
Ga0210394_1001703443300021420SoilLRFLRIVPQSGIFGELVQLRQARGGFFDVKDASSAARLTA
Ga0210384_1110076823300021432SoilRGALLHQLLGLLRIVPEIGVFGELVQLGEPCRRLIDVKDASSAARLTA
Ga0210390_1068863313300021474SoilQLLRFLWNVPEIGVFGELVQLCQACSGFFDVKDASSAARLTA
Ga0210398_1040941623300021477SoilKRIVQRGSLLHQLLRLLGIIPELGIFGELVQFRQARGGFLDVKDASSAARLTA
Ga0210409_1039236613300021559SoilRGAFLHQLLRFLRIVPQSGIFGELVQLRQARGGFFDVKDASSAARLTA
Ga0210409_1121814713300021559SoilDAAQRILQRGSLLHQPLRLLGVVPEIGIFGELVQLRQTRGGLFDVKDASSAARPTA
Ga0126371_1353484113300021560Tropical Forest SoilLADAGQRVLKRGALLHQLLRFLGIVPEMGVFGELVQLSQPRRRFLDVKGASSAARPTA
Ga0187833_1056390223300022225SeawaterLCVAGIVPQLGIFGEGIQFVELANRGVIVKDASSAARQTA
Ga0242678_103299823300022715SoilDAGQRILQRGAFLHQLLRFLWIVPQSGIFGELVQLRQARGGFFDVKDASSAARLTA
Ga0242657_106478313300022722SoilLHQLLRFLWIVPQSGFFGELVQLRQARGGFFDVKDASSAARLTA
Ga0242654_1022128313300022726SoilQLLGLLGIVPEIGIFGELVQLGEPCRRLIDVKDASSAARLTA
Ga0242654_1040319613300022726SoilAGQRILQRGALLHQLLCFLGIVPEIGIFGQLVQLGQPCRRLFDVKDASSAARQTA
Ga0222622_1019175223300022756Groundwater SedimentILQRRALLHQPLGLLGIVPKIGIFGELVQLGKTSGGLLDVKDASSAARLTA
Ga0247781_101889223300022896Plant LitterLHQLLGLLGIVPEIGIFGELVQLGKSRRGLFNVKDASSAARQTA
Ga0247764_117981113300022897Plant LitterDAGQRILERGTLLHQFLGFLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA
Ga0247783_113247013300022911Plant LitterFLRVVPEIGIFSELVQLREARRGCIDVKDASSAARLTA
Ga0224554_108971713300023068SoilLALDLADAGELPLKRGALLHQLLGFLRIVPEIGVFCESVQFGEARRGSIDVKDASSAARLTA
Ga0247758_106929823300023079Plant LitterLQRIHQRGALLHQLLGLLGIVPEIGIFSELVQLGKARRGLIDVKDASSAARQTA
Ga0247738_1019728823300023100Plant LitterIVPEIGIFSELVQLGKARRGLIDVKDASSAARQTA
Ga0247762_107687023300023169Plant LitterDALQRIHQRGALLHQLLGLLGIVPEIGIFSELVQLGKARRGLIDVKDASSAARQTA
Ga0179589_1006154013300024288Vadose Zone SoilGIVPEIGVFRELVQFRQACGGCIDVKDASSAARLTA
(restricted) Ga0255047_1053600223300024520SeawaterRGALLHQLLRFLGIIPEIGIFCELVQLSEARRRFLDVKDASSAARLTA
Ga0209233_105087513300025261Arabidopsis RhizosphereLDLADARERILQRGALLHQLLGLLGVVPEIGIFCELVQLSEACRRFLDVKDASSAARLTA
Ga0209673_107872013300025273Arabidopsis RootLGIVPEVGIFCELVQLGEACRRFLDVKDASSAARLTA
Ga0209257_109534413300025304Arabidopsis RootIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA
Ga0207696_116345723300025711Switchgrass RhizosphereALDLADALERIHQRGALLHQLLGLLGIVPEIGIFGELVQLGEASRGFLDVKDASSAARLT
Ga0207685_1008488513300025905Corn, Switchgrass And Miscanthus RhizosphereAAERILQRGSLLHQLLRLVGIVPEIGVFCELVQLSKPRRGFFDVKDASSAARPTA
Ga0207645_1029406313300025907Miscanthus RhizosphereDSLQRILQRGALLHQLLGLLGVVPEIGVFGELVQLGKPGRRLFDVKDASSAARLTA
Ga0207643_1084905313300025908Miscanthus RhizosphereILQRGALLHQLLGLLRIVPEIGIFSELVQLSEARRRFLDVKDASSAARLTA
Ga0207643_1112648423300025908Miscanthus RhizosphereLQRGALLHQLLGLLGVVPEIGVFGELVQLGKPGRRLFDVKDASSAARLTA
Ga0207693_1083282423300025915Corn, Switchgrass And Miscanthus RhizosphereKRGPLLHQLLGFLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA
Ga0207657_1025622913300025919Corn RhizosphereLGLLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA
Ga0207657_1041837413300025919Corn RhizosphereAFGSSNAAKLVFERGPLLHQLLGFLRIVPEIGVFGEVVQFGETRGCGIDVKDASSAARLT
Ga0207649_1158318423300025920Corn RhizosphereLRIVPEIGMFGERVQFGETRRCSIDVKDASSAVRQTA
Ga0207681_1011721323300025923Switchgrass RhizosphereGVLLYQLLGFLGIVPEIGIFGELVQLGEASRGFLDVKDASSAARLTA
Ga0207664_1198891813300025929Agricultural SoilELTLERGPLLHQLLGFLRIVPEIGIFGEIVQFGEACRRGVDVKDASSAARLTA
Ga0207644_1161612313300025931Switchgrass RhizosphereLLGLLGIVPEIGMFGELVQLGQSCRGFLDVKDASSAARPTA
Ga0207689_1010129713300025942Miscanthus RhizosphereGIVPEIGIFGELVQLGEASRGLLDVKDASSAARLTA
Ga0207679_1120459913300025945Corn RhizosphereIQRVLQRGSLLHQFLRLLGVVPEIGVLSELVQLRKTGGGFFDVKDASSAARPTA
Ga0207658_1074189513300025986Switchgrass RhizosphereLLHQLLGLLRIVPEIGIFGELVQLGEPCRGFLDVKDASSAARLTA
Ga0207677_1090315223300026023Miscanthus RhizosphereLALDLADALERIHQRGALLHQLLGLLGIVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA
Ga0207677_1142607113300026023Miscanthus RhizosphereGERILERGALLHQLLGLLGVVPEIGIFCELVQLGEACRRFLDVKDASSAARLTA
Ga0207678_1073087013300026067Corn RhizosphereGLLGVVPEIGVFGELVQLGKPGRRLFDVKDASSAARLTA
Ga0207702_1125798513300026078Corn RhizosphereADARERILKRGPLLHQLLGLLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA
Ga0207683_1054816523300026121Miscanthus RhizosphereGALLHQLLGLLGIVPEIGIFGELVQLGKASRGCLDVKDASSAARLTA
Ga0207683_1134336313300026121Miscanthus RhizosphereDLADAFERILQRGALLHQLLGLLGIVPEIGVFGELVQFGEPRRGLFDVKDASSAARLTA
Ga0207698_1150977713300026142Corn RhizosphereDARERILKRGSLLHQLLGFLGIVPEVGIFCELVQLSEACRRFIDVKDASSAARLTA
Ga0209472_130003623300026323SoilRGALLHQLLRLLRIVPEIGIFRELVQLRQTRRGFFNVKDASSAARLTA
Ga0209159_119406223300026343SoilLGIVPEIGVFGELVQLGQTSRGLLDVKDASSAARLTA
Ga0209805_110724413300026542SoilGIVPEIGVFGELVQLRKTRRGFFDVKDASSAARLTA
Ga0209648_1001817663300026551Grasslands SoilLQRGALLHQFLRFLGVVPEIGIFGELVQLGKPRGGLFDVKDASSAARPTA
Ga0209331_116551413300027603Forest SoilLHQLLGLLGVVPEIGIFGELVQLGQTRRGCIDVKDASSAARLTA
Ga0209190_130177423300027736Freshwater LakeMRPLAHQLLRFGGFIPEIGVFGLPVQLGKAGARFIDVKDASSAALRTA
Ga0209701_1051122823300027862Vadose Zone SoilLHQLLGFLGIVPEIGVFRELVQLRKARRGCIDVKDASSAARLTA
Ga0209813_1049667923300027866Populus EndosphereHQRGALLHQLLGLLGIVPEIGVFGELVQLGEPSRGFLDVKDASSAARLTA
Ga0209579_1049853223300027869Surface SoilRFLWVVPEIGVFGELVQLRQPRGGFFDVKDASSAARLTA
Ga0268266_1031302113300028379Switchgrass RhizosphereIVPEVGIFCELVQLSEARRRFLDVKDASSAARQTA
Ga0137415_1093084123300028536Vadose Zone SoilLLRLLGIVPEIGVFRELVQLGKTRRGCFDVKDASSAALLTA
Ga0265326_1018615813300028558RhizosphereALEALDGVQAFFQIGPLAHQLLRAFGVVPEIGFFGFGVQFGEAASRRFDVKDASSAARLT
Ga0247823_1084096223300028590SoilRVLQRGALLHQLLGLLGIVPEIGIFGELIQLREASRGLFDVKDASSAARLTA
Ga0302166_1011471713300028652FenLGLLGIVPEIGIFGEFVQFGETRRGCIDVKDASSAARQTA
Ga0302202_1045322713300028762BogGALLHQFLGLLGIVPEIGIFGELVQLGQTRRGLIDVKDASSAARQTA
Ga0307282_1012857013300028784SoilIVPEIGIFRELVQLREARRGCIDVKDASSAARLTA
Ga0307292_1013705123300028811SoilIVPEIGIFRELVQLGETRRGFFDVKDASSAARLTA
Ga0302157_1051047513300028813BogLHQLLCLLGIVPEIGIFGELVQLGQPRRGCIDVKDASSAARLTA
Ga0311361_1133393913300029911BogLLHQFLGLLGIVPEIGIFGELVQLGQTRRGLIDVKDASSAARQTA
Ga0302150_1010324613300029956BogHQLLSLLGIVPEVGVFRELVQLSKACRGCIDVKDASSAARLTA
Ga0302188_1030304713300029986BogVERILQRGPLLHQFLGLLGIVPEIGIFGELVQLRQTRRGLIDVKDASSAARQTA
Ga0302195_1004327513300030051BogRGALLHQFLGLLGIVPEIGIFGELVQLGQTRRGLIDVKDASSAARQTA
Ga0302046_1040438823300030620SoilALLHKLRSLLRVVPDFGVFGELVQLREAPFGFLKVKETSSAARQTA
Ga0307499_1022487723300031184SoilLHQLLGLLGIVPEIGIFGELVQLGEPRRGLFDVKDASSAARLTA
Ga0307500_1020249823300031198SoilLDLADAIERILQRGSLLHQLLRLLGIVPEVGVLCELVQLGKSRRGCTDVKDASSAARLTA
Ga0307506_1005604413300031366SoilLLHQLLGLLGIVPEIGIFGELVQLGQPCRGLFDVKDASSAARLTA
Ga0170820_1593708413300031446Forest SoilQRGSLLHQLLRLLGIIPELGIFGELVQFRQARGGFLDVKDASSAARLTA
Ga0307505_1036257213300031455SoilGLLRIVPELGVFGELVQLREAALGFLEVKETSSAARATA
Ga0307513_1060970213300031456EctomycorrhizaLHQLLGLLRIVPEIGIFGELVQLREACRGLFDVKDASSAARLTA
Ga0310915_1112456113300031573SoilFLGIVPEIGIFGELVQLSQPRRRFLDVKDASSAARLTA
Ga0310686_11337998413300031708SoilGFLGIVPEIGIFGELVQFGQTRRGCIDVKDASSAARPTA
Ga0307476_1012131323300031715Hardwood Forest SoilKLAFDLADAGQRILQRGAFLHQLLRFLWIVPQSGIFGELVQLRQARGGFFDVKDASSAARLTA
Ga0307474_1152605323300031718Hardwood Forest SoilALLHQLLRFLGIVPEIGIFGELVQLSQPCRRLFDVKDASSAARQTA
Ga0318521_1054015213300031770SoilTLLHQLLSFLRIVPEIGIFCELVQLSEARRRFLDVKDASSAARPTA
Ga0318523_1058857613300031798SoilALLHQPLRLLRIVPEIGIFGELVQLSQPRRRCLDVKDASSAARLTA
Ga0318497_1053322213300031805SoilLHQLLGLLRIVPEIGVFGELVQLRQSRRRLLDVKDASSAA
Ga0307478_1025544823300031823Hardwood Forest SoilPLLHQLLRLLWIVPEIGVFGELVQLRQPRSGFFDVKDASSAARLTA
Ga0307413_1068555423300031824RhizosphereHQLLGLLGIVPEIGIFGELVQLGKASRGLFDVKDASSAARLTA
Ga0318564_1001570313300031831SoilAFLHQLLGFLRIVPEIGVFSELVQLGKPRRRFLDVKDASSAVRPTA
Ga0310917_1002627713300031833SoilQLLRLLGIVPELGIFGELVQFRQTRGGFSDVKDASSAARPTA
Ga0306919_1010122113300031879SoilVQRGSLLHQLLRLLGIVPEPGILGELVQFRQARGGFLDVKDASSAARLTA
Ga0306925_1108705023300031890SoilLGIVPEIGIFCELVQLSEARRRFLDVKDASSAARLTA
Ga0307406_1082686823300031901RhizosphereFDLADAFQRIHQRGALLHQLLGLLGIVPEIGIFGELVQLGKASRGLFDVKDASSAARLTA
Ga0306921_1151246213300031912SoilLRIVPEIGVFGELVQLSQPRRRLLDVKDASSAARPTA
Ga0310916_1081412523300031942SoilLQRGALLHQLLRFLGIVPEIGIFGELVQLSQPRRRFLDVKDASSAARLTA
Ga0310909_1151290223300031947SoilVQRGSLLHQLLRLLGIVPELGIFSELVQFRQARGGFFDVKDASSAARPTA
Ga0306926_1138448123300031954SoilALDLADAGQRILQRGALLHQLLGLLGIVPEIGIFRELVQLSQPRRRLLDVKDASSAARPT
Ga0307409_10156772823300031995RhizosphereLQRIHQRGALLHQLLGLLGIVPEIGIFGELIQLGEARRGLFDVKDASSAARLTA
Ga0307411_1071960523300032005RhizosphereHQRGALLHQLLGLLGIVPEIGIFGELVQLGKASCGLFDVKDASSAARLTA
Ga0318563_1043478113300032009SoilANAGQRILQRGALLHQLLRFLGIVPEIGIFGELVQLSQPRRRFLDVKDASSAARLTA
Ga0318533_1125827013300032059SoilIVPEIGIFCELVQLSEARRRFLDVKDASSAARLTA
Ga0308173_1051970613300032074SoilLERGPLLHQLLGLLGIVPEVGIFCELVQLSEARRRFLDVKDASSAARLTA
Ga0306924_1108212313300032076SoilLLGIVPELGIFGELVQFRQTRGGFFDVKDASSAARPTA
Ga0318540_1038966213300032094SoilRILQRGALLHQLLGLLRIVPEIGVFGELVQLRQSRRRLLDVKDASSAARLTA
Ga0307472_10099708113300032205Hardwood Forest SoilERILQRGALLHQLLSFLRIVPEIGIFCELVQLSEARRRFLDVKDASSAARLTA
Ga0335085_1115183323300032770SoilQLLGLLRIVPEIGVFGELVQLSQARRRLLDVKDASSAARLTA
Ga0335081_1274846713300032892SoilNTGQRILQRGALLHQFLGFLRIVPEVGVFGELVQLGKPCRRFLDVKDASSAARPTA
Ga0335069_1112084513300032893SoilDLADAGQRILQRRALLHQLLGLLGIVPEIGIFCELVQLSKAGRRFLDVKDASSAARLTA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.