| Basic Information | |
|---|---|
| Family ID | F101336 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 40 residues |
| Representative Sequence | PTKIALVGEPSLTSVDPFVSKGTAKTSFCGNSWQATY |
| Number of Associated Samples | 67 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.20 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (67.647 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine (29.412 % of family members) |
| Environment Ontology (ENVO) | Unclassified (82.353 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (80.392 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 15.38% Coil/Unstructured: 84.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF01678 | DAP_epimerase | 81.37 |
| PF02881 | SRP54_N | 12.75 |
| PF11700 | ATG22 | 2.94 |
| PF02885 | Glycos_trans_3N | 0.98 |
| PF12146 | Hydrolase_4 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0253 | Diaminopimelate epimerase | Amino acid transport and metabolism [E] | 81.37 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 67.65 % |
| All Organisms | root | All Organisms | 32.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000186|LPfeb10P162000mDRAFT_c1006303 | Not Available | 865 | Open in IMG/M |
| 3300000322|LPaug08P121000mDRAFT_1041985 | Not Available | 509 | Open in IMG/M |
| 3300001680|KiloMoana_10106105 | Not Available | 1029 | Open in IMG/M |
| 3300001769|supr60_1038814 | Not Available | 693 | Open in IMG/M |
| 3300005429|Ga0066846_10248143 | Not Available | 585 | Open in IMG/M |
| 3300005597|Ga0066832_10199860 | Not Available | 597 | Open in IMG/M |
| 3300005603|Ga0066853_10250212 | Not Available | 584 | Open in IMG/M |
| 3300005948|Ga0066380_10065838 | Not Available | 1040 | Open in IMG/M |
| 3300005951|Ga0066379_10203957 | Not Available | 638 | Open in IMG/M |
| 3300006011|Ga0066373_10172161 | Not Available | 628 | Open in IMG/M |
| 3300006076|Ga0081592_1091806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1227 | Open in IMG/M |
| 3300006306|Ga0068469_1192235 | Not Available | 689 | Open in IMG/M |
| 3300006308|Ga0068470_1468479 | Not Available | 615 | Open in IMG/M |
| 3300006309|Ga0068479_1297810 | Not Available | 913 | Open in IMG/M |
| 3300006310|Ga0068471_1150946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3754 | Open in IMG/M |
| 3300006310|Ga0068471_1436947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 775 | Open in IMG/M |
| 3300006313|Ga0068472_10244631 | Not Available | 1010 | Open in IMG/M |
| 3300006313|Ga0068472_10340103 | Not Available | 669 | Open in IMG/M |
| 3300006313|Ga0068472_10340732 | Not Available | 994 | Open in IMG/M |
| 3300006313|Ga0068472_10347946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3352 | Open in IMG/M |
| 3300006313|Ga0068472_10409726 | Not Available | 810 | Open in IMG/M |
| 3300006313|Ga0068472_10425707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1094 | Open in IMG/M |
| 3300006313|Ga0068472_10478275 | Not Available | 693 | Open in IMG/M |
| 3300006313|Ga0068472_10571140 | Not Available | 515 | Open in IMG/M |
| 3300006313|Ga0068472_10687417 | Not Available | 616 | Open in IMG/M |
| 3300006313|Ga0068472_10735414 | Not Available | 621 | Open in IMG/M |
| 3300006313|Ga0068472_10740780 | Not Available | 681 | Open in IMG/M |
| 3300006313|Ga0068472_10761488 | Not Available | 531 | Open in IMG/M |
| 3300006313|Ga0068472_10785973 | Not Available | 701 | Open in IMG/M |
| 3300006313|Ga0068472_11129311 | Not Available | 725 | Open in IMG/M |
| 3300006315|Ga0068487_1394138 | Not Available | 543 | Open in IMG/M |
| 3300006326|Ga0068477_1149196 | Not Available | 897 | Open in IMG/M |
| 3300006326|Ga0068477_1493756 | Not Available | 948 | Open in IMG/M |
| 3300006330|Ga0068483_1299127 | Not Available | 713 | Open in IMG/M |
| 3300006331|Ga0068488_1155217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1536 | Open in IMG/M |
| 3300006331|Ga0068488_1589399 | Not Available | 500 | Open in IMG/M |
| 3300006331|Ga0068488_1651322 | Not Available | 707 | Open in IMG/M |
| 3300006331|Ga0068488_1712282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 813 | Open in IMG/M |
| 3300006336|Ga0068502_1343469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1290 | Open in IMG/M |
| 3300006339|Ga0068481_1325057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1553 | Open in IMG/M |
| 3300006339|Ga0068481_1328568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1172 | Open in IMG/M |
| 3300006340|Ga0068503_10668203 | Not Available | 801 | Open in IMG/M |
| 3300006341|Ga0068493_10286122 | Not Available | 994 | Open in IMG/M |
| 3300006341|Ga0068493_10317739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3790 | Open in IMG/M |
| 3300006341|Ga0068493_10479433 | Not Available | 671 | Open in IMG/M |
| 3300006341|Ga0068493_10513916 | Not Available | 893 | Open in IMG/M |
| 3300006341|Ga0068493_10558201 | Not Available | 687 | Open in IMG/M |
| 3300006341|Ga0068493_10564416 | Not Available | 779 | Open in IMG/M |
| 3300006341|Ga0068493_10747381 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300006567|Ga0099958_1178023 | Not Available | 799 | Open in IMG/M |
| 3300006902|Ga0066372_10478444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 729 | Open in IMG/M |
| 3300007283|Ga0066366_10276411 | Not Available | 708 | Open in IMG/M |
| 3300007283|Ga0066366_10389494 | Not Available | 604 | Open in IMG/M |
| 3300007514|Ga0105020_1022197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 6044 | Open in IMG/M |
| 3300007514|Ga0105020_1114574 | All Organisms → cellular organisms → Bacteria | 2031 | Open in IMG/M |
| 3300007514|Ga0105020_1116272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2010 | Open in IMG/M |
| 3300008223|Ga0105348_1097104 | Not Available | 872 | Open in IMG/M |
| 3300008253|Ga0105349_10265932 | Not Available | 713 | Open in IMG/M |
| 3300009104|Ga0117902_1421487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1173 | Open in IMG/M |
| 3300009173|Ga0114996_10510992 | Not Available | 904 | Open in IMG/M |
| 3300009481|Ga0114932_10908680 | Not Available | 507 | Open in IMG/M |
| 3300009703|Ga0114933_10210787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1313 | Open in IMG/M |
| 3300009703|Ga0114933_10705875 | Not Available | 646 | Open in IMG/M |
| 3300009703|Ga0114933_10988334 | Not Available | 533 | Open in IMG/M |
| 3300009706|Ga0115002_10784148 | Not Available | 667 | Open in IMG/M |
| 3300009786|Ga0114999_10444682 | Not Available | 1011 | Open in IMG/M |
| 3300010883|Ga0133547_10273980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3524 | Open in IMG/M |
| 3300012950|Ga0163108_11094135 | Not Available | 514 | Open in IMG/M |
| 3300018606|Ga0193025_1011474 | Not Available | 623 | Open in IMG/M |
| 3300020369|Ga0211709_10173144 | Not Available | 654 | Open in IMG/M |
| 3300020425|Ga0211549_10161240 | Not Available | 880 | Open in IMG/M |
| 3300020425|Ga0211549_10207994 | Not Available | 777 | Open in IMG/M |
| 3300020454|Ga0211548_10204264 | Not Available | 958 | Open in IMG/M |
| 3300020459|Ga0211514_10133465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1233 | Open in IMG/M |
| 3300020476|Ga0211715_10008473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 5815 | Open in IMG/M |
| 3300020477|Ga0211585_10207523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1232 | Open in IMG/M |
| 3300020478|Ga0211503_10162311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1277 | Open in IMG/M |
| 3300020478|Ga0211503_10313233 | Not Available | 855 | Open in IMG/M |
| 3300020478|Ga0211503_10680362 | Not Available | 529 | Open in IMG/M |
| 3300021065|Ga0206686_1169845 | Not Available | 634 | Open in IMG/M |
| 3300021442|Ga0206685_10280201 | Not Available | 565 | Open in IMG/M |
| 3300021980|Ga0232637_10481373 | Not Available | 612 | Open in IMG/M |
| 3300025184|Ga0208832_101024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 4456 | Open in IMG/M |
| 3300025235|Ga0208206_1039660 | Not Available | 607 | Open in IMG/M |
| 3300026074|Ga0208747_1023110 | Not Available | 1502 | Open in IMG/M |
| 3300026321|Ga0208764_10430138 | Not Available | 615 | Open in IMG/M |
| 3300027755|Ga0209034_10173010 | Not Available | 674 | Open in IMG/M |
| 3300027844|Ga0209501_10039720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3483 | Open in IMG/M |
| 3300027844|Ga0209501_10348832 | Not Available | 892 | Open in IMG/M |
| 3300028487|Ga0257109_1033635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1690 | Open in IMG/M |
| 3300031757|Ga0315328_10326002 | Not Available | 896 | Open in IMG/M |
| 3300031801|Ga0310121_10142485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1500 | Open in IMG/M |
| 3300031802|Ga0310123_10144739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1629 | Open in IMG/M |
| 3300031803|Ga0310120_10180564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1165 | Open in IMG/M |
| 3300031811|Ga0310125_10128108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1327 | Open in IMG/M |
| 3300031886|Ga0315318_10343053 | Not Available | 856 | Open in IMG/M |
| 3300032006|Ga0310344_10463041 | Not Available | 1088 | Open in IMG/M |
| 3300032019|Ga0315324_10106480 | Not Available | 1054 | Open in IMG/M |
| 3300032130|Ga0315333_10063824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1668 | Open in IMG/M |
| 3300032132|Ga0315336_1104943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1214 | Open in IMG/M |
| 3300032360|Ga0315334_10314138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1307 | Open in IMG/M |
| 3300032360|Ga0315334_11727384 | Not Available | 532 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 29.41% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 17.65% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 10.78% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.78% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 8.82% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 4.90% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 3.92% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 3.92% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.96% |
| Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 1.96% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.98% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.98% |
| Diffuse Hydrothermal Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids | 0.98% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 0.98% |
| Black Smokers Hydrothermal Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000186 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2010 P16 2000m | Environmental | Open in IMG/M |
| 3300000322 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P12 1000m | Environmental | Open in IMG/M |
| 3300001680 | Black smokers hydrothermal plume microbial communities from Kilo Moana, Pacific Ocean | Environmental | Open in IMG/M |
| 3300001769 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Shallow Background Supr60 | Environmental | Open in IMG/M |
| 3300005429 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV76 | Environmental | Open in IMG/M |
| 3300005597 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF51B | Environmental | Open in IMG/M |
| 3300005603 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV61 | Environmental | Open in IMG/M |
| 3300005948 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_O2min_ad_571m_LV | Environmental | Open in IMG/M |
| 3300005951 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300006011 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_O2min_ad_340m_LV | Environmental | Open in IMG/M |
| 3300006076 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid A | Environmental | Open in IMG/M |
| 3300006306 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0500m | Environmental | Open in IMG/M |
| 3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
| 3300006309 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0500m | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006313 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770m | Environmental | Open in IMG/M |
| 3300006315 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0770m | Environmental | Open in IMG/M |
| 3300006326 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0770m | Environmental | Open in IMG/M |
| 3300006330 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_1000m | Environmental | Open in IMG/M |
| 3300006331 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_1000m | Environmental | Open in IMG/M |
| 3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
| 3300006339 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006341 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m | Environmental | Open in IMG/M |
| 3300006567 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0770m | Environmental | Open in IMG/M |
| 3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300007283 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_250_ad_252m_LV_B | Environmental | Open in IMG/M |
| 3300007514 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300008223 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN8C Hudson Canyon | Environmental | Open in IMG/M |
| 3300008253 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon | Environmental | Open in IMG/M |
| 3300009104 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012950 | Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaG | Environmental | Open in IMG/M |
| 3300018606 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_149 - TARA_N000002509 (ERX1782176-ERR1711960) | Environmental | Open in IMG/M |
| 3300020369 | Marine microbial communities from Tara Oceans - TARA_B100000446 (ERX556016-ERR599044) | Environmental | Open in IMG/M |
| 3300020425 | Marine microbial communities from Tara Oceans - TARA_B100001765 (ERX556083-ERR598964) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
| 3300020476 | Marine microbial communities from Tara Oceans - TARA_B100001750 (ERX556108-ERR598958) | Environmental | Open in IMG/M |
| 3300020477 | Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300021065 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021980 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Burke_FS924 _150kmer | Environmental | Open in IMG/M |
| 3300025184 | Marine microbial communities from the Deep Pacific Ocean - MP2158 (SPAdes) | Environmental | Open in IMG/M |
| 3300025235 | Marine microbial communities from the Deep Pacific Ocean - MP1483 (SPAdes) | Environmental | Open in IMG/M |
| 3300026074 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_AAIW_ad_750m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026321 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes) | Environmental | Open in IMG/M |
| 3300027755 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - 250m_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300028487 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_2000m | Environmental | Open in IMG/M |
| 3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
| 3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
| 3300031802 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057 | Environmental | Open in IMG/M |
| 3300031803 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_AW_983 | Environmental | Open in IMG/M |
| 3300031811 | Marine microbial communities from Western Arctic Ocean, Canada - CB11b_Tmax_Bot8 | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032019 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 21515 | Environmental | Open in IMG/M |
| 3300032130 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 34915 | Environmental | Open in IMG/M |
| 3300032132 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #5 | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LPfeb10P162000mDRAFT_10063031 | 3300000186 | Marine | NSFIPTKIALVGEPSLTSVDTFVSKGTAKTSFCGNSWQATY* |
| LPaug08P121000mDRAFT_10419852 | 3300000322 | Marine | FIPTKITLVGEPSLTSVDPFVSKGTAKTFFCGNSWQITY* |
| KiloMoana_101061051 | 3300001680 | Black Smokers Hydrothermal Plume | TYFIIPTKNALVGEPSLTSVDPFVSKGTAKTFFCGNSWQTTY* |
| supr60_10388142 | 3300001769 | Hydrothermal Vent Plume | NSFIPTKTALAGEPSLTSVDPFVSKGTAKTSLCGNSTQPTY* |
| Ga0066846_102481432 | 3300005429 | Marine | PTKITLVGEPSLTSVDPFVSKGTAKTFFCGNTWQTTYRGSKSQ* |
| Ga0066832_101998601 | 3300005597 | Marine | IALVGEPSLTSVDPFVSKGTAKTFFCGNSWQTTY* |
| Ga0066853_102502122 | 3300005603 | Marine | ITLVGEPSLTSVDPFVSKGTAKTFFCGNSWQATY* |
| Ga0066380_100658382 | 3300005948 | Marine | FIPTKIALVGEPSLTSVDPFVSKGTAKTFFCGNSRQATY* |
| Ga0066379_102039571 | 3300005951 | Marine | IFKHNSFIPAKNALVGEPSLTSVDPFVSKGTAKTFFCGNSRQATY* |
| Ga0066373_101721611 | 3300006011 | Marine | GEPSLTSVDPFVPKGTAKTFFCGNRRQATYRGSKSQQIKIKLKI* |
| Ga0081592_10918061 | 3300006076 | Diffuse Hydrothermal Fluids | AKNALVDEPSLTSVDPFASKGTAKTFFCGNSWQTTY* |
| Ga0068469_11922351 | 3300006306 | Marine | IPTKIALVGEPSLTSVDPFVSKGTAKIFFCGNCWQTTY* |
| Ga0068470_14684791 | 3300006308 | Marine | LSKKIFKHNSFIPTKITLVGEPSLTSVDPFVSKGTAKTSFCGNSQQAIY* |
| Ga0068479_12978101 | 3300006309 | Marine | YIFKHNSFIPTKIALVGEPSLTSVDPFVAKGTAKTLLCGNSPQATY* |
| Ga0068471_11509461 | 3300006310 | Marine | PTKDALVGEPSLTSVDPSVPKGTAKISFCGNSWQTTY* |
| Ga0068471_14369471 | 3300006310 | Marine | IPTNTALVGEPSLTSVDPSVSKGTAKTSLCGNSPQATY* |
| Ga0068472_102446311 | 3300006313 | Marine | IALVGEPSLTSVDPFVPKGTAKTFFCGNRWQTTYRGSKSQ* |
| Ga0068472_103401031 | 3300006313 | Marine | EPSLTSVAPFVPKGTAKTFFCGNRWQTTYRGSKSQ* |
| Ga0068472_103407321 | 3300006313 | Marine | PSTDQIFKHNSFIPTQIALVGEPSLTNVDPFVSKGTAKTSFCVNSWQATY* |
| Ga0068472_103479466 | 3300006313 | Marine | IPAKHALVGEPSLTCVDPFVSKGTAKTSLCGNSTQATY* |
| Ga0068472_104097261 | 3300006313 | Marine | HNSFIPTKTALVGEPSLTSVDPFVSKGTAKTSLCGNSTQPTY* |
| Ga0068472_104257071 | 3300006313 | Marine | PTKIALVGEPSLTSVDPFVSKGTAKTSFCGNSWQATY* |
| Ga0068472_104782751 | 3300006313 | Marine | TKITLVGEPSLTSVDPFVSKGTAKTSFCGNSPQATY* |
| Ga0068472_105711402 | 3300006313 | Marine | FKHNSFIPTKIALVGEPSLTSVDPFVSKGTAKTFFCGNSRQATY* |
| Ga0068472_106874171 | 3300006313 | Marine | IFKHNSFIPAKNALVGEPSLTSVDPFVSKGTAKTFFCGNRWQTTY* |
| Ga0068472_107354141 | 3300006313 | Marine | NALVGEPSLTSVDPSVSKGTAKTFFCGNSWQTTY* |
| Ga0068472_107407801 | 3300006313 | Marine | HNILTPTNIALVGEPSLTSVDPFVPKGTAKTFFCGNRRQATYRGSKSQ* |
| Ga0068472_107614882 | 3300006313 | Marine | PAKNALVGEPSLTSVDPFVSKGTAKTFFCGNSWQTTY* |
| Ga0068472_107859732 | 3300006313 | Marine | KIALVGEPSLTSVDPFVSKGTAKTFFCGNSWQITY* |
| Ga0068472_111293111 | 3300006313 | Marine | AKNALVGEPSLTSVDPFVSKGTAKTFFCGNSPQATY* |
| Ga0068487_13941381 | 3300006315 | Marine | FKHNLSIPTTIALVGEPSLTSVDPFVSKGTAKTYFCGNKQQTTY* |
| Ga0068477_11491962 | 3300006326 | Marine | IALVGEPSLTSVDPFVSKGTAKTSFCGNSPQATY* |
| Ga0068477_14937562 | 3300006326 | Marine | NALVGEPSLTSVDPFVSKGTAKTSFCVNSWQTTY* |
| Ga0068483_12991271 | 3300006330 | Marine | NSLVGEPSLTSVDPFASKGTAKTFFCGNSRQATY* |
| Ga0068488_11552171 | 3300006331 | Marine | HNTFIPTKDALVGEPSLTSVDPFVTKGTAKTFFCGNSWQTTY*GSKSQ* |
| Ga0068488_15893991 | 3300006331 | Marine | SFIPTKITLVGEPSLTSVDPFVSKDTAKTFFCGNSWQATY* |
| Ga0068488_16513221 | 3300006331 | Marine | IIPTTIALVGEPSLTSVDPFVSKGTAKTFFCGNSWQITY* |
| Ga0068488_17122823 | 3300006331 | Marine | KIALVGEPSLTSVDPFVSKGTAKTSFCGNSPQATY* |
| Ga0068502_13434691 | 3300006336 | Marine | IPTKNALVGEPSLTSVDPFASKGTAKTSFCGNSWQATY* |
| Ga0068481_13250573 | 3300006339 | Marine | FIPTKIALVGEPSLTSVDPFVSKGTAKTYFCGNSQQTTY* |
| Ga0068481_13285683 | 3300006339 | Marine | TQIALVGEPSLTSVDPFVSKGTAKTTFCGNSQQTTY* |
| Ga0068503_106682032 | 3300006340 | Marine | AKITLVGEPSLTSVDPFVSKGTAKTSFCGNSPQATY* |
| Ga0068493_102861221 | 3300006341 | Marine | IIALVGEPSLTSVDPFVSKGTAKTFFCGNSWQATY* |
| Ga0068493_103177391 | 3300006341 | Marine | TALVGEPSLTSVDPFVSKDTAKTSLCGNNTQATY* |
| Ga0068493_104794331 | 3300006341 | Marine | QTYFLIPTKIALVGEPSLTSVDPFVSKGTAKTFFCGNSWQITY* |
| Ga0068493_105139162 | 3300006341 | Marine | KHNSFIPTKIALVGEHSLTSVDPFVSKGTAKTSFCGNSPQATY* |
| Ga0068493_105582012 | 3300006341 | Marine | NALVGEPSLTSVDPFVSKGTAKTSLCGNSTQPTY* |
| Ga0068493_105644161 | 3300006341 | Marine | NALVGEPSLTSVDPFVSKGTAKTFFCGNSQQATY* |
| Ga0068493_107473812 | 3300006341 | Marine | KNALVDEPSLTSVDPFVSKGTAKTFFCGNSWQTTY* |
| Ga0099958_11780232 | 3300006567 | Marine | PAKNALVGEPSLTSVDLFVSKDTAKTSFCGNSWQTTY* |
| Ga0066372_104784441 | 3300006902 | Marine | IFKHNSFIPTKIALVGEPSLTSVDPFVSKGTAKTSFCGNSWQTTY* |
| Ga0066366_102764111 | 3300007283 | Marine | ALVGEPSLTSVDPFVSKGTAKTFFCGNRWQTIYRGSKSQ* |
| Ga0066366_103894941 | 3300007283 | Marine | IPTKIALVGEPSLTSVDPFVSKGTAKTFFCGNRQQTTY* |
| Ga0105020_10221971 | 3300007514 | Marine | IFKHNLFIPTKIALVGEPSLTSVDPFVSKGTAKTFFCGNSWEITY* |
| Ga0105020_11145741 | 3300007514 | Marine | HNSFIPAKNALVGEPSLTSVDPFVSKGTAKTFFCGNSWQTTY* |
| Ga0105020_11162723 | 3300007514 | Marine | HNSFIPAKNALVGEPSLTSVDPFVSKGTAKTFFCGNSWQATY* |
| Ga0105348_10971042 | 3300008223 | Methane Seep Mesocosm | HNSFIPTKITLVGEPSLTSVDPFVAKGTAKTFFCGNKWQTTY* |
| Ga0105349_102659321 | 3300008253 | Methane Seep Mesocosm | FKHNSFIPTKIALVGEPSLTSVDPFVSKGTAKTSFCGNSQQTTYRGSKSQ* |
| Ga0117902_14214871 | 3300009104 | Marine | KIALVGEPSLTSVDPFVSKGTAKTYFCGNSQQTTY* |
| Ga0114996_105109921 | 3300009173 | Marine | KHNSFIPTKIALVGEPSLTSVDPFVAKGTAKTFFCGNSLQITY* |
| Ga0114932_109086802 | 3300009481 | Deep Subsurface | IFPTKIALVGEPSLTSVDPFVSKGTAKTLFCGNTLESTY* |
| Ga0114933_102107871 | 3300009703 | Deep Subsurface | ALVGEPSLTSVDPFVSKGTAKTYFCGNNSQTIYRGSKSQQIKIKV* |
| Ga0114933_107058752 | 3300009703 | Deep Subsurface | IPAQIALVGEPSLTSVDPFVSKGTAKTSFCGNRQQTTY* |
| Ga0114933_109883342 | 3300009703 | Deep Subsurface | KHNSFIPAKIALVGEPSLTSVDPFVPKGTAKTSFCGNSWETTY* |
| Ga0115002_107841481 | 3300009706 | Marine | IPTKIALVGEPSLTSVDPFVSKGTAKTFFCGNNWQTTY* |
| Ga0114999_104446822 | 3300009786 | Marine | FIPTKIALVGEPSLTSVDPFVAKGTAKTFFCGNSLQITY* |
| Ga0133547_102739801 | 3300010883 | Marine | IALVGEPSLTSVDPFVSKGTAKAFVCGNWLQITH* |
| Ga0163108_110941351 | 3300012950 | Seawater | IALVGEPSLTSVDPFVSKGTAKTFFCGNRWQTTYRGSKSQ* |
| Ga0193025_10114741 | 3300018606 | Marine | IFKHNLFTPTNIALVGEPSLTSVDPFVSKGTAKTSFCGNSPQATY |
| Ga0211709_101731441 | 3300020369 | Marine | TKIALVGEPSLTSVDPFVSKGTAKTFFCGNSWQITY |
| Ga0211549_101612401 | 3300020425 | Marine | GEPSLTSVDPFVPKGTAKTFFCGNRWQATYRGSKSQ |
| Ga0211549_102079941 | 3300020425 | Marine | TKNALVGEPSLTSVDPFVSKGTAKTSFCGNSWQTTY |
| Ga0211548_102042642 | 3300020454 | Marine | IPTTIALVGEPSLTSVDPFVSKGTAKTYFCGNKQQTTY |
| Ga0211514_101334651 | 3300020459 | Marine | NSFIPAKIALVGEPSLTSVDPFVSKGTAKTSFCGNRLQTTY |
| Ga0211715_100084739 | 3300020476 | Marine | FIPTTIALVGEPSLTSVDPFVSKGTAKTYFCGNKQQTTY |
| Ga0211585_102075231 | 3300020477 | Marine | KIALVGEPSLTSVDPFVSKGTAKTFFCGNRGQTTY |
| Ga0211503_101623111 | 3300020478 | Marine | TKIALVGEPSLTSVDPFVSKGTAKTFFCGNNWQTTY |
| Ga0211503_103132331 | 3300020478 | Marine | TKIALVGEPSLTSVDPFVSKGTAKTFFCGNSRQITY |
| Ga0211503_106803621 | 3300020478 | Marine | EPSLTSVDPFVSKGTAKTIFCGNSKQTIYRGSKSQ |
| Ga0206686_11698451 | 3300021065 | Seawater | LLNFQTYFIIPTTITLVGEPSLTSVDPFVSKGTAKTFFCGNSWQITY |
| Ga0206685_102802012 | 3300021442 | Seawater | IFPTKIALVGEPSLTSVDPFVSKGTAKTFFCGNSWQTTY |
| Ga0232637_104813731 | 3300021980 | Hydrothermal Vent Fluids | HNSFIPTKIALVGEPSLTSVDTFVFKGTAKTSFCGNSWQATY |
| Ga0208832_1010246 | 3300025184 | Deep Ocean | SFIPTKIALVGESSLTSVDTFVSKGTAKTSFYGNSWQATY |
| Ga0208206_10396602 | 3300025235 | Deep Ocean | SFIPTKTALVGEPSLTSVDPFVSKGTAKTSLCGNSWQATY |
| Ga0208747_10231101 | 3300026074 | Marine | HNSFIPTKIALVGEPSLTSVDPFVSKGTAKTSFCGNSWKTTYSGSKSQ |
| Ga0208764_104301381 | 3300026321 | Marine | FIPTKIALVGEPSLTSVDPFVSKGTAKTYFCGNRQQTTY |
| Ga0209034_101730101 | 3300027755 | Marine | PTKSALVGEPSLTSVDPFASKGTAKTSLCGNSTQPTY |
| Ga0209501_100397206 | 3300027844 | Marine | PTKITLVGEPSLTSVDPFVSKGTAKTSFCGNSQQTTY |
| Ga0209501_103488321 | 3300027844 | Marine | FIPTKIALVGEPSLTSVDPFVAKGTAKTFFCGNSLQITY |
| Ga0257109_10336351 | 3300028487 | Marine | VGEPSLTSVDPFVPKGTAKTFFCGNRWQTTYRGSKSQ |
| Ga0315328_103260022 | 3300031757 | Seawater | KIALAGEPSLTSVDPFASKGTAKTSFCGNSQQATY |
| Ga0310121_101424851 | 3300031801 | Marine | NSFIPANNALVGEPSLTSVDLFVSKDTAKTSFCGNSWQTTY |
| Ga0310123_101447391 | 3300031802 | Marine | PFIPAKHALVGEPSLTSVDLFVSKDTAKTSFCGNSWQTTY |
| Ga0310120_101805643 | 3300031803 | Marine | FIPTKIALVGEPSLTSVDTFVSKGTAKTSFCGNSWQATY |
| Ga0310125_101281083 | 3300031811 | Marine | PTKNALVGEPSLTSVDPFVSKGTAKTSFCVNSWQATY |
| Ga0315318_103430531 | 3300031886 | Seawater | LFTPTNIALVGEPSLTSVDPFVSKGTAKTFFCGNRWQITYRGSKSQ |
| Ga0310344_104630411 | 3300032006 | Seawater | KHNSFIPTKITLVGEPSLTSVDPFVAKGTAKTSFCGNRWQTTY |
| Ga0315324_101064802 | 3300032019 | Seawater | KHNSFIPTKIALVGEPSLTSVDPFVSKGTAKTSFCGNSWKTTYSGSKSQ |
| Ga0315333_100638243 | 3300032130 | Seawater | VFKHNLFTPTNIALVGEPSLTSVDPFVPKGTAKTFFCGNRWQATYRGSKSQ |
| Ga0315336_11049431 | 3300032132 | Seawater | KITLVGEPSLTSVDPFVSKGTAKTFFCGNSWQTTY |
| Ga0315334_103141381 | 3300032360 | Seawater | TYFIIPTTITLVGEPSLTSVDPFVSKGTAKTFFCGNSWQITYRGSKSQ |
| Ga0315334_117273842 | 3300032360 | Seawater | NLFIPTNIALVGETSLTSVDPFVPKGTAKTFFCGNRWETTYRGSKSQQIKIKLKI |
| ⦗Top⦘ |