NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F098130

Metagenome / Metatranscriptome Family F098130

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098130
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 136 residues
Representative Sequence MPGPHPRRRLVRDDVLLQRGNVQDWAPPGWHWEVLPSGARRLVRNPGPVVDPELLWWRSRGPLSVRREPAPPEVVRRRVREEDEHVRRYMAAMDVRFSNTWQVLRGSHPSYDPVMVPSLWVSTARASGTASELDHSIVFDLY
Number of Associated Samples 61
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 3.85 %
% of genes near scaffold ends (potentially truncated) 37.50 %
% of genes from short scaffolds (< 2000 bps) 94.23 %
Associated GOLD sequencing projects 52
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.038 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(19.231 % of family members)
Environment Ontology (ENVO) Unclassified
(66.346 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(31.731 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.47%    β-sheet: 16.47%    Coil/Unstructured: 67.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF13963Transpos_assoc 1.92
PF03004Transposase_24 0.96



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.04 %
UnclassifiedrootN/A0.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001305|C688J14111_10047250All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1297Open in IMG/M
3300001686|C688J18823_10455799All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata823Open in IMG/M
3300004479|Ga0062595_102555759All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata511Open in IMG/M
3300005827|Ga0074478_1160229All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata547Open in IMG/M
3300005841|Ga0068863_102446086All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata532Open in IMG/M
3300006163|Ga0070715_10310055All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata848Open in IMG/M
3300006163|Ga0070715_10564783All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata662Open in IMG/M
3300010038|Ga0126315_10446809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata818Open in IMG/M
3300010038|Ga0126315_11060489All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata545Open in IMG/M
3300011443|Ga0137457_1300642All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata548Open in IMG/M
3300012211|Ga0137377_10168401All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata2101Open in IMG/M
3300012327|Ga0118275_103676All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata631Open in IMG/M
3300012358|Ga0137368_10538634All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata748Open in IMG/M
3300015273|Ga0182102_1003927All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata943Open in IMG/M
3300015273|Ga0182102_1004666All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata906Open in IMG/M
3300015273|Ga0182102_1006950All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata821Open in IMG/M
3300015273|Ga0182102_1037922All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata535Open in IMG/M
3300015273|Ga0182102_1047735All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata502Open in IMG/M
3300015278|Ga0182099_1000807All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1707Open in IMG/M
3300015280|Ga0182100_1003312All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1392Open in IMG/M
3300015280|Ga0182100_1049803All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata640Open in IMG/M
3300015284|Ga0182101_1001653All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1665Open in IMG/M
3300015284|Ga0182101_1100001All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata502Open in IMG/M
3300015290|Ga0182105_1001536All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1761Open in IMG/M
3300015293|Ga0182103_1015385All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata897Open in IMG/M
3300015293|Ga0182103_1080666All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata549Open in IMG/M
3300015293|Ga0182103_1096781All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata515Open in IMG/M
3300015297|Ga0182104_1003272All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1497Open in IMG/M
3300015309|Ga0182098_1015327All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata995Open in IMG/M
3300015309|Ga0182098_1019121All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata934Open in IMG/M
3300015309|Ga0182098_1085275All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata583Open in IMG/M
3300015319|Ga0182130_1032698All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata828Open in IMG/M
3300018053|Ga0184626_10217688All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata806Open in IMG/M
3300018053|Ga0184626_10366262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata583Open in IMG/M
3300018063|Ga0184637_10382071All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata842Open in IMG/M
3300018063|Ga0184637_10450644All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata757Open in IMG/M
3300018063|Ga0184637_10613689All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata612Open in IMG/M
3300018071|Ga0184618_10078722All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1256Open in IMG/M
3300018073|Ga0184624_10526582All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata512Open in IMG/M
3300018078|Ga0184612_10195742All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1051Open in IMG/M
3300018079|Ga0184627_10074504All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1778Open in IMG/M
3300018079|Ga0184627_10184573All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1104Open in IMG/M
3300018079|Ga0184627_10255193All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata923Open in IMG/M
3300018079|Ga0184627_10278543All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata879Open in IMG/M
3300018079|Ga0184627_10609918All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata547Open in IMG/M
3300020815|Ga0214108_10691948Not Available529Open in IMG/M
3300020815|Ga0214108_11006280All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata507Open in IMG/M
3300020815|Ga0214108_11146526All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata548Open in IMG/M
3300020815|Ga0214108_11400376All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata826Open in IMG/M
3300020816|Ga0214090_11775511All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1289Open in IMG/M
3300020817|Ga0214258_11119587All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata813Open in IMG/M
3300020818|Ga0214277_10069264All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata801Open in IMG/M
3300020818|Ga0214277_10562367All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1517Open in IMG/M
3300020818|Ga0214277_10624558All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1173Open in IMG/M
3300020818|Ga0214277_10879985All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1359Open in IMG/M
3300021080|Ga0210382_10112111All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1144Open in IMG/M
3300021965|Ga0227319_10498212All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata730Open in IMG/M
3300021966|Ga0226662_10026567All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu2475Open in IMG/M
3300021971|Ga0227318_10595828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata500Open in IMG/M
3300021982|Ga0226661_10246458All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1011Open in IMG/M
3300022756|Ga0222622_10056669All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata2240Open in IMG/M
3300023205|Ga0255814_10394120All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1101Open in IMG/M
3300023205|Ga0255814_11507538All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1311Open in IMG/M
3300023205|Ga0255814_11933039All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata730Open in IMG/M
3300023205|Ga0255814_12127231All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata803Open in IMG/M
3300023280|Ga0255813_10093195All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata578Open in IMG/M
3300023280|Ga0255813_10523228All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata535Open in IMG/M
3300023280|Ga0255813_11021132All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata882Open in IMG/M
3300023280|Ga0255813_11324749All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata772Open in IMG/M
3300023291|Ga0256703_10698727All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata707Open in IMG/M
3300023291|Ga0256703_10873941All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu1829Open in IMG/M
3300023291|Ga0256703_11117151All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1263Open in IMG/M
3300023291|Ga0256703_11359953All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata794Open in IMG/M
3300023300|Ga0256702_11335848All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata792Open in IMG/M
3300023300|Ga0256702_12033937All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata593Open in IMG/M
3300023300|Ga0256702_12099698All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1106Open in IMG/M
3300025427|Ga0208077_1014743All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1120Open in IMG/M
3300028019|Ga0224573_1000928All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata2696Open in IMG/M
3300028019|Ga0224573_1009088All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata746Open in IMG/M
3300028048|Ga0256405_10325896All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata910Open in IMG/M
3300028052|Ga0268300_1000553All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata2887Open in IMG/M
3300028052|Ga0268300_1005818All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata707Open in IMG/M
3300028054|Ga0268306_1004636All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata930Open in IMG/M
3300028147|Ga0268303_102337All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata759Open in IMG/M
3300028237|Ga0302338_1055192All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata783Open in IMG/M
3300028463|Ga0268325_103640All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata540Open in IMG/M
3300028464|Ga0268302_102842All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata730Open in IMG/M
3300028464|Ga0268302_104735All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata618Open in IMG/M
3300028465|Ga0268301_100492All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1275Open in IMG/M
3300028714|Ga0307309_10025811All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1175Open in IMG/M
3300028824|Ga0307310_10361334All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata715Open in IMG/M
3300028876|Ga0307286_10223824All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata686Open in IMG/M
3300028885|Ga0307304_10263977All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata753Open in IMG/M
3300029799|Ga0311022_11500615All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata687Open in IMG/M
3300029799|Ga0311022_12029946All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1112Open in IMG/M
3300029799|Ga0311022_12495721All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1224Open in IMG/M
3300029799|Ga0311022_12941803All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1010Open in IMG/M
3300030872|Ga0265723_1028824All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata525Open in IMG/M
3300031047|Ga0073995_12236408All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata538Open in IMG/M
3300031152|Ga0307501_10167523All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata608Open in IMG/M
3300031708|Ga0310686_102675379All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1331Open in IMG/M
3300031708|Ga0310686_112927257All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata829Open in IMG/M
3300032822|Ga0314740_1000053All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae5489Open in IMG/M
3300033812|Ga0364926_038080All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata910Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere19.23%
Food WasteEngineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste14.42%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment12.50%
Food WasteEngineered → Solid Waste → Landfill → Unclassified → Unclassified → Food Waste8.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.69%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere7.69%
Food WasteEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Food Waste4.81%
Anaerobic Digester DigestateEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate3.85%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.92%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.92%
RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Roots1.92%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.96%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.96%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.96%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.96%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.96%
Human SkinHost-Associated → Human → Skin → Unclassified → Unclassified → Human Skin0.96%
FecesHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Feces0.96%
RumenHost-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005827Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBAEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300011443Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2EnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012327Human skin bacterial and viral communities - University of Pennsylvania - MG100562Host-AssociatedOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300015273Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015278Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300020815Food waste microbial community from Durham, Ontario, Canada - FW2 megahitEngineeredOpen in IMG/M
3300020816Food waste microbial community from Durham, Ontario, Canada - FW1 megahitEngineeredOpen in IMG/M
3300020817Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed1 megahitEngineeredOpen in IMG/M
3300020818Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed2EngineeredOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021965Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed1 spadesEngineeredOpen in IMG/M
3300021966Food waste microbial community from Durham, Ontario, Canada - FW2 spadesEngineeredOpen in IMG/M
3300021971Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed2 spadesEngineeredOpen in IMG/M
3300021982Food waste microbial community from Durham, Ontario, Canada - FW1 spadesEngineeredOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023205Combined Assembly of Gp0242100, Gp0242119EngineeredOpen in IMG/M
3300023280Combined Assembly of Gp0238881, Gp0242115EngineeredOpen in IMG/M
3300023291Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada. Combined Assembly of Gp0242115, Gp0242119EngineeredOpen in IMG/M
3300023300Food waste microbial community from Durham, Ontario, Canada. Combined Assembly of Gp0238881, Gp0242100EngineeredOpen in IMG/M
3300025427Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300028019Spruce roots microbial communities from Bohemian Forest, Czech Republic ? CRU1Host-AssociatedOpen in IMG/M
3300028048Bovine rumen microbial communities from Lethbridge, Alberta, Canada - RJG_02Host-AssociatedOpen in IMG/M
3300028052Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028054Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028147Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028237Enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Reed Canary Grass, Gen10, Rep 2, Chloramphenicol (External Submission)Host-AssociatedOpen in IMG/M
3300028463Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028464Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028465Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300029799Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119EngineeredOpen in IMG/M
3300030872Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031047Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300032822Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033812Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J14111_1004725023300001305SoilMPGPHPRYRRASGLLDGMRVLDWAPPGWHWEVVSGVRRLARNPGLVVDPDILWWRSRGPQSVRREPAPEEVVRRRIREEDDHVRRYMAALDDAGYYSLWQVLQGSHPSYEWVMVPSLWVSTASRSRRRLLF*
C688J18823_1045579923300001686SoilMPGPHPRRRHVRDDVQLTHVRDWAPPGWHWEVLPGGARRLMRNPAPGPVVDPDLVWWRSRGPVSVRREPAPPEVVRRRVREEDEHVHRYMVALEGGRFSNTWQFLQGSHFSYDPVRVPSLWVSTARAAGTASVLDSSVVFDL*
Ga0062595_10255575913300004479SoilFSFINTFSATMPGPHPRYRRAAGLLDGMRNYRDWAPPGWHCEVVSGAHRLVRNPGLVVDPDLLWWRSRGPQSVQREPAPEEVVSRRVREEDEHVRRYMVALDAGYSSTWQVLQGSHPSYEWVMVPSLWVSTARRSRRRLLY*
Ga0074478_116022913300005827Sediment (Intertidal)YKNGVFSSLLSTTMLDPHPRRRLGGNDQGLSSAGHVRDWAPPGWHWEVLPSGTRSLVRNPGLVVDPELLWWRSRGPLSVQREPAPEELVRRRIREEDEHVRRYMVALDVRFSNTWQYLQGSHPSYDPLMVPSLWVFTARDSGSASRRPV*
Ga0068863_10244608613300005841Switchgrass RhizosphereMPGPHPRYRRASGLLDGMRVLDWAPPGWHWEVVSGVRRLVRNPGLVVDPDILWWRSRGPQSVRREPAPEEVVRRRIREEDDHVRRYMAALDAGYYSLWQVLQGSHPSYEWVMVPSLWVSTASRSRRRLLF*
Ga0070715_1031005533300006163Corn, Switchgrass And Miscanthus RhizosphereMPGPHPRRRLVRDDVLLQRGNVQDWAPPGWHWEVLPSGARRLVRNPGPVVDPELLWWRSRGPLSVRREPAPPEVVRRRVREEDEHVRRYMAAMDVRFSNTWQVLRGSHPSYDPVMVPSLWVSTARASGTASELDHSIVFDLY*
Ga0070715_1056478313300006163Corn, Switchgrass And Miscanthus RhizosphereMPGLHPRRRRVGGDIMLERRNVRDWAPPGWHWEVLPSRARSLVRNPGLVVDPELLWWRSRGPLSVQRERAPAEVVRRRVREEDEHVRRYMVALDARFDNTWQILQGSHPSYDPVMVPYLWVSTTRDSGTASDLDYSIVFDLY*
Ga0126315_1044680923300010038Serpentine SoilMLNPHPCRQPVRDDVLLQRRHVRDWAPPGWHWEVLPSGARIFVRIPGPVVDPELLWWRARGPHSVRRLASPAEVVRHRVMEEDDHVHHYMVALNVRFSNTCQVLQGSHWSYDPVVVPSLWVSTASQLNYSIVDDLH*
Ga0126315_1106048913300010038Serpentine SoilMSGPHRRRRPVCDDVLLQRTHARDWAPPGWHWEVLPSGARRLVRNPAPGTVVDPELLWWRSRGPLSVRREPAPPEVVCRRVREEDEHVRRYMAAMDVRFSNTWQVLRGSHPSYDSVMVPSLWVSTARASGTASELDYSIVFDLD*
Ga0137457_130064213300011443SoilMPIPHPRRRLGADNQLRHVRDCALPGWHWEMLPTGARSLVRNLASGPVVDPELLWWRSRGPLSVRRQPAPSEVVRRRVREEDEHVRRYMVTLDVRFSNTWQFLQGSQPSYDPVMVPSLWVFTARGSWSESRRPV*
Ga0137377_1016840123300012211Vadose Zone SoilMPGPHPRRRLGGDDLLERRHVRDWAPPGWHWEVLPSRARSLVRNPGPVVDPELLWWRSRGPLSVWRQPATPEMVRRRVREEDEHVRRYMAALDARFSNTWQVLQGSHPSYDPVMVPSLWVSTARASGTASELDSSIIFDLY*
Ga0118275_10367613300012327Human SkinMPGPHPRRRPVRDDVQPTHVRDWAPPGWHWEVLPGGARRLMRNPAPGPVVDPDLVWWRSRGPVSVRREPAPPEVVRRRVREEDEHVHRYMVALEGGRFSNTWQFLQGSHFSYDPVRVPSLWVSTARAAGTASVLDSSIVFDL*
Ga0137368_1053863413300012358Vadose Zone SoilMPGPHPRRRPVRSNVFLQRGHVRDWAPPGWHWEVLPSGARRLVRNLALGPVVDPELLWWRSRGPLSVRREPAPPEVVCRRVREEDEHVRRYMAAMDVRFSNTWQVLRGSHPSYDPVMVPSLWVSTARASGTASELDYSIVFDLDY*
Ga0182102_100392713300015273Switchgrass PhyllosphereMQLINKTLHILYKFSTTMPGPHPRYRRVGEHPFDRMGDVQDWAPPGWHWEVISEARRLVRNPGPVVDPHILWWWSRGPQSVRRQPAPEWIVRQRVREEDEHVRRYLEALGAAGSCRTWRVLQVSHPSYEFVVVPSLWVATFRRTRRCLLY*
Ga0182102_100466623300015273Switchgrass PhyllosphereMMPGPHPRRRRVGSDILLERHNVRDWAPPGWHWEVLPSRARSLVRNPGLVVDPELLWWRSRGPLSVQRERAPAEVVSHRVREEDEHVRHYMAALDARFSNTWQVLQGSHPSYDPVMVPYLWVSTASDSETASEPSSPSCTL
Ga0182102_100695013300015273Switchgrass PhyllosphereMPGPHPRDRCASGVLDGMRNVRDWAPQGWHWEVVSGVRRLARNPDLVVDPDLLWWRSQGPRSVRREPAPEEVLRRRIRQEDQHVLWYMVALDIRFDNTWQVLQGSHPSYEWVMVPSLWVSTASRSRRCLLF*
Ga0182102_103792213300015273Switchgrass PhyllosphereMQLINKTLHILYKLSTTMPGPHPRYRRVREHPFDRMGDVRDWAPPGWHWEGASEARHLVRNPGPVVDPHILWWRSHGPHSVRRQPAPEWIVRRRVREEDEHVRRYLAALGAAGSCRTWRVLQGSHPSYEFVVVPSLWVATRLTRRCLLY*
Ga0182102_104773513300015273Switchgrass PhyllosphereMPGPHPRYRRASGLLDGMRVLDWAPPGWHWEVVSGVRRLARNPGLVVDPDILWWRSRGPQSVRREPAPEEVVRRRIREEDDHVRRYMAALDARYYSLWQVLQGSHPSYEWVMVPSLWVSTASWRRRCFLF*
Ga0182099_100080723300015278Switchgrass PhyllosphereMQLINKTLHILYKLSTTMPGPHPRYRRVREHPFDRMGDVRDWAPPGWHWEGASEARRLVRNPGPVVDPHILWWQSHGPHSVRRQPAPEWIVRRRVREEDEHVRRYLAALGAAGSCRTWRVLQGSHPSYEFVVVPSLWVATRLTRRCLLY*
Ga0182100_100331233300015280Switchgrass PhyllosphereVRMPGPHPRYRRASGLLDGMRVLDWAPPGWHWEVVSGVRRLVRNPGLVVDPDILWWRSRGPQSVRREPVPEEVVRRRIREEDDHVRRYMAALDDAGYYSLWQVLQGSHPSYEWVMVPSLWVSTASRSRRRLLF*
Ga0182100_104980313300015280Switchgrass PhyllosphereMPGPHPRYRRAPGVLDGMRVLDWAPPGWHWEVVFGVRRLARNPGLVVDPDILWWRSHGPQSVRREPAPEEVVRRRIREEDDHVRRYMAALDAGYYSLWQVLQGSHPSYEWVMVPSLWV
Ga0182101_100165323300015284Switchgrass PhyllosphereMPGPHPRYRRASGLLDGMRVLDWAPPGWHWEVVSGVRRLARNPGLVVDPDLLWWRSRGPQSVRREPAPEEVVRRRIREEDDHVRRYMAALDDAGYYSLWQVLQGSHPSYEWVMVPSLWVSTASRSRRRLLF*
Ga0182101_110000113300015284Switchgrass PhyllosphereMQLINKTLHILYKLSTTMPGLHPRYRRVREHPFDRMGDVRDWAPPGWHWEGASETRRLVRNPGPVVDPHILWWRSRGPQSVRRQPAPEWIVRRRVREEDEHVRRYLAALGAAGSCRTWRVLQGSHPSYEF
Ga0182105_100153613300015290Switchgrass PhyllosphereMQLINKTLHILYKLSTTMPGPHPRYRRVREHPFDRMGDVRDWAPPGWHWEGASEARRLVRNPGPVVDPHILWWRSRGPQSVRRQPAPEWIVRRRVREEDEHVRRYLAALGAAGSCRTWRVLQGSHPSYEFVVVPSLWVATRLTRRCLLY*
Ga0182103_101538513300015293Switchgrass PhyllosphereMGNVWDWAPPGWHWEVISEARRLVRNPGPVDDPDLLWWRSRGPQAVRRQSAPEWIIRRRVREEDEHVRRYLAALGAGSCRTWQVLQGSHPSYEFVVVPSLWVATFRRTRRSLLY*
Ga0182103_108066613300015293Switchgrass PhyllosphereMPGPHPRRHHGGEHLLDGMGNVRDWALPGWHWEVISGARCLVRNPGPVVDPDLLWWRSRGPQRVEREATPKWIVRRRVREEDEHVCHYMVALDAGYSRTWQVLQGSHPSYEFVMVPSLWVFTFHRSRHCLLY*
Ga0182103_109678113300015293Switchgrass PhyllosphereVNKILHILNKFSATMPGPHPRRRRVGEHPFDRMGDVRDWAPPGWHWEVLFEARRLVRNPRPVVDPDLLWWRSHGPQAVRRQPTPEWIVRRRVWEEDEHIRRYLEALGAGSCRTWQVLQGSHLSYEFMVVPSLWVITFRRTRRCLLY*
Ga0182104_100327213300015297Switchgrass PhyllosphereMQLINKTLHILYKFSTTMPGPHPRYRRVGEHPFDRMGDVRDWAPPGWHWEGASEARRLVRNPGPVVDPHILWWRSHGPHSVRRQPAPEWIVRRRVREEDEHVRRYLAALGAAGSCRTWRVLQGSHPSYEFVVVPSLWVATRLTRRCLLY*
Ga0182098_101532713300015309Switchgrass PhyllosphereMPGPHPRYRRASGLLDGMRVLDWAPPGWHWEVVSGVRRLARNPGLVVDPDLLWWRSRGPQSVRREPAPEEVVRRRIREEDDHVRRYMAALDVGYYSLWQVLQGSHPSYEWVMVPSLWVSTASRSRRRL
Ga0182098_101912113300015309Switchgrass PhyllosphereMQLINKTLHILYKLSTTMPGPHPRYRRVREHPFDRMGDVRDWAPPGWHWEGASEARRLVRNPGPVVDPHILWWRSRGPQSVRRQPAPEWIVRRRIREEDEHVRRYLAALGAAGSCRTWRV
Ga0182098_108527513300015309Switchgrass PhyllosphereMSGPHPHYRRASGLLDGMRVLDWAPPGWHWEVVSGVRRLARNPGLVVDPDILWWRSRGPQSVRREPAPEEVVRRRIREEDDHVRRYMAALDDAGYYSLWQVLQGSHPSYEWVMVPSLWVSTASRSRRRLLF*
Ga0182130_103269813300015319Switchgrass PhyllosphereMPGPHPRRRLGGGGLLDQRGHVQDWAPPGWHWEVLPSGACSLVRNQAPVVDPELLWWRSRGPLLVRRQPAPSEVVRRRVREEDEHVRRYMDALDVRFSNTWQVLQGSQPSYDPVMVPSLWVSTARASGTVSELDSSIIFDLY*
Ga0184626_1021768823300018053Groundwater SedimentHPRLRLGDEYLLDEMRHVRDWAPPGWHWEVLPSAERNLVRIPGPIVDPELLWWRSRGPQRVQREPAHEAVVRRRVREEDEHVRRYMVALDTRFSNTWQVLQGPHPGYDFVPVPYLWVFTARGSGSRRRLMY
Ga0184626_1036626213300018053Groundwater SedimentMPGPHPRLRRGGEHLLDQMRHVRDWAPPGWHWEVVSGAHRLVKNPGPVIDPELLWWRSRGPQSVPEEVVRRRVREEDQHVRRYLVALDARFSTSNTWQVLQGSHPSYAPVMVPDTSQTYL
Ga0184637_1038207113300018063Groundwater SedimentFSATMPGPHPRRRGGEHLLDGMRNVRDWAPPGWHWEVVSGARRLVRNPGPVVYPELLWWRSRGPQRVQREPAHEEVVRRRVREEDEHVRRYMVTLDARFSNTWQVLQGPHPGYDFVPVPYLWVFTARGSGSRRRLMY
Ga0184637_1045064423300018063Groundwater SedimentMPVPHPRSRLSSDNLLERRDVRDWAPPGWHWEVVSGARRLVRNPGLVVDPELLWWRSHGPQSVQREPSSEEVVRRRVREEDEHVRRYMVALDARFSSTWQVLQGSHPSYEFVMVPSLWVFTARRSRRCLMY
Ga0184637_1061368913300018063Groundwater SedimentTFSATMPGPHPRDRRGGEHLLDGMRNVRDWAPPGWHWEVVSGARRLVRNPGLVVDPELLWWRSRGPQSVQRKPAPEEVVRRRVREEDEHVRCYMVALDARFSSTWQVLQGSHPSYEFVMVPSLWVFTASGSGTASRRPV
Ga0184618_1007872223300018071Groundwater SedimentMRPHRRLGGNDQGLGSAGHVRDWALPGWHWEVLPSGRRSLVRNQGPVVDPELIWWRSRGPRSVQREPAPEEVVRRRVREEDEHVRRYMVALDVRFSNTWQFLQGSHLSYDPVMVPSLWVFTARGSGPESRRPV
Ga0184624_1052658213300018073Groundwater SedimentMPGPHPRRRGGEHLLDGMRNVRDWAPPGWHWEVVSGARRLVRNPGPVVDPELLWWRSQGPQSVQREPAPEEVVRRRVREEDEHVHRYMVALDVRFSNTWQFLQGSHPSYDPVMVPSLWVLTARGSGPESRRPV
Ga0184612_1019574223300018078Groundwater SedimentMPGPHSRSRLDSDNLLERREVRDWAPPGWHWEVVSGARRLVRNPGLVVDPDLLWWRSRGSQSVQRESAPEEVVRRRVREEDEHVRRYMVALDAGYSSTWQVLQGSHPSYEWVMVPSLWVFTARGSASGRRRV
Ga0184627_1007450433300018079Groundwater SedimentTMPGPHPRSRLGSDNLLEKRDVRNWAPPGWHWEVVSGARRLVRNPGLVVDPDLLWWRSRGPQSVQREPAPEEVVSRRVREEDEHVRRYMVALDARFSSTWQVLQGSHPSYEFVMVPSLWVFTARRSRRRLLYQ
Ga0184627_1018457323300018079Groundwater SedimentMSGPHHRLRCGGEHLLDQMRHVRDWAPPGWHWEVVSGARRLVRNPGPVVDPKLLWWRSRGPQRVQREPAHEEVVRRRVREEDEHVRRYMVALDVRFSNTWQVLQGPHPGYDFVPVPYLWVFTARGSGSRRRLMY
Ga0184627_1025519313300018079Groundwater SedimentSFINTFSATMPGPHPRDRRALGLLDGMRTVRDWAPPGWHWEVISGVRRLVRNSGLVVDPDLLWWRSRGPQSVRREPAPVEVVRRRIREEDEHVRRYMVALDAGYSSTWQVLQGSHPSYEWVMVPSLWVSTARRSRRRLLY
Ga0184627_1027854313300018079Groundwater SedimentMPGPHPRRRLRSENLLERRDVRDWAPPGWHWEVVFGARRLVRNPGLVIDSELLWWRSRGPQSVQREPTREEVVHRRVREEDEHVHRYMVVLDARFSSTRQVLQGSHPSYEFVMVPSLWVFTARRSRRRLLY
Ga0184627_1060991813300018079Groundwater SedimentMPGPHPRSRLGSENLLERRDVRDWAPPGWHWEVVSGARRLVRNPGLVVDPELFWWRSRGLQSVQREPAPEEVVRRRVREEDQHVHRYMVALDARFSSTWEVLLGSHPSYEFVMVPSLWVFTARGSAPGRRRV
Ga0214108_1069194813300020815Food WasteMPGPHPRRRPVRDDVLRQRTHVWDWALLGWHWEVLPGGARRLVRNPTSGPGVDPDLLWWRARGTHSVQRQPAPPEVVRRRVREEDAHGPRYMAAMDDVRFSTTWQVLWADDPVMVPSLWVCTARAPGTASGTLDSSVVLNLY
Ga0214108_1100628023300020815Food WasteAPPGWHWEVLPGGARRLVGNPTSGPDVDPDLLWWRSRGPHSVQRQPAPLEVVIRRVREEDENVHRYMAAMDDVRFSTTWRVLWADDRRYDPVMVPSLWVCTARAPGTASGALDSSVVLDL
Ga0214108_1114652613300020815Food WasteMPAPHPRRRPVRDDVLLQRTHVRDWAPPGWHWEVLPGGARHLVRNPGPVVDPEVLWWRSRGPLSVRREPAPPEVVRRRVREEDEHVRCYMAAMDVSFSNTWQSLWGDHRSYDPVMVPSLWVSTACAS
Ga0214108_1140037623300020815Food WasteMPGPHPRRRPVRDDVQPTHVRDWAPPGWHWEVLPGGARRLMRNPAPGPVVDPDLVWWRSRGPVSVRRDPAPPEVVRRRVREEDEHVHRYMVALEGGRFSNTWQYLRGSHFSYDPVRVPSLWVSTAHAGGTASVLDSSVVFDLY
Ga0214090_1177551113300020816Food WasteMPGPHPRRRPVRDDVQPTHVRDWAPPGWHWEVLPGGARRLMRNPAPGPVVDPDLVWWRSRGPVSVRRDPAPPEVVRRRVREEDEHVHRYMVALEGGRFSNTWQYLRGSHFSYDPVRVPSLWVSTARAAGTASVLDSSVVFDL
Ga0214258_1111958723300020817Food WasteIRDDVLLQRTHVRDWAPPGWHWEVLPSGPRRLVRNPAPGAIVDPHLLWWRSRGPLSVRREPAPPEVVRHRVREEDEHIHRYMAAMDVRFSNTWQVLWGDHPSYDPVMVPSLWVSTARTSGTASGLDYSVVFDLY
Ga0214277_1006926413300020818Food WasteMMPGPHPRRRPVRDDVRLTHVRDWAPPGWHWEVLPRGARRLVRYPASGPVVDSDLLWWRSHGPHSLQREPAPPEVVRRRVREEDEHVHRYMAAMDVRFFNTWQVLWVDDRRYDPVMVPCLWVSTAR
Ga0214277_1056236733300020818Food WasteMPGPHPRRRPVRDDVRLTHVRDWAPPGWHWEVLPGGARRLMRNPAPGPVVDPDLVWWRSRGPVSVRRDPAPPEVVRRRVREEDEHVHRYMVALEGGRFSNTWQYLRGSHFSYDPVRVPSLWVSTARAAGTASVLDSSVVFDLY
Ga0214277_1062455813300020818Food WasteMPGPHPRRRPVRDAVLLQRTHVRDWAPSGWHWEVLPGGACRLVRNPTSGPVVDPDLLWWRSRGPHSVQRQPAPPEVVRRRVREEDEHVHRYMAAMDDVRFSTTWRVLWADDRRYDPVMVPSLWVCTARAPGTASGALDSSVVLDLY
Ga0214277_1087998543300020818Food WasteMPGPHPRRRPIRDDVRLTHVRDWAPPGWHWEVLPSGARRLVRNPAPGPVVDPHLLWWRSRGPLSVRREPAPPEVVRRRVREEDEHVHRYMAAMDVRFSNTWQVLWGDHPSYDPVMVPSLWLSTA
Ga0210382_1011211123300021080Groundwater SedimentMPDPHRRRRLGGDDPFRRSDVRDWAPPGWHWEVLPSGARSLVRNPGLVVDPELLWWRSHGPLSVQREPAPEEVVRRRIREEDEHVRRYMYALDRMYSNTWSFLQGSHVSYVPVWVPYLWVCTARGSGPPGPSRRLV
Ga0227319_1049821213300021965Food WasteMPGPHPRRRPVRDDVLLQRTHVRDWAPPGWHWEVLPGGARRLVRNPASGPVVDPDLLWWRSRGPLSVRREPAPPEVVRRRVREEDEHVHRYMAAMDVRFSNTWQVLWGDHPSYDPVMVPSLWVSTARTSGTASGLDYSVVFDLY
Ga0226662_1002656713300021966Food WasteMPGPHPRRRPVRDDVLLQRTHVRDWAPPGWHWEVLPGGARRLVRNPASGPVVDPDLLWWRSRGPHSVQREPAPPEVVRRRVREEDEHVHRYMAAMDVRFSNTWQVLWADDRRYDPVMVPSLWVSTARAPGTASGALDSSVVLDLY
Ga0227318_1059582813300021971Food WasteFSTMPGPHPRRRPVRDDVQPTHVRDWAPPGWHWEVLPGGARRLMRNPAPGPVVDPDLVWWRSRGPVSVRRDPAPPEVVRRRVREEDEHVHRYMVALEGGRFSNTWQFLRGSHFSYDPVRVPSLWVSTARAGGTASVLDSSVVFDLY
Ga0226661_1024645813300021982Food WasteMPGPHPRRRPVRDDVLLQRTHVRDWAPPGWHWEVLPGGARRLVRNPASGPVVDPDLLWWRSRGPHSVQREPAPPEVVRRRVREEDEHVHRYMAAMDVRFSNTWQVLWADDRRYDPVMVPCLWVSTARAPGTASGLDSSIVFDLY
Ga0222622_1005666913300022756Groundwater SedimentMPGPHPRLRRGDEHLLDQMRNVRDWAPPGWHWEVVSGARRLVRNPGPVVDPELLWWRSRGPQRVQREPAHEAVVRRRVREEDEHVRRYMVALDTRFSNTWQVLQGPHPGYDFVPVPYLWVFTARGSGTGSRRRLMY
Ga0255814_1039412013300023205Food WasteWAPPGWHWEVLPSGARHLVRNPPPGPVVDPDLLWWRSPGPLSVRREPAPPEVVRRHVSKEDEHVCRYMAAMDVRFFNTWLVLWGDDRSYDPMMVPSLWVSTARASGTASGLDYSVVFDLY
Ga0255814_1150753833300023205Food WasteMPGPHPRRRPVRDDVLLQRTHVRDWAPPGWHWEVLPGGARRLVRNPTSGPVVDPDLLWWRSRGPHSVQRQPAPPEVVRRRVREEDEHVHRYMAAMDDVRFSTTWRVLWADDRRYDPVMVPSLWVCTARAPGTASGALDSSVVLDLY
Ga0255814_1193303923300023205Food WasteVRDWAPLDWHWEVLPRGARRLMRNPAPGPVVDPDLVWWRSRGPHSVQREPAPPEVVRRRVREEDEHVHRYMVALEGGKFSNTWQFLQGSHFSYDPMRVPSLWVSTARAAGTTSGLDSFVVFDLY
Ga0255814_1212723113300023205Food WasteMPGPHPRRQPVRDDVLLQRTHVRDWAPPGWHWEVLPSGARRLVRNPASGPVVDPDLLWWRSRGPHSVQREPAPPEVVRRRVREEDEHVHRYMAAMDVRFSNTWQVLWADDRRYDPVMVPCLWVSTARAPGTASGLDSSIVFDLY
Ga0255813_1009319513300023280Food WasteMPGPHPRRRPVRDDVQPTHVRDWAPPGWHWEVLPGGARRLMRNPAPGPVVDPDLVWWRSRGPVSVRRDPAPSEVVRRRVREEDEHVHRYMVVLEGGRFSNTWQFLKGSHFSYDPVRVPSLWVSTARTA
Ga0255813_1052322823300023280Food WasteRPVRDDVLVQRSHVRDWAPPGWHWEVLPSRARRLVRNPAPGPVVDPDLVWWRSRGPVSVRRDPAPPEVVRRRVREEDEHVHRYMVALEGGRFSNTWQFLQGSHFSYDPVRVPSLWVSTARAAGTASVLDSSVVFDL
Ga0255813_1102113213300023280Food WasteTFCGHIVFVLNDIPGPHPRRRPVRDDVLLQRTHVQDWAPPGWHWEVLPGGARRLVRNPTSGPVVDPDLLWWRSRGPHSVQRQPALSEVVRRRVREEDEHVHRYMAAMDDVRFSTTWRVLWADDRRYDPVMVPSLWVCTARAPGTASGALDSSVVLDLY
Ga0255813_1132474923300023280Food WasteMPGPHPRRRPVRDDVLLQRTHVRDWAPLGWHWEVLPGGARRLVRNPASGPVVDPDLLWWRSRGPHSVQREPAPPEVVRRRVREEDEHVHRYMAAMDVRFSNTWQVLWGDHPSYDPVMVPSLWLSTA
Ga0256703_1069872713300023291Food WasteMIPGPHPRRRPVRDDVMLQGTHVRDWAPPGWHWEVLPRGVRRLVRNPASGPVVDPDLLWWRSRGPHSVQREPAPPEVVRRRVTEEDEHVQRYMAAMDDVRFSTTWRVLWADDRRYDPMMVPSLWVCTARAPGTASGALDSSVVLDLY
Ga0256703_1087394133300023291Food WastePPPMMPIPHPHRRLGGGGLLDQRGHVRDWASPGWYWEVLPSGGRSLVRSHSVVHPNLVLWRSRGPVTVPRLPAPPEVVRRRVREEDEHVHRYMTAMDVRFSNTWQSLWGDDQSYDPVMVPSLWVSTARASGTASGLDSSVVFDLY
Ga0256703_1111715113300023291Food WasteYFTFAAHSICCRRCPARILAVRDDVLLQRTHVRDWAPPGWHWEVLPSGARHLVRNPAPGPVVDPHLLWWRSRGPLSVRREPAPPEVVRRRVREEDEHVRRYMAAMDVRFSNTWQVLLGDHPSYDPVMVPSLWVSTARTSGTASGLDYSVVFDLY
Ga0256703_1135995313300023291Food WasteMPGPHPRRRPVRDDVLLQRTHVRDWAPPGWHWEVLPGGARRLVRNPASGPVVDPDLLWWRSRGPHSVQREPAPPEVVRHRVREEDEHVHRYMAAMDVRFSNTWQVLWADDRRYDPVMVPCLWVSTARAPGTASGLDSSIVFNLY
Ga0256702_1133584813300023300Food WasteMPGPHPRRRPVRDDVQPTHVRDWAPSGWHWEVLPGGARRLMRNPAPGPVVDPDLVWWHSRGPVSVRRDPAPPEVVRRRVREEDEHVHRYMVALEGGRFSNTWQYLRGSHFSYDPVRVPSL
Ga0256702_1203393713300023300Food WasteMPGPHPRRRPVRDDVRLTHVRAWAPPGWHWEVLPGGARRLMRNPAQGPVLDPDLVWWRSRGPVSVRRDPAPPEVVRRRVREEDEHVHRYMVALEGGRFSNTWQYLRGSHFSYDPVRVPSLWVSPAHAAGTASVLDSSVVFDL
Ga0256702_1209969823300023300Food WasteMPDPDPRRRPVRDDVLLQGTHVRDWAPPGWHWEVLPGGARRLVRNPTSGPVVDPDLLWWRSRGPHSVQRQPAPPEVVRRRVREEDEHVHRYMAAMDDVRFSTTWRVLWADDRRYDPVMVPSLWVCTARAPGTASGALDSSVVLDLY
Ga0208077_101474313300025427Arctic Peat SoilMRPHRRLGGNDQGLGSAGHVRDWAPPGWHWEVLPSGRRSLVRNQGPVVDPELIWWLSRGPRSVQREPAPEEVVRRRVREEDEHVRRYMVVLETRFSNTWQFLQGSHPSYDPVMVPSLWVFTTRGSGPESRRPV
Ga0224573_100092833300028019RootsMEHRNVRDWAPPGWHWEVLPSGARSLVRNPGPVVDPELVWWPARGPRPVQREPAPLEVVRRRIREEDEHVRRYLVALEVMTYRSWQYLPGPSAIFDPQPVPYLWVFTTRGPGPRPHH
Ga0224573_100908813300028019RootsMPDPHPRHRLGGDDQFERRHVRDWAPPGWHWEVPSSGTRSLVRNPGLVVDPELLWWRSSGPLSVQREPAPEEVVRHRVREEDEHVRRYMVALDVRFSNTWQFLQGSHPSYAPVMVPSLWVFTARGSGSASRRPV
Ga0256405_1032589613300028048RumenMPGPHPRRRPVRDDVQPTHVRDWAPPGWHWEVLPGGARRLMRNPAPGPVVDPDLVWWRSRGPVLVRRDPAPPEVVRRRVREEDEHVHRYMVALEGGRFSNTWQYLRGSHFSYDPVRVPSLWVSTARAAGTASVLDSSVVFDL
Ga0268300_100055333300028052PhyllosphereMPGPHPRYRRASGLLDGMRVLDWAPPGWHWEVVSGVRRLARNPGLVVDPDILWWRSRGPQSVRREPAPEEVVRRRIREEDDHVRRYMAALDDAGYYSLWQVLQGSHPSYEWVMVPSLWVSTASRSRRRLLF
Ga0268300_100581813300028052PhyllosphereSLVHINKILHTLNKFSATMPGPHPRRRRVGEHPFDRMGDVRDWAPPGWHWEVLSEARRLVRNPGPVVDPDLLWWRSHGPQAVRRQPAPEWIVRRRVREEDEHVRRYLEALGAGSCRTWQVLQGSHPSYEFVVVPSLWVITFRRTRRCLLY
Ga0268306_100463613300028054PhyllosphereMPGPHPRYRRASGLLDGMRVLDWAPPGWHWEVVSGVRRLVRNPGLVVDPDILWWRSRGPQSVRREPAPEEVVRRRIREEDDHVRRYMAALDDAGYYSLWQVLQGSHPSYEWVMVPSLWVSTASRSRRRLLF
Ga0268303_10233713300028147PhyllosphereMQLINKTLHILYKLSTTMPGPHPRYRRVREHPFDRMGDVRDWAPPGWHWEGASEARRLVRNPGPVVDPHILWWRSHGPHSVRRQPAPEWIVRRRVREEDEHVRRYLAALGAAGSCRTWRVLQGSHPSYEFVVVPSLWVATRRTRRCLLY
Ga0302338_105519213300028237FecesMPDPHPRRRLGGDDPFERRHVRDWAPPGWHWEVLPSGARNLVRNRGLVVDPELLWWQSRGPLAVQREPAPEEVVRRRVREEDEHVRRYMVALDDRFSNTWQFLQGSHPSYVPVMVPSLWVMTARGSGTGRRRPV
Ga0268325_10364013300028463PhyllosphereMPGQHPRHRLGGNNLLERRHVWDWALPGWHWEVLPSGAWSLVRNQSPVIDPEVLWWRSRGPLSVQREPAPAEVVRHRVREEDEHVRRYMAALDARFSNTWQVLQGSHPSYDPVIVPYLWVSTACTARRQLDLY
Ga0268302_10284213300028464PhyllosphereMPGPHPRRRRVGEHPFDRMGDVRDWAPPGWHWEVLSEARRLVRNPGPVVDPDLLWWRSHGPQAVRRQPAPEWIVRRRVREEDEHVRRYLEALGAGSCRTWQVLQGSHPSYEFVVVPSLWVITFRRTRR
Ga0268302_10473523300028464PhyllosphereFSLVHAINKTLHILYKFSTTMPGPHPRYRRVGEHPFDRMGDVRDWAPPGWHWEGASEARRLVRNPGPVVDPHILWWQSRGPQSVRRQPAPEWIVRRRVREEDEHVRRYLAALGAAGSCRTWRVLQGSHPSYEFVVVPSLWVATRLTRRCLLY
Ga0268301_10049213300028465PhyllosphereMQLINKTLHILYKFSTTMPGPHPRYRRVREHPFDRMGDVRDWAPPGWHWEGASEARRLVRNSDPVVDPHILWWRSHGPHSVRRQPAPEWIVRQRVREEDEHVRRYLAALGAAGSCRTWRVLQGSHPSYEFVVVPSLWVATRLTRRCLLY
Ga0307309_1002581113300028714SoilMPGPHPRRRLVRDDILLQRGNVRDWAPPGWHWEVLPSGARSLVRNPTPGPIVDPELLWWRSRGPLLVRRQPAPPEVVRRRVREEDEHVRRYMDALDVRFSNTWQVLQGSHPSYDPVMVPSLWVSTARASGTASELDSSIIFDLY
Ga0307310_1036133413300028824SoilLFSATMRPHRRLGGNDQGLGSAGHVRDWAPPGWHWEVLPSGRRSLVRNQGPVVDPELIWWRSRGPRSVQREPAPEEVVRRRVREEDEHVRRYMVALDVRFSNTWQFLQGSHPSYDPVMVPSLWVFTARGSGPESRRPV
Ga0307286_1022382413300028876SoilERRHVRDWAPPGWHWEVLPSGARSLVRNPGPVVDPELLWWRSRGPLSVRRQPAPPEVVRRRVREEDEHVRRYMDALYVRFSNTWQVLQGSHPSYDPVMVPSLWVSTARASGTASELDSSIIFDLY
Ga0307304_1026397723300028885SoilMPVPHPRCRLGGDNQLERRHVRDWAPPGWHWEVLPCGARSLVRNRGLVVDPELLWWRSRGPQSVQREPAPEDVVRRRVREEDEHVRRYMVALDDMFSNTWQFLQGSHPSYVPVMVPYLWVFTARGTCPRRPV
Ga0311022_1150061523300029799Anaerobic Digester DigestateMPGPHPRRRPVCDDVLLHRSHVRDWAPPGWHWEVLPRGARRLMRNPAPGPVGDPELVWWLSRGPVSVRREPAPPEEVRRRVRKEDEHVHRYMTAMDVRFSNTWQVLRGSHPSYDPVVVPSLWVSTARASGTASELDNLIVFDLY
Ga0311022_1202994613300029799Anaerobic Digester DigestateNDVLLTHVRDWAPPGWHWEVLPGGPRRLMRNPAPGPVVDPHLLWWHSCGPLSVRREPAPPEVVRRLVREEDEHVHRYMAAMDVRFSNTWQVLLGDHPSYDPVMVPSLWVSTARTSGTASGLDYSVVFDLY
Ga0311022_1249572113300029799Anaerobic Digester DigestateMPGPHPRRRPVRDDVQPTHVRDWAPPGWHWEVLPGGARRLMRNPAPGPVVDPDLVWWRSRGPVSVRRDPAPPEVVRRRVREEDEHVHRYMVALEGGRFSNTWQFLQGSHFSYDPVRVPSLWVSTARAAGTASVLDSSVVFDL
Ga0311022_1294180313300029799Anaerobic Digester DigestateMPGPHPRRRHVRDDVLLQRTHVRDWAPPGWHWEVLPSGARRLVRNPAPGPVVDPHLLWWHSRGPRSVRREPAPPEVVCRRVREEDEHVHRYMAAMDVRFSNTWQVLWGDHPSYDPVMVPS
Ga0265723_102882413300030872SoilMPDPHPCRRLGFDDQFERRHVRDWAPPGWHWEVLHSGARSLVRNPGPVVDPELVWWPARGPRPVQREPAPLEVVRRRIREEDEHVRRYLVALEVMTSRSWQYLPGPPGIFDPQPVPYLWVFTTRGPGPRPHH
Ga0073995_1223640813300031047SoilFSATMPDQHPRHRLDGTDRGLGSAGHVRDWAPPGWHWKVLPSGARSLVRNRGLVVDPELLWWRSRGPLSVQREPAPEEVVRRRVREEDEHVRRYMVALDVRFSNTWQFLQGSHPSYDPVMVPSLWVFTARGPGPESRRTV
Ga0307501_1016752313300031152SoilMPGPHPRRRLGGDDLLERRHVRDWAPPGWHWEVLPSGARSLVRNPGPVVDPELHWWRSRGPLSVWRQPATPEVVRRRVREEDEHVRRYMDALDVRFSNTWQVLQGSHPSYDPVMVPSLWVSTARASGTASELDSSIIFDLY
Ga0310686_10267537923300031708SoilMPDPHPRRRLGGDDQFERRHVRDWAPPGWHWEVPSSGTRSLVRNPGLVVDPELLWWRSRGPLSVQREPAPEEVVRRRVREEDEHVRRYMVALDVRFSNTWQFLQGSHPSYAPVMVPSLWVFTARGSGPASRRPV
Ga0310686_11292725713300031708SoilMPRPHHRLPARPTLLDQIEGHHVRDWAPPGWHWEVLPSGARSLVRNPGPVVDPELLWWRQDGPRAVQREPAPEQLVRRRVAEEDEHVRRYMVGMDVGFPNTWQFLPGPDLTYAPVSVPSGWVLTARGSRPASRRPV
Ga0314740_100005363300032822Switchgrass PhyllosphereMPGPHPGRRPVRDDVLLQRRHVRDWAPPGWHWEVLPSGARSLVRNRAPVVDPELLWWRARGPLSVRRQPAPPEVVRRRVREEDEHVRRYIDALHVRFSNTWQVLQGSHPSYDPVMVPSLWVSTARASGTASELDSSMIFDLY
Ga0364926_038080_2_4183300033812SedimentLFSATMRPHRRLGGNDHPLDSAGHVRDWAPPGWHWEVLPSGRRSLVRNQGPVVDPELIWWRSRGPGSVQREPAPEEVVRRRVREEDEHVRRYMVALDVRFSNTWQFLQGSHPSYDPVMVPSLWVFTARGSGPESRRPV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.