| Basic Information | |
|---|---|
| Family ID | F097858 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MSTRHEICAIERTAGNAGAAASLILGTLLLLIRP |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 77.67 % |
| % of genes near scaffold ends (potentially truncated) | 16.35 % |
| % of genes from short scaffolds (< 2000 bps) | 56.73 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.269 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (8.654 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.077 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.038 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.77% β-sheet: 0.00% Coil/Unstructured: 53.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00682 | HMGL-like | 38.46 |
| PF03976 | PPK2 | 18.27 |
| PF08502 | LeuA_dimer | 10.58 |
| PF04191 | PEMT | 6.73 |
| PF08543 | Phos_pyr_kin | 3.85 |
| PF03480 | DctP | 2.88 |
| PF00528 | BPD_transp_1 | 1.92 |
| PF13361 | UvrD_C | 0.96 |
| PF01745 | IPT | 0.96 |
| PF00005 | ABC_tran | 0.96 |
| PF03807 | F420_oxidored | 0.96 |
| PF06808 | DctM | 0.96 |
| PF04290 | DctQ | 0.96 |
| PF13379 | NMT1_2 | 0.96 |
| PF04069 | OpuAC | 0.96 |
| PF05231 | MASE1 | 0.96 |
| PF09084 | NMT1 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 18.27 |
| COG0119 | Isopropylmalate/homocitrate/citramalate synthases | Amino acid transport and metabolism [E] | 10.58 |
| COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 3.85 |
| COG0524 | Sugar or nucleoside kinase, ribokinase family | Carbohydrate transport and metabolism [G] | 3.85 |
| COG2240 | Pyridoxal/pyridoxine/pyridoxamine kinase | Coenzyme transport and metabolism [H] | 3.85 |
| COG2870 | ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase | Cell wall/membrane/envelope biogenesis [M] | 3.85 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.96 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.96 |
| COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 0.96 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.96 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.15 % |
| Unclassified | root | N/A | 28.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000042|ARSoilYngRDRAFT_c00939 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31 | 2147 | Open in IMG/M |
| 3300000891|JGI10214J12806_11367817 | Not Available | 544 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_100931533 | Not Available | 764 | Open in IMG/M |
| 3300001423|JGI20199J14953_1002572 | Not Available | 1760 | Open in IMG/M |
| 3300001430|JGI24032J14994_100750 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
| 3300001538|A10PFW1_10942846 | Not Available | 675 | Open in IMG/M |
| 3300001867|JGI12627J18819_10015847 | All Organisms → cellular organisms → Bacteria | 3028 | Open in IMG/M |
| 3300003998|Ga0055472_10148408 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 695 | Open in IMG/M |
| 3300005529|Ga0070741_10009779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 18437 | Open in IMG/M |
| 3300005543|Ga0070672_100000403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 24982 | Open in IMG/M |
| 3300005563|Ga0068855_100017362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 8658 | Open in IMG/M |
| 3300005563|Ga0068855_100035830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5909 | Open in IMG/M |
| 3300005563|Ga0068855_100196974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2269 | Open in IMG/M |
| 3300005564|Ga0070664_100083347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2758 | Open in IMG/M |
| 3300005564|Ga0070664_100217493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1709 | Open in IMG/M |
| 3300005578|Ga0068854_100377865 | Not Available | 1167 | Open in IMG/M |
| 3300005607|Ga0070740_10001947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 26131 | Open in IMG/M |
| 3300005713|Ga0066905_100003569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6160 | Open in IMG/M |
| 3300005713|Ga0066905_100378528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1141 | Open in IMG/M |
| 3300005764|Ga0066903_100229152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2830 | Open in IMG/M |
| 3300005764|Ga0066903_100645317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1849 | Open in IMG/M |
| 3300005833|Ga0074472_10280436 | Not Available | 1797 | Open in IMG/M |
| 3300005836|Ga0074470_11802617 | Not Available | 1254 | Open in IMG/M |
| 3300005844|Ga0068862_100305074 | Not Available | 1466 | Open in IMG/M |
| 3300005937|Ga0081455_10000185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 78750 | Open in IMG/M |
| 3300005938|Ga0066795_10112930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 808 | Open in IMG/M |
| 3300005938|Ga0066795_10117054 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300005947|Ga0066794_10007402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3035 | Open in IMG/M |
| 3300005947|Ga0066794_10064700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1087 | Open in IMG/M |
| 3300006055|Ga0097691_1009302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 4998 | Open in IMG/M |
| 3300006057|Ga0075026_100023707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2751 | Open in IMG/M |
| 3300006057|Ga0075026_100361013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 808 | Open in IMG/M |
| 3300006059|Ga0075017_100051240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2776 | Open in IMG/M |
| 3300006174|Ga0075014_100107274 | Not Available | 1311 | Open in IMG/M |
| 3300006175|Ga0070712_100206689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1546 | Open in IMG/M |
| 3300006177|Ga0075362_10556710 | Not Available | 590 | Open in IMG/M |
| 3300006358|Ga0068871_100005825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 8660 | Open in IMG/M |
| 3300006572|Ga0074051_10004003 | Not Available | 673 | Open in IMG/M |
| 3300006619|Ga0075529_1009154 | Not Available | 811 | Open in IMG/M |
| 3300006626|Ga0101570_10528698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 618 | Open in IMG/M |
| 3300006638|Ga0075522_10194038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1029 | Open in IMG/M |
| 3300006638|Ga0075522_10534321 | Not Available | 540 | Open in IMG/M |
| 3300006642|Ga0075521_10013730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3181 | Open in IMG/M |
| 3300006755|Ga0079222_11601644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 617 | Open in IMG/M |
| 3300006795|Ga0075520_1159254 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 980 | Open in IMG/M |
| 3300006806|Ga0079220_10146772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1295 | Open in IMG/M |
| 3300006949|Ga0075528_10027935 | Not Available | 1426 | Open in IMG/M |
| 3300009029|Ga0066793_10179172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1235 | Open in IMG/M |
| 3300009031|Ga0103682_10346481 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300009091|Ga0102851_10339571 | Not Available | 1487 | Open in IMG/M |
| 3300009148|Ga0105243_10039887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3664 | Open in IMG/M |
| 3300009545|Ga0105237_10060145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3801 | Open in IMG/M |
| 3300009551|Ga0105238_11906244 | Not Available | 627 | Open in IMG/M |
| 3300010043|Ga0126380_10031522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2685 | Open in IMG/M |
| 3300010043|Ga0126380_10058169 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2128 | Open in IMG/M |
| 3300010043|Ga0126380_10116901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1638 | Open in IMG/M |
| 3300010359|Ga0126376_12488163 | Not Available | 565 | Open in IMG/M |
| 3300010361|Ga0126378_10125408 | All Organisms → cellular organisms → Bacteria | 2579 | Open in IMG/M |
| 3300010366|Ga0126379_10032032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4122 | Open in IMG/M |
| 3300010373|Ga0134128_10015841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 8958 | Open in IMG/M |
| 3300010373|Ga0134128_10057015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4503 | Open in IMG/M |
| 3300010375|Ga0105239_10006578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 13462 | Open in IMG/M |
| 3300010396|Ga0134126_10425252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1540 | Open in IMG/M |
| 3300010398|Ga0126383_10075078 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2926 | Open in IMG/M |
| 3300011119|Ga0105246_10033664 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3408 | Open in IMG/M |
| 3300012212|Ga0150985_101904863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 719 | Open in IMG/M |
| 3300012469|Ga0150984_101452221 | Not Available | 520 | Open in IMG/M |
| 3300012495|Ga0157323_1021951 | Not Available | 615 | Open in IMG/M |
| 3300012899|Ga0157299_10145909 | Not Available | 663 | Open in IMG/M |
| 3300012931|Ga0153915_10156966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2470 | Open in IMG/M |
| 3300012958|Ga0164299_10030212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2346 | Open in IMG/M |
| 3300012961|Ga0164302_10000016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 36358 | Open in IMG/M |
| 3300012971|Ga0126369_10034764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4179 | Open in IMG/M |
| 3300012987|Ga0164307_10025634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3119 | Open in IMG/M |
| 3300014208|Ga0172379_10025962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 5897 | Open in IMG/M |
| 3300014303|Ga0075358_1019799 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300014325|Ga0163163_10035379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4844 | Open in IMG/M |
| 3300014838|Ga0182030_10007315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 23066 | Open in IMG/M |
| 3300015063|Ga0167649_100807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4444 | Open in IMG/M |
| 3300015190|Ga0167651_1047066 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 910 | Open in IMG/M |
| 3300017650|Ga0182736_1004613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 8543 | Open in IMG/M |
| 3300017966|Ga0187776_11040428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella | 604 | Open in IMG/M |
| 3300017994|Ga0187822_10232454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae | 627 | Open in IMG/M |
| 3300018064|Ga0187773_10141082 | Not Available | 1234 | Open in IMG/M |
| 3300021074|Ga0194044_10276314 | Not Available | 640 | Open in IMG/M |
| 3300021560|Ga0126371_10002455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 15960 | Open in IMG/M |
| 3300025914|Ga0207671_11349051 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR31 | 554 | Open in IMG/M |
| 3300025949|Ga0207667_10848675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 908 | Open in IMG/M |
| 3300026464|Ga0256814_1032361 | Not Available | 621 | Open in IMG/M |
| 3300026903|Ga0207462_1001390 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300027645|Ga0209117_1050235 | Not Available | 1237 | Open in IMG/M |
| 3300027706|Ga0209581_1009308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 6513 | Open in IMG/M |
| 3300027902|Ga0209048_10118047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2018 | Open in IMG/M |
| 3300028889|Ga0247827_10858455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 606 | Open in IMG/M |
| 3300029903|Ga0247271_132526 | Not Available | 507 | Open in IMG/M |
| 3300031247|Ga0265340_10401445 | Not Available | 605 | Open in IMG/M |
| 3300031711|Ga0265314_10365408 | Not Available | 790 | Open in IMG/M |
| 3300031820|Ga0307473_10238339 | Not Available | 1107 | Open in IMG/M |
| 3300031949|Ga0214473_10220692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2187 | Open in IMG/M |
| 3300032892|Ga0335081_10039702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 7484 | Open in IMG/M |
| 3300033004|Ga0335084_10244810 | Not Available | 1859 | Open in IMG/M |
| 3300033489|Ga0299912_10419583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1093 | Open in IMG/M |
| 3300033808|Ga0314867_174163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae | 507 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.65% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.77% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 3.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.88% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.88% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.92% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.96% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.96% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.96% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.96% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.96% |
| Groundwater | Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater | 0.96% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.96% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.96% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.96% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.96% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.96% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.96% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina - sample from Arabidopsis soil young | Host-Associated | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001423 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 | Environmental | Open in IMG/M |
| 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006619 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-4B | Environmental | Open in IMG/M |
| 3300006626 | Soil microbial communities from the Leymus chinensis steppe, China - after adding 17.5 g N m- 2, yr-1 | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006949 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009031 | Microbial communities from groundwater in Rifle, Colorado, USA - 3D_0.1um | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014208 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Groundwater well OW334 metaG | Environmental | Open in IMG/M |
| 3300014303 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015063 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3b, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015190 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300017650 | Enriched backyard soil microbial communities from Emeryville, California, USA - eDNA 5th pass 30_C Kraft BY (version 2) | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300021074 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-17m | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026464 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 CS5 | Environmental | Open in IMG/M |
| 3300026903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A1-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ARSoilYngRDRAFT_009392 | 3300000042 | Arabidopsis Rhizosphere | MSTRHDIRAIKRTAGNAGAAASFILGTLLLLIRP* |
| JGI10214J12806_113678172 | 3300000891 | Soil | MSTRHEICAIERTAENAGTAASLILGTLLLLIRP* |
| JGIcombinedJ13530_1009315331 | 3300001213 | Wetland | MSTRHNICAIERTADNAGSAAVLILGTLLLLIRP* |
| JGI20199J14953_10025722 | 3300001423 | Arctic Peat Soil | MSTRQTICAIERAAAKADPAATLILGTLLLLTRP* |
| JGI24032J14994_1007502 | 3300001430 | Corn, Switchgrass And Miscanthus Rhizosphere | RTTMSTRYDISATERTAGNAGAAASLILGTLLLLIRP* |
| A10PFW1_109428463 | 3300001538 | Permafrost | MSARQNICAIERAAGQDSHAGPVATLILGTLLLLI |
| JGI12627J18819_100158473 | 3300001867 | Forest Soil | MSTRHDICAIERTAGNAGSAATLILGTLLLLISP* |
| Ga0055472_101484081 | 3300003998 | Natural And Restored Wetlands | RRNEGDLRAMTTRRKISALARAASQAEPAATLILGSLLLLTRP* |
| Ga0070741_100097794 | 3300005529 | Surface Soil | MKGDLDAMTTRYQVCAIERTAATAGAAATLILGSLLLLTRP* |
| Ga0070672_10000040322 | 3300005543 | Miscanthus Rhizosphere | MSTRYDISATERTAGNAGAAASLILGTLLLLIRP* |
| Ga0068855_1000173622 | 3300005563 | Corn Rhizosphere | MSTRQTICAIERTAPRAGAAASLILGSLLLLICP* |
| Ga0068855_1000358302 | 3300005563 | Corn Rhizosphere | MSTRHDSCAIERTAPRAGAAASLILGSLLLLICP* |
| Ga0068855_1001969742 | 3300005563 | Corn Rhizosphere | MSTRHDICAIERTAPKAGAAATLILGSLLLLISP* |
| Ga0070664_1000833473 | 3300005564 | Corn Rhizosphere | MSTRHDIRAIERTAGNAGAAASLILGTLLLLIRP* |
| Ga0070664_1002174932 | 3300005564 | Corn Rhizosphere | MSTRHDIRAIKRTADNADTAASLILGTLLLLIRP* |
| Ga0068854_1003778652 | 3300005578 | Corn Rhizosphere | MSTRHDIRAVERTAGNAGAAASLILGTLLLLIRP* |
| Ga0070740_1000194720 | 3300005607 | Surface Soil | MKGDLDAMTTRYQVCAIERTAAMAGAAATLILGSLLLLTRP* |
| Ga0066905_1000035695 | 3300005713 | Tropical Forest Soil | MSTRWNIRAIGRTARRAGSTASLIQGTLLLLIRP* |
| Ga0066905_1003785282 | 3300005713 | Tropical Forest Soil | MSARHEICAIERTAGDAGAAASLILGTLLLLIRP* |
| Ga0066903_1002291523 | 3300005764 | Tropical Forest Soil | MSTRQSFCATKRTAAHAGSAASLILGTLLLLIRP* |
| Ga0066903_1006453172 | 3300005764 | Tropical Forest Soil | MSTRQIICANEWTAEHAGSAASLILATLLLLIRP* |
| Ga0074472_102804362 | 3300005833 | Sediment (Intertidal) | MSTRQTICAIERAAAKADPAATLILGTLLLLIRP* |
| Ga0074470_118026173 | 3300005836 | Sediment (Intertidal) | MTTRNHIGAIERAAATAAPAATLILGSLLLLIRP* |
| Ga0068862_1003050742 | 3300005844 | Switchgrass Rhizosphere | MSTRQIICATERTAGHAGSAASLILGTLLLLIRP* |
| Ga0081455_1000018523 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSARHEICAIERTAVDAGAAASLILGTLLLLIRP* |
| Ga0066795_101129302 | 3300005938 | Soil | MSARQNICAIERAAGKAEPAATLILGTLLLLIRP* |
| Ga0066795_101170541 | 3300005938 | Soil | MPTRQTICAIERAAGTAEPAATLILGTLLLLIRP* |
| Ga0066794_100074025 | 3300005947 | Soil | MSARQNICAIERAAGTAEPAATLILGTLLLLIRP* |
| Ga0066794_100647002 | 3300005947 | Soil | MSARQTICAIERAAGTAEPAATLILGTLLLLIRP* |
| Ga0075028_1006519012 | 3300006050 | Watersheds | MSTRQTICAIERTAGNAGSAAALILGSLLLLSAPEGRLG |
| Ga0097691_10093024 | 3300006055 | Arctic Peat Soil | MSTRQTICAIERAAGTAEPAATLILGTLLLLIRP* |
| Ga0075026_1000237074 | 3300006057 | Watersheds | MSTRRNIRAIGRTAGYAGSAGSLILGTLLLLIRP* |
| Ga0075026_1003610132 | 3300006057 | Watersheds | MSTRQTICAIERTAGNAGSAAALILGSLLLLIRP* |
| Ga0075017_1000512404 | 3300006059 | Watersheds | MTTRNATSALDRTAATAGSAATFILGSLLLLIRP* |
| Ga0075014_1001072741 | 3300006174 | Watersheds | MSARQNICAIERAAAKAEPAATLILGTLLLLIRP* |
| Ga0070712_1002066892 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTLQTICAIERTAPRAGAAASLILGTLLLLIRP* |
| Ga0075362_105567102 | 3300006177 | Populus Endosphere | MSTRHDISATERTAGNAGAAASLILGTLLLLIRP* |
| Ga0068871_1000058254 | 3300006358 | Miscanthus Rhizosphere | MSTRQIICATERTAGHAASAASLIPGTLLLLIRP* |
| Ga0074051_100040031 | 3300006572 | Soil | MSTRHEICAIERTAGNAGAAASLILGTLLLLIRP* |
| Ga0075529_10091542 | 3300006619 | Arctic Peat Soil | MSARQDICAIERAAGKAEPAATLILGTLLLLIRP* |
| Ga0101570_105286981 | 3300006626 | Soil | MSTRHDICAIERTAATAGSAATLILGSLLLLISP* |
| Ga0075522_101940382 | 3300006638 | Arctic Peat Soil | MSTRQTICAIGRAAGQAEPVASLILGSLLLLIRP* |
| Ga0075522_105343212 | 3300006638 | Arctic Peat Soil | MSTRHDICAIERTAATAGAAASLILGSLLLLISP* |
| Ga0075521_100137302 | 3300006642 | Arctic Peat Soil | MSARHKSSAIERAAGQAEPAATLILGTLLLLIRP* |
| Ga0079222_116016442 | 3300006755 | Agricultural Soil | MKQTMSARLQICAIEPAAKAVPAAALILGSLLLLSRP* |
| Ga0075520_11592542 | 3300006795 | Arctic Peat Soil | MSARQNICAIERAADTAEPAATLILGTLLLLIRP* |
| Ga0079220_101467722 | 3300006806 | Agricultural Soil | MSALQTNCAIERAAGETGAAASLILGTLLLLIRP* |
| Ga0075528_100279352 | 3300006949 | Arctic Peat Soil | MSTRQTICAIERAAGRAEPAATLILGTLLLLIRP* |
| Ga0066793_101791722 | 3300009029 | Prmafrost Soil | MPSRQTICAIEQAAGTAEPAATLILGTLLLLIRP* |
| Ga0103682_103464812 | 3300009031 | Groundwater | MSTRQTICAIERTAKQVGAAATLILGTLLLLIRP* |
| Ga0102851_103395711 | 3300009091 | Freshwater Wetlands | MSARQNICAIERAATKAEPAAILILGTLLLLIRP* |
| Ga0105243_100398875 | 3300009148 | Miscanthus Rhizosphere | MSTRQIICATERTAGHAGAAASLILGTLLLLIRP* |
| Ga0105237_100601454 | 3300009545 | Corn Rhizosphere | MSTRYDISATERTAGNAGAAASLILGSLLLLIRP* |
| Ga0105238_119062442 | 3300009551 | Corn Rhizosphere | MSTLQTNCAIEPAAAKAMPAATLILGTLLLLIRP* |
| Ga0126380_100315221 | 3300010043 | Tropical Forest Soil | MSTRPNFCAIERTVGSAGSATSLILGTLLLLIRP* |
| Ga0126380_100581694 | 3300010043 | Tropical Forest Soil | MSTRRNIRAIGRTAANAGSAASLILGTLLLLIRP* |
| Ga0126380_101169011 | 3300010043 | Tropical Forest Soil | MAMSTRQTICATEWTAGYAGSAESLILGTLLLLIRP* |
| Ga0126376_124881632 | 3300010359 | Tropical Forest Soil | MTTRYNIRAIGRAAGKADPAATLILGTLLLLIRP* |
| Ga0126378_101254083 | 3300010361 | Tropical Forest Soil | TMSTRHEIRAIEQTASNAGAAASLILGTLLLLIRP* |
| Ga0126379_100320326 | 3300010366 | Tropical Forest Soil | MSTRRNIRAIGRTAGYAGSAASLILGTLLLLIRP* |
| Ga0134128_100158416 | 3300010373 | Terrestrial Soil | MSMLQIDCAIERTAGNAGTAASLILGTLLLLIRP* |
| Ga0134128_100570154 | 3300010373 | Terrestrial Soil | MSTRQTICATERTAGHAASAASLILGTLLLLIRP* |
| Ga0105239_100065781 | 3300010375 | Corn Rhizosphere | MFTRYDISATERTAGNAGAAASLILGTLLLLIRP* |
| Ga0134126_104252522 | 3300010396 | Terrestrial Soil | MSTRRDISATERTAGNAGAAASLILGTLLLLIRP* |
| Ga0126383_100750782 | 3300010398 | Tropical Forest Soil | MTTRQDIRAIGRAAGKADPAATLILGTLLLLIRP* |
| Ga0105246_100336645 | 3300011119 | Miscanthus Rhizosphere | MSTRQIICATERTAGHAASAASLIQGTLLLLIRP* |
| Ga0150985_1019048633 | 3300012212 | Avena Fatua Rhizosphere | MKADEMTTRLQICAIDRTAKAASAAALILGSLLLLTRP* |
| Ga0150984_1014522211 | 3300012469 | Avena Fatua Rhizosphere | RGMKADEMTTRLQICAIDRTAKAASAATLILGSLLLLMRP* |
| Ga0157323_10219511 | 3300012495 | Arabidopsis Rhizosphere | TDEMREHSMSTRRNIRAIGRTAGYAGSAASLILGTLLLLIRP* |
| Ga0157299_101459092 | 3300012899 | Soil | MSTRHDIRAIKRTADNAGTAASLILGTLLLLIRP* |
| Ga0153915_101569664 | 3300012931 | Freshwater Wetlands | MSARHKSSAIERAAGSAEPAATLILGTLLLLIRP* |
| Ga0164299_100302123 | 3300012958 | Soil | MSTRQSICAIERTAGRAGSVATLILGSLLLLIRP* |
| Ga0164302_1000001644 | 3300012961 | Soil | MSTRYDISATERTAGNAGAADSLILGTLLLLIRP* |
| Ga0126369_100347641 | 3300012971 | Tropical Forest Soil | MSTRQSFCATKRTAVHAGSAASLILGTLLLLIRP* |
| Ga0164307_100256342 | 3300012987 | Soil | MSTRQIICATERTAGHAASAASLILGTLLLLIRP* |
| Ga0172379_100259627 | 3300014208 | Groundwater | MPTRQTNCAIERAATKAGPVASLILGTLLLLTRP* |
| Ga0075358_10197992 | 3300014303 | Natural And Restored Wetlands | FLPMSTLQTNCAIEPVATKAMPAATLILGTLLLLIRP* |
| Ga0163163_100353792 | 3300014325 | Switchgrass Rhizosphere | MSTRHDIRAIKRTADNADTAASLILGTLLLLMRP* |
| Ga0182030_100073157 | 3300014838 | Bog | MSTRQTICAIGPAAIRPLPVASLILGTLLLLIRP* |
| Ga0167649_1008071 | 3300015063 | Glacier Forefield Soil | MSARQTICAIERTAAMAGSDAFLILGSLLLLIRP* |
| Ga0167651_10470662 | 3300015190 | Glacier Forefield Soil | MSTRQTICAIGRAAAKADPVASLILGTLLLLIRP* |
| Ga0182736_10046133 | 3300017650 | Soil | MSTQQTTCAIERAAATSVAPAPAANLILGTLLLLIRP |
| Ga0187776_110404281 | 3300017966 | Tropical Peatland | MMGRAMSALQTNCAIERTAGYAGAAASLILGTLLLLIRP |
| Ga0187822_102324541 | 3300017994 | Freshwater Sediment | MKGRAMSALQTNCAIERAAGETGAAASLILGTLLLLIRP |
| Ga0187773_101410821 | 3300018064 | Tropical Peatland | EGYSKAMSTRPNICAIERTAGHADSVASLILGLLLLIRP |
| Ga0194044_102763141 | 3300021074 | Anoxic Zone Freshwater | MSTLQTICTIEPAAARSMALAGPAATLILGTLLLL |
| Ga0126371_100024559 | 3300021560 | Tropical Forest Soil | MAMSTRQTICATEWTAGYAGSAESLILGTLLLLIRP |
| Ga0207671_113490512 | 3300025914 | Corn Rhizosphere | QESMSALQTNCAIERKAGNAGAAASLILGTLLLLIRP |
| Ga0207667_108486751 | 3300025949 | Corn Rhizosphere | MKGDLRAMTTRHQICAIERTAAKFHGLAGSAATLILGSLLLL |
| Ga0256814_10323611 | 3300026464 | Sediment | PGTMSTRYDIRVLKQTADNAGTAASLILGMLLLLIRP |
| Ga0207462_10013901 | 3300026903 | Soil | TMSTRYDISATERTAGNAGAAASLILGTLLLLIRP |
| Ga0209117_10502351 | 3300027645 | Forest Soil | MSTRQINCAIGRAAGQDSQAGLAATLILGTLLLLIRP |
| Ga0209581_10093085 | 3300027706 | Surface Soil | MKGDLDAMTTRYQVCAIERTAAMAGAAATLILGSLLLLTRP |
| Ga0209048_101180472 | 3300027902 | Freshwater Lake Sediment | MSTRQTNCAIARAAGQDSQAGLAATLILGTLLLLLLIRP |
| Ga0247827_108584552 | 3300028889 | Soil | QRTTMSTRYDISATERTAGNAGAAASLILGTLLLLIRP |
| Ga0247271_1325262 | 3300029903 | Soil | AMSTRQTICAIGPAAAGPAPVVSVILGTLLLLIRP |
| Ga0265340_104014452 | 3300031247 | Rhizosphere | MSMLQTNCTIERAAAKSMALAEPAATSILGTLLLLIRP |
| Ga0265314_103654081 | 3300031711 | Rhizosphere | MSMLQTNCTIERAAAKSMALADAAATPILGTLLLLTRP |
| Ga0307473_102383391 | 3300031820 | Hardwood Forest Soil | LKAMSTRTNICAIERTAGHAGAAATLILGSLLLLIRP |
| Ga0214473_102206922 | 3300031949 | Soil | MSARHTICAIEPAAAKFNLVADPAATLILGTLLLLIRP |
| Ga0335081_100397024 | 3300032892 | Soil | MTTRQDIRAIERTAAKFHGLAGSAATLILGSLLLLICP |
| Ga0335084_102448101 | 3300033004 | Soil | DEGHSKAMSTRQTICAIERTAGYAGSAAALILGSLLLLIRP |
| Ga0299912_104195832 | 3300033489 | Soil | MSARHIIRAIEPAAAKADGIGTPMATLILGTLLLLIRP |
| Ga0314867_174163_339_470 | 3300033808 | Peatland | VNYEGDLKAMTTRRDICAIERTATTAGAAASLVLGSLLLLIRP |
| ⦗Top⦘ |