| Basic Information | |
|---|---|
| Family ID | F097616 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MNGPLLISLLPPERIWDSAAAISGSTPFIAILLLIGFLLSLFLRHPGR |
| Number of Associated Samples | 70 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 17.31 % |
| % of genes near scaffold ends (potentially truncated) | 46.15 % |
| % of genes from short scaffolds (< 2000 bps) | 75.96 % |
| Associated GOLD sequencing projects | 63 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (19.231 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.154 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (40.385 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF06803 | DUF1232 | 3.85 |
| PF08238 | Sel1 | 2.88 |
| PF00571 | CBS | 1.92 |
| PF00107 | ADH_zinc_N | 1.92 |
| PF13620 | CarboxypepD_reg | 1.92 |
| PF01061 | ABC2_membrane | 1.92 |
| PF08240 | ADH_N | 1.92 |
| PF07690 | MFS_1 | 1.92 |
| PF01161 | PBP | 0.96 |
| PF08734 | GYD | 0.96 |
| PF01135 | PCMT | 0.96 |
| PF01381 | HTH_3 | 0.96 |
| PF01894 | UPF0047 | 0.96 |
| PF02225 | PA | 0.96 |
| PF07589 | PEP-CTERM | 0.96 |
| PF02321 | OEP | 0.96 |
| PF12002 | MgsA_C | 0.96 |
| PF16116 | DUF4832 | 0.96 |
| PF02518 | HATPase_c | 0.96 |
| PF16561 | AMPK1_CBM | 0.96 |
| PF05973 | Gp49 | 0.96 |
| PF03916 | NrfD | 0.96 |
| PF02142 | MGS | 0.96 |
| PF04389 | Peptidase_M28 | 0.96 |
| PF02586 | SRAP | 0.96 |
| PF04773 | FecR | 0.96 |
| PF01609 | DDE_Tnp_1 | 0.96 |
| PF14539 | DUF4442 | 0.96 |
| PF13578 | Methyltransf_24 | 0.96 |
| PF13474 | SnoaL_3 | 0.96 |
| PF00293 | NUDIX | 0.96 |
| PF13635 | DUF4143 | 0.96 |
| PF13418 | Kelch_4 | 0.96 |
| PF00891 | Methyltransf_2 | 0.96 |
| PF00294 | PfkB | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG3339 | Uncharacterized membrane protein YkvA, DUF1232 family | Function unknown [S] | 3.85 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.96 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.96 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.96 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.96 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.96 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.96 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.96 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.96 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.96 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.96 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.46 % |
| Unclassified | root | N/A | 36.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003994|Ga0055435_10100636 | Not Available | 763 | Open in IMG/M |
| 3300003994|Ga0055435_10209433 | Not Available | 564 | Open in IMG/M |
| 3300004009|Ga0055437_10053158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria) | 1091 | Open in IMG/M |
| 3300004012|Ga0055464_10030480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1357 | Open in IMG/M |
| 3300004050|Ga0055491_10034808 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300004778|Ga0062383_10029017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2037 | Open in IMG/M |
| 3300004779|Ga0062380_10209585 | Not Available | 791 | Open in IMG/M |
| 3300004781|Ga0062379_10020337 | Not Available | 1138 | Open in IMG/M |
| 3300005830|Ga0074473_10150863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium 37-65-8 | 872 | Open in IMG/M |
| 3300005832|Ga0074469_11261282 | Not Available | 587 | Open in IMG/M |
| 3300005833|Ga0074472_10564658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4293 | Open in IMG/M |
| 3300005833|Ga0074472_11493854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1949 | Open in IMG/M |
| 3300005889|Ga0075290_1023440 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300006224|Ga0079037_100064662 | All Organisms → cellular organisms → Bacteria | 2932 | Open in IMG/M |
| 3300006224|Ga0079037_100110551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2331 | Open in IMG/M |
| 3300006224|Ga0079037_100233509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1672 | Open in IMG/M |
| 3300006224|Ga0079037_100453084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1224 | Open in IMG/M |
| 3300006224|Ga0079037_101046764 | Not Available | 808 | Open in IMG/M |
| 3300006224|Ga0079037_101494836 | Not Available | 674 | Open in IMG/M |
| 3300006224|Ga0079037_102186217 | Not Available | 553 | Open in IMG/M |
| 3300006930|Ga0079303_10210116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300007351|Ga0104751_1002421 | All Organisms → cellular organisms → Bacteria | 28993 | Open in IMG/M |
| 3300009091|Ga0102851_10401263 | Not Available | 1380 | Open in IMG/M |
| 3300009111|Ga0115026_10036974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2581 | Open in IMG/M |
| 3300009111|Ga0115026_10181028 | Not Available | 1389 | Open in IMG/M |
| 3300009111|Ga0115026_10865263 | Not Available | 712 | Open in IMG/M |
| 3300009167|Ga0113563_11314757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria) | 846 | Open in IMG/M |
| 3300009296|Ga0103681_1012428 | All Organisms → cellular organisms → Bacteria | 4901 | Open in IMG/M |
| 3300009538|Ga0129287_10008293 | All Organisms → cellular organisms → Bacteria | 5065 | Open in IMG/M |
| 3300009868|Ga0130016_10304730 | All Organisms → cellular organisms → Bacteria | 1881 | Open in IMG/M |
| 3300011264|Ga0151623_1418393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1633 | Open in IMG/M |
| 3300011407|Ga0137450_1105911 | Not Available | 550 | Open in IMG/M |
| 3300012152|Ga0137347_1031108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae | 837 | Open in IMG/M |
| 3300012673|Ga0137339_1003242 | Not Available | 1179 | Open in IMG/M |
| 3300012931|Ga0153915_10006029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 11326 | Open in IMG/M |
| 3300012931|Ga0153915_10094189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3166 | Open in IMG/M |
| 3300012931|Ga0153915_11429881 | Not Available | 808 | Open in IMG/M |
| 3300012931|Ga0153915_12995855 | Not Available | 550 | Open in IMG/M |
| 3300012964|Ga0153916_11424050 | Not Available | 769 | Open in IMG/M |
| 3300014305|Ga0075349_1040429 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300018055|Ga0184616_10130765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 917 | Open in IMG/M |
| 3300021081|Ga0210379_10422193 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300024056|Ga0124853_1168607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium 21-66-5 | 2380 | Open in IMG/M |
| 3300025034|Ga0210041_1074640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1477 | Open in IMG/M |
| 3300025318|Ga0209519_10015461 | All Organisms → cellular organisms → Bacteria | 3942 | Open in IMG/M |
| 3300025551|Ga0210131_1096293 | Not Available | 514 | Open in IMG/M |
| 3300025790|Ga0210075_1010287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1508 | Open in IMG/M |
| 3300025891|Ga0209585_10146995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 909 | Open in IMG/M |
| 3300025950|Ga0210134_1025836 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300025966|Ga0210105_1026180 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300025968|Ga0210103_1008774 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
| 3300026030|Ga0208908_1005069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1182 | Open in IMG/M |
| 3300026048|Ga0208915_1015294 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300026535|Ga0256867_10074538 | Not Available | 1336 | Open in IMG/M |
| 3300027657|Ga0256865_1002203 | All Organisms → cellular organisms → Bacteria | 6094 | Open in IMG/M |
| 3300027716|Ga0209682_10106796 | Not Available | 708 | Open in IMG/M |
| 3300027843|Ga0209798_10162221 | All Organisms → Viruses → Predicted Viral | 1116 | Open in IMG/M |
| 3300027843|Ga0209798_10182537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_64_85 | 1041 | Open in IMG/M |
| 3300027871|Ga0209397_10375764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300027877|Ga0209293_10014847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2636 | Open in IMG/M |
| 3300027877|Ga0209293_10584600 | Not Available | 589 | Open in IMG/M |
| 3300028032|Ga0265296_1187818 | All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium CG22_combo_CG10-13_8_21_14_all_63_91 | 726 | Open in IMG/M |
| 3300031746|Ga0315293_10380196 | Not Available | 1115 | Open in IMG/M |
| 3300031772|Ga0315288_10197177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2191 | Open in IMG/M |
| 3300031834|Ga0315290_11365747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus → unclassified Deinococcus → Deinococcus sp. TS-293 | 581 | Open in IMG/M |
| 3300031949|Ga0214473_10042844 | All Organisms → cellular organisms → Bacteria | 5306 | Open in IMG/M |
| 3300031949|Ga0214473_10228167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2147 | Open in IMG/M |
| 3300031949|Ga0214473_11074578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 844 | Open in IMG/M |
| 3300031949|Ga0214473_12397624 | Not Available | 503 | Open in IMG/M |
| 3300031965|Ga0326597_10010459 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12359 | Open in IMG/M |
| 3300031965|Ga0326597_11010150 | Not Available | 839 | Open in IMG/M |
| 3300031997|Ga0315278_10108483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 2805 | Open in IMG/M |
| 3300031997|Ga0315278_10198089 | Not Available | 2066 | Open in IMG/M |
| 3300031997|Ga0315278_10215906 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1975 | Open in IMG/M |
| 3300031997|Ga0315278_10628083 | Not Available | 1097 | Open in IMG/M |
| 3300031997|Ga0315278_11274440 | Not Available | 717 | Open in IMG/M |
| 3300031997|Ga0315278_11512591 | Not Available | 645 | Open in IMG/M |
| 3300032163|Ga0315281_12154278 | Not Available | 529 | Open in IMG/M |
| 3300032164|Ga0315283_12048151 | Not Available | 568 | Open in IMG/M |
| 3300032177|Ga0315276_10304801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1693 | Open in IMG/M |
| 3300032342|Ga0315286_11298618 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300032397|Ga0315287_11225016 | Not Available | 863 | Open in IMG/M |
| 3300032401|Ga0315275_10432164 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. CG24A | 1476 | Open in IMG/M |
| 3300032401|Ga0315275_11276553 | Not Available | 796 | Open in IMG/M |
| 3300032516|Ga0315273_10207135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium CG_4_9_14_3_um_filter_65_9 | 2681 | Open in IMG/M |
| 3300032516|Ga0315273_10305156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2160 | Open in IMG/M |
| 3300032516|Ga0315273_12139397 | Not Available | 659 | Open in IMG/M |
| 3300033233|Ga0334722_10138625 | All Organisms → cellular organisms → Bacteria | 1827 | Open in IMG/M |
| 3300033408|Ga0316605_11157656 | Not Available | 746 | Open in IMG/M |
| 3300033413|Ga0316603_10058020 | All Organisms → cellular organisms → Bacteria | 2867 | Open in IMG/M |
| 3300033413|Ga0316603_10511822 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300033413|Ga0316603_10525935 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300033413|Ga0316603_10658241 | Not Available | 976 | Open in IMG/M |
| 3300033413|Ga0316603_11093755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria) | 754 | Open in IMG/M |
| 3300033414|Ga0316619_10032916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2691 | Open in IMG/M |
| 3300033419|Ga0316601_100068339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2728 | Open in IMG/M |
| 3300033419|Ga0316601_100867480 | Not Available | 895 | Open in IMG/M |
| 3300033480|Ga0316620_10397390 | Not Available | 1244 | Open in IMG/M |
| 3300033481|Ga0316600_10102739 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
| 3300033485|Ga0316626_11017741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 735 | Open in IMG/M |
| 3300033485|Ga0316626_11923136 | Not Available | 535 | Open in IMG/M |
| 3300033521|Ga0316616_101231030 | Not Available | 953 | Open in IMG/M |
| 3300033521|Ga0316616_104523544 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium RBG_19FT_COMBO_58_17 | 523 | Open in IMG/M |
| 3300033814|Ga0364930_0038905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1613 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 19.23% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 14.42% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 9.62% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 9.62% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 5.77% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 5.77% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 4.81% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 3.85% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.88% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.88% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.96% |
| Groundwater | Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater | 0.96% |
| Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 0.96% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.96% |
| Sediment | Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Sediment | 0.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Beach Aquifer Porewater | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.96% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.96% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.96% |
| Deep Subsurface Aquifer | Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Deep Subsurface Aquifer | 0.96% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.96% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004012 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004050 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300004781 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300007351 | Combined Assembly of Gp0115775, Gp0115815 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009296 | Microbial communities from groundwater in Rifle, Colorado, USA-3A_0.2um | Environmental | Open in IMG/M |
| 3300009538 | Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2W | Environmental | Open in IMG/M |
| 3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
| 3300011264 | Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer 63 | Environmental | Open in IMG/M |
| 3300011407 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT454_2 | Environmental | Open in IMG/M |
| 3300012152 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT590_2 | Environmental | Open in IMG/M |
| 3300012673 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT399_2 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300014305 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025034 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-03 (SPAdes) | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025790 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300025950 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025966 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025968 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026030 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1_rd (SPAdes) | Environmental | Open in IMG/M |
| 3300026048 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027657 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 HiSeq | Environmental | Open in IMG/M |
| 3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028032 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0055435_101006362 | 3300003994 | Natural And Restored Wetlands | MNGPLLFSILPPERIWDSSTAISDYTPFVAILLLIGFLLSLFLRQPGR* |
| Ga0055435_102094331 | 3300003994 | Natural And Restored Wetlands | PMNGPLLITLLPPEKLLDSTGAIPVYEPSIALLLLIGFLLSLFLRHPRR* |
| Ga0055437_100531581 | 3300004009 | Natural And Restored Wetlands | MNGPLLITLLPPEKLLDSTGAIPVYEPSIALLLLIGFLLSLFLRHPRR* |
| Ga0055464_100304802 | 3300004012 | Natural And Restored Wetlands | GPLLISLLPPEQTWDSPVAISGHTSFVAILLLIGFLLSLLLRHPGH* |
| Ga0055491_100348081 | 3300004050 | Natural And Restored Wetlands | NKPLLISLLPPEQTWDFAVAIPSYTPFLAILLLIGFLLSHLLRHPGR* |
| Ga0062383_100290172 | 3300004778 | Wetland Sediment | MNGPLLISLLPPEKLLDATGTVPVYEPFIVVLLLIGFLLSLFLRHPRG* |
| Ga0062380_102095852 | 3300004779 | Wetland Sediment | MNGPLLIGLLPPEKLLDSTGAALVYEPFIAVLLLIGFLLSLFLRHPRR* |
| Ga0062379_100203371 | 3300004781 | Wetland Sediment | MNGPLLISLLPPEQTWNFADAVPSYTPFVAILLLIGFLLSLFLRHPGR* |
| Ga0074473_101508632 | 3300005830 | Sediment (Intertidal) | MNGPLLISLLPPDQTWNFADAVPGYLPFVAILLLIGFLLSILLRQPDRS* |
| Ga0074469_112612823 | 3300005832 | Sediment (Intertidal) | MNGPLLISLLPPEQTWDSPVAISGHTSFVAILLLIGFLLSLLLRHPGH* |
| Ga0074472_105646586 | 3300005833 | Sediment (Intertidal) | MNGPLLVSLLPPEKLLDSTGAVPVYEPSIAVLLLIGFLLSLLLRHPGRG* |
| Ga0074472_114938544 | 3300005833 | Sediment (Intertidal) | MYGPLLISLLPPERTLDSAAAVSGAAPLVAILLLIGLLLSLWLRPPER* |
| Ga0075290_10234402 | 3300005889 | Rice Paddy Soil | VNGPLLISLLPPERAWDSAVAVSDAAPIIFLLLLAGFLLSLFLRRPER* |
| Ga0079037_1000646622 | 3300006224 | Freshwater Wetlands | MNGPLLITLLPPERVWDSATTISDYTPFVAILLLIGFLMSLFLRRPGR* |
| Ga0079037_1001105512 | 3300006224 | Freshwater Wetlands | MNGPLLISLLPPEKFLDSTGATPVYEPFIAVLLLIGFLLSLLLRHPGR* |
| Ga0079037_1002335093 | 3300006224 | Freshwater Wetlands | MNGPLLISLLPPERILDSSTAFSDYTPFVAILLLIGFLLSLFLRQPGVDRNSA |
| Ga0079037_1004530842 | 3300006224 | Freshwater Wetlands | MNGPLLISLLPPERVWDSASAVSGSTPYIAVFLLIGFLLSLLLRHPER* |
| Ga0079037_1010467641 | 3300006224 | Freshwater Wetlands | MNGPLLISLLPPERIWDSATDISDSTPFVAILLLIGFLLSLLLRHPGR* |
| Ga0079037_1014948362 | 3300006224 | Freshwater Wetlands | MNGPLLISLLPPERIWDSAAAISDPTPFVAVFLLIGYLLSLLLRHPGR* |
| Ga0079037_1021862171 | 3300006224 | Freshwater Wetlands | MNGPLLVSLLPPERTWDSATATSDSTPYIAILLLIGFLLSLLLRHPSR* |
| Ga0079303_102101162 | 3300006930 | Deep Subsurface | MNGPLLIDLLPPEKLLDPTGVVPVSAPFIAVLLLIGFLLSLMLRPP |
| Ga0104751_100242127 | 3300007351 | Deep Subsurface Aquifer | MNGPLLISLLPPERSLESAAAVAGSPIVVAVLLLAGLFLSLVLRRP* |
| Ga0102851_104012632 | 3300009091 | Freshwater Wetlands | MNGPLLISLLPPERIWDSSTAISDSTPIIAIFLLIGFLLSLVLRHPG* |
| Ga0115026_100369743 | 3300009111 | Wetland | MNGPLLISLLPPEKLLDSTGTVPITEPFIAILLLIGFLLSLVLRHPER* |
| Ga0115026_101810282 | 3300009111 | Wetland | MNGPLLISLLPPERILDSSTAFSDYTPFVAILLLIGFLLSLFLRQPGR* |
| Ga0115026_108652631 | 3300009111 | Wetland | MNGPLLISLLPPERVWDSATATSDSTPFVATLLLIGFLLSLLLRQTGR* |
| Ga0113563_113147572 | 3300009167 | Freshwater Wetlands | MNGPILVSLLPPERIWDSAAATSDSTPFVAVFLLIGYLLSLTLLSADCP |
| Ga0103681_10124286 | 3300009296 | Groundwater | MNAPLLVSLLPPEWPAGSEAAVSASAPFVAILLLAGLLLSLVLRHPGR* |
| Ga0129287_100082936 | 3300009538 | Beach Aquifer Porewater | MNGPLLVSLLPLERMWDTTAVVSGFVPFVAILLLIGFLLSLFLRHPGR* |
| Ga0130016_103047302 | 3300009868 | Wastewater | MNGPLLIQLLPPERIWDLTGAVPDAAPSIAILLLAGFLLSFLLRHPGG* |
| Ga0151623_14183931 | 3300011264 | Sediment | MNGPLLISMLPPETLTDAAGAVPPYDPFIAVLLLAGLLLSLLLRPSGR* |
| Ga0137450_11059112 | 3300011407 | Soil | MNGPLLISLLPPDRSWDSAPAISGSAPFIAILLLIGILLSLFLRHPER* |
| Ga0137347_10311082 | 3300012152 | Soil | MNGPLLISLLPPEWSWDSAAAISGSPPFIAILLLIGFLLSLFLR |
| Ga0137339_10032422 | 3300012673 | Soil | MNGPLLISLLPPDRSWDSAPAISGSAPFIAILLLIGILLSLFLRHPDR* |
| Ga0153915_100060292 | 3300012931 | Freshwater Wetlands | MQALYGPLLISLLPPEGSWDSAPAISSATPFIAILLLIGLLLSLLLRHPRG* |
| Ga0153915_100941893 | 3300012931 | Freshwater Wetlands | MNGPLLISLLPPEQTWDSTATVSGFMPFIAILLLIGLLLSLYLRHPER* |
| Ga0153915_114298812 | 3300012931 | Freshwater Wetlands | MYGPLLVSLLPPEKLLDATGMLPVYEPFIAVLLLIGFLLSLFLLHPGR* |
| Ga0153915_129958551 | 3300012931 | Freshwater Wetlands | MNGPLLISLLPPERIWDSSTAISDSTPIIAIILLIGFLLSLVLRHPG* |
| Ga0153916_114240502 | 3300012964 | Freshwater Wetlands | LPPEKLLDATGTLPVYEPFIAVLLLIGFLLSLFLLHPGR* |
| Ga0075349_10404291 | 3300014305 | Natural And Restored Wetlands | MNGPLLVSLLPQEQTWEYAAAIPGYTPFVAILLLIGFLLSILLIQPDRS* |
| Ga0184616_101307651 | 3300018055 | Groundwater Sediment | MNGPLLISLLPPERIWESAVANSGFTPFVAILLLIGFLLSLFLRHPGRG |
| Ga0210379_104221931 | 3300021081 | Groundwater Sediment | MNGPLLISLLPPERIWDSAAAISGSTPFIAILLLIGFLLSLFLRHPGR |
| Ga0124853_11686073 | 3300024056 | Freshwater Wetlands | MNGPLLISLLPPEGNLDSIAAISDSTPFVAILLLIGFLLSLFLRHPER |
| Ga0210041_10746401 | 3300025034 | Aquifer | LVSLLPPEHAWDSAAATSGSTSFIAILLLVGFLLSLLLRHPGR |
| Ga0209519_100154615 | 3300025318 | Soil | MNGPLLVSLLPPEHAWDSAMSIPGSTPLVAILLLIGFLLILFLRHPRR |
| Ga0210131_10962931 | 3300025551 | Natural And Restored Wetlands | MNGPLLTSLLPPERIWDTVTATSDSTPFVAILLLIGFLLSLLLRH |
| Ga0210075_10102871 | 3300025790 | Natural And Restored Wetlands | PLLISLLPPEQTWDSPVAISGHTSFVAILLLIGFLLSLLLRHPGH |
| Ga0209585_101469951 | 3300025891 | Arctic Peat Soil | PLLISLLPPEQTWDSAAATSGSTPFVAILLLIGFLLSLFLRHPGR |
| Ga0210134_10258361 | 3300025950 | Natural And Restored Wetlands | LVSLLPQEQTWEYAAAIPGYTPFVAILLLIGFLLSILLIQPDRS |
| Ga0210105_10261802 | 3300025966 | Natural And Restored Wetlands | SLLPQEQTWEYAAAIPGYTPFVAILLLIGFLLSILLIQPDRS |
| Ga0210103_10087741 | 3300025968 | Natural And Restored Wetlands | MNGPLLVSLLPQEQTWEYAAAIPGYTPFVAILLLIGFLLSILLIQPDRS |
| Ga0208908_10050691 | 3300026030 | Natural And Restored Wetlands | DSMNGPLLISLLPPEQTWDSPVAISGHTSFVAILLLIGFLLSLLLRHPGH |
| Ga0208915_10152942 | 3300026048 | Natural And Restored Wetlands | MNGPLLISLLPPEKLLDSTGAVPVYDPFIAVLLLIGF |
| Ga0256867_100745382 | 3300026535 | Soil | MNGPLLVSLLPPERIGDSASAISGTTPFVAILLLIGFLLSLFLRHPER |
| Ga0256865_10022033 | 3300027657 | Soil | MNGPLLVSLLPPERSWEYASSLSDSTPFVAVLLLIGFLLSLFLRHPER |
| Ga0209682_101067961 | 3300027716 | Wetland Sediment | MNGPLLISLLPPEKLLDATGTVPVYEPFIVVLLLIGFLLSLFLRHPRG |
| Ga0209798_101622213 | 3300027843 | Wetland Sediment | PEKLLDSTGAVPVYEPFIVVLLLIGFLLSLFLRHPGR |
| Ga0209798_101825371 | 3300027843 | Wetland Sediment | MNGPLLISLLPPEKLLDSTGAAPVYAPFIAVLLLIGFFL |
| Ga0209397_103757642 | 3300027871 | Wetland | MNGPLLIDLLPPEKLLDSTGVVPVPAPFIAALLLIGFLLSLMLR |
| Ga0209293_100148472 | 3300027877 | Wetland | MNGPLLISLLPPERILDSSTAFSDYTPFVAILLLIGFLLSLFLRQPGR |
| Ga0209293_105846001 | 3300027877 | Wetland | MNGPLLVSLLPPERIWDSAVGISDSTPFVAVLLLIGFLLSLLL |
| Ga0265296_11878181 | 3300028032 | Groundwater | MNGPLLISLLPPERSWDSAAAISGSTPFIAILLLIGFLLSLFLRHPGR |
| Ga0315293_103801962 | 3300031746 | Sediment | MNGPLLISLLPPEKLLDSTVAVPVYEPFIAVLLLIGFLLSLLLRHPKR |
| Ga0315288_101971772 | 3300031772 | Sediment | MNGPLLVSLLPPEKLLDSTGAVPVYEPSIAVLLPIGFLLSLLLRHPGRG |
| Ga0315290_113657471 | 3300031834 | Sediment | MNGPLLVSLLPPEKLLNSAGAVPVYEPYIAVLLLIGFL |
| Ga0214473_100428443 | 3300031949 | Soil | MNGPLLISLLPPEKMMESPGAIPGYAQFIAVLLLIGFLLSLFLRHPER |
| Ga0214473_102281672 | 3300031949 | Soil | MNGPLLVTLLPPERSWDSASSLSGSTPFIAILLLIGFLLSLFLRHPGR |
| Ga0214473_110745781 | 3300031949 | Soil | MNGPLLISLLPPERIWDSAVAISDSTPFVAILLVIGFLLS |
| Ga0214473_123976242 | 3300031949 | Soil | MNGPLLISLLPPEKLIDSTGAAPVYEPFIAVLLLIGFLLSLLLRHPGR |
| Ga0326597_100104594 | 3300031965 | Soil | MNGPLLVSLLPPEHAWDSAMSIPGSTPLVAILLLIGFLLTLFLRHPGR |
| Ga0326597_110101501 | 3300031965 | Soil | MNGPLLVSLLPPEHAWDSAMSIPGSTPFVAILLLIGFLLTLFLRHPGR |
| Ga0315278_101084835 | 3300031997 | Sediment | MNGPLLISLLPPEKLLDSTGAAPVYEPFIVVLLLIGFL |
| Ga0315278_101980891 | 3300031997 | Sediment | SMNGPLLISLLPPEKLLDSTGAVQVDEPFIAVLLLIGFLLSLFLRHPGRG |
| Ga0315278_102159063 | 3300031997 | Sediment | MNGPLLISLLPPEKLLDSTGAVQVDEPFIAVLLLIGFLLS |
| Ga0315278_106280832 | 3300031997 | Sediment | MNGPLLINLLPPEKLLDSTGAVPVYEPSIAVLLLIGFLLSILLRHPER |
| Ga0315278_112744402 | 3300031997 | Sediment | PLLISLLPPEKLSDSTGAVPVYEPLIAVLLLIGFLLSLFLRHPGR |
| Ga0315278_115125911 | 3300031997 | Sediment | MNGPLLVSLLPQEKLLDATVTVAVPVYEPFIAVLLLIGFLLSL |
| Ga0315281_121542782 | 3300032163 | Sediment | MNGPLLISLLPPEKLLDSTVAVPVYEPFIAVLLLIGFLLSLLL |
| Ga0315283_120481511 | 3300032164 | Sediment | DFMNGPLLISLLPPEKLLDSTGAAPVYEPFIVVLLLIGFLLSILLRQPDP |
| Ga0315276_103048012 | 3300032177 | Sediment | MNGPLLISLLPPEKLLDSTGAVPVYEPFIAVLLLIGFLLSLLLRHPRR |
| Ga0315286_112986182 | 3300032342 | Sediment | MNGPLLISLLPPEKLLDSTGAALVYEPFIAVLLLVGFLLSLFLRHPER |
| Ga0315287_112250162 | 3300032397 | Sediment | MNGPLLISLLPPERLLDSTVGAIPVYEPFIIAVLLLIGFL |
| Ga0315275_104321641 | 3300032401 | Sediment | NGPLLISLLPPEKLLESAGAVPVYEPFIIAVLLLIGFLLSILLKQPDRS |
| Ga0315275_112765531 | 3300032401 | Sediment | MNGPLLISLLPPERLLDSTVGAIPVYEPFIIAVLLLIGFLLSLLLRHP |
| Ga0315273_102071353 | 3300032516 | Sediment | MNGPLLISLLPPEKLLDSTGAVPVYAPFIAVLLLIGFLL |
| Ga0315273_103051564 | 3300032516 | Sediment | MNGPLLIGLLPPEKLLDSTGAVPVYEPFIAVLLLIGFLLSLLLRHPKR |
| Ga0315273_121393971 | 3300032516 | Sediment | MNGPLLISLLSPEKLLDPTGAVPVYEPLIAVLLLI |
| Ga0334722_101386253 | 3300033233 | Sediment | MNGPLLISLLPPEWSWDSAAAISGSPPFIAILLLIGFLLSLFLRHPGR |
| Ga0316605_111576562 | 3300033408 | Soil | VNLLPPERIWDSATATSDSTPFVAILLLIGFLLSLFLRQPGR |
| Ga0316603_100580201 | 3300033413 | Soil | MNGPLLITLLPPERVWDSATTISDYTPFVAILLLIGFLMSLFLRRPGR |
| Ga0316603_105118222 | 3300033413 | Soil | MNGPLLISLLPPERIWDSSTAISDYTPFVAILLLIGFLLSLFLRQPGRL |
| Ga0316603_105259351 | 3300033413 | Soil | MNGPLLISLLPSEKLLDSTEVVPVYEPFIAVLLLIGFLLSLMLR |
| Ga0316603_106582411 | 3300033413 | Soil | MNGPLLTSLLPPERIWDSTAAISDYTPFVAILLLIGFLLSLML |
| Ga0316603_110937551 | 3300033413 | Soil | MNGPLLVSLLPPERIWDSAVAISDSTPFVAVFLLIGFLLSLLLRHPGR |
| Ga0316619_100329163 | 3300033414 | Soil | MNGPLLISLLPPERIWDSSTAISDSTPIIAIFLLIGFLLSLVLRHPG |
| Ga0316601_1000683391 | 3300033419 | Soil | MNGPLLVSLLPPERIWDSAVGISDSTPFVAVLLLIGFLLS |
| Ga0316601_1008674801 | 3300033419 | Soil | MNGPLLISLLPPEKFLDSTGATPVYEPFIAVLLLIGFLLSLL |
| Ga0316620_103973902 | 3300033480 | Soil | MNGPLLISLLPPERIWDSSTAISDFTPIIAIILLIGFLLSLVLRHPG |
| Ga0316600_101027391 | 3300033481 | Soil | MNGPLLISLLPPERILDSSTAISDYTPFVAILLLIGFLLSLFLRQPGR |
| Ga0316626_110177412 | 3300033485 | Soil | MYGPLLIRLLPPERTWDSPFAVSGSTPFIAILLLLGFLPSLF |
| Ga0316626_119231362 | 3300033485 | Soil | MNGPLVVSLLPPERIWDSASAVSGSTPYIAVFLLIGFLLSLLLRHPR |
| Ga0316616_1012310302 | 3300033521 | Soil | PPEKLLDPTGVVPVSAPFIAVLLLIGFLLSLMLRPPRG |
| Ga0316616_1045235441 | 3300033521 | Soil | PLLITLLPPERVWDSATTISDYTPFVAILLLIGFLMSLFLRRPGR |
| Ga0364930_0038905_1471_1611 | 3300033814 | Sediment | MNGPLLVSLLPPEWTWDSAAAASGSSPFVAILLLIGFLLSLFLRHPG |
| ⦗Top⦘ |