| Basic Information | |
|---|---|
| Family ID | F089576 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MFGLPDITIIAVGGVVLVIIVALLYWGLTFKGHD |
| Number of Associated Samples | 60 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 41.51 % |
| % of genes near scaffold ends (potentially truncated) | 13.76 % |
| % of genes from short scaffolds (< 2000 bps) | 65.14 % |
| Associated GOLD sequencing projects | 52 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (84.404 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (22.018 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.138 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (53.211 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.94% β-sheet: 0.00% Coil/Unstructured: 58.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF00474 | SSF | 29.36 |
| PF00999 | Na_H_Exchanger | 4.59 |
| PF00072 | Response_reg | 2.75 |
| PF00582 | Usp | 2.75 |
| PF02652 | Lactate_perm | 2.75 |
| PF01593 | Amino_oxidase | 2.75 |
| PF13419 | HAD_2 | 2.75 |
| PF13173 | AAA_14 | 1.83 |
| PF00689 | Cation_ATPase_C | 1.83 |
| PF10369 | ALS_ss_C | 1.83 |
| PF14539 | DUF4442 | 1.83 |
| PF02775 | TPP_enzyme_C | 1.83 |
| PF12399 | BCA_ABC_TP_C | 1.83 |
| PF13710 | ACT_5 | 0.92 |
| PF02653 | BPD_transp_2 | 0.92 |
| PF01728 | FtsJ | 0.92 |
| PF03441 | FAD_binding_7 | 0.92 |
| PF07747 | MTH865 | 0.92 |
| PF13520 | AA_permease_2 | 0.92 |
| PF12544 | LAM_C | 0.92 |
| PF10114 | PocR | 0.92 |
| PF02776 | TPP_enzyme_N | 0.92 |
| PF00654 | Voltage_CLC | 0.92 |
| PF01202 | SKI | 0.92 |
| PF00209 | SNF | 0.92 |
| PF13414 | TPR_11 | 0.92 |
| PF00005 | ABC_tran | 0.92 |
| PF02086 | MethyltransfD12 | 0.92 |
| PF09918 | DUF2148 | 0.92 |
| PF13180 | PDZ_2 | 0.92 |
| PF01243 | Putative_PNPOx | 0.92 |
| PF04885 | Stig1 | 0.92 |
| PF13248 | zf-ribbon_3 | 0.92 |
| PF13635 | DUF4143 | 0.92 |
| PF13426 | PAS_9 | 0.92 |
| PF13432 | TPR_16 | 0.92 |
| PF13847 | Methyltransf_31 | 0.92 |
| PF11667 | DUF3267 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 4.59 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 4.59 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 4.59 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 4.59 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 4.59 |
| COG1620 | L-lactate permease | Energy production and conversion [C] | 2.75 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 1.83 |
| COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.92 |
| COG0293 | 23S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJ | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.92 |
| COG0415 | Deoxyribodipyrimidine photolyase | Replication, recombination and repair [L] | 0.92 |
| COG0733 | Na+-dependent transporter, SNF family | General function prediction only [R] | 0.92 |
| COG1189 | Predicted rRNA methylase YqxC, contains S4 and FtsJ domains | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.40 % |
| Unclassified | root | N/A | 15.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000032|Draft_c0052611 | Not Available | 811 | Open in IMG/M |
| 3300000558|Draft_10013280 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 3020 | Open in IMG/M |
| 3300000558|Draft_10019479 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 15591 | Open in IMG/M |
| 3300000558|Draft_10161562 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 5103 | Open in IMG/M |
| 3300000568|Draft_10063550 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula boonei | 5711 | Open in IMG/M |
| 3300000568|Draft_10585204 | Not Available | 1147 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_100072309 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 900 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_100528614 | Not Available | 538 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_100629179 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 2526 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_100643864 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1022 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_100695153 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 2625 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_101065547 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 596 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_101656269 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 666 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_101894767 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 640 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_102709642 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 737 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_103411433 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 614 | Open in IMG/M |
| 3300001279|JGI20214J14112_1008449 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1722 | Open in IMG/M |
| 3300001368|JGI20225J14565_1035626 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 1313 | Open in IMG/M |
| 3300001580|Draft_10162155 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1066 | Open in IMG/M |
| 3300001605|Draft_10703133 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 504 | Open in IMG/M |
| 3300001866|JGI24729J20445_1000537 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 19612 | Open in IMG/M |
| 3300001866|JGI24729J20445_1008859 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 2544 | Open in IMG/M |
| 3300001866|JGI24729J20445_1048991 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 605 | Open in IMG/M |
| 3300001866|JGI24729J20445_1057986 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 532 | Open in IMG/M |
| 3300001881|JGI24728J21555_1010028 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae | 2842 | Open in IMG/M |
| 3300002172|JGI24730J26740_1000077 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 92324 | Open in IMG/M |
| 3300002220|MLSBCLC_10113155 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 4129 | Open in IMG/M |
| 3300002220|MLSBCLC_10166059 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1522 | Open in IMG/M |
| 3300002220|MLSBCLC_10351336 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanospirillaceae → Methanospirillum → Methanospirillum hungatei | 1619 | Open in IMG/M |
| 3300003541|JGI20214J51650_10319230 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1079 | Open in IMG/M |
| 3300004775|Ga0007798_10065989 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 806 | Open in IMG/M |
| 3300004776|Ga0007800_10078852 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 794 | Open in IMG/M |
| 3300004776|Ga0007800_10096380 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 717 | Open in IMG/M |
| 3300005325|Ga0074199_1032424 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1252 | Open in IMG/M |
| 3300005472|Ga0074280_136 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 14803 | Open in IMG/M |
| 3300005645|Ga0077109_1082376 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 919 | Open in IMG/M |
| 3300008944|Ga0115987_1014007 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 866 | Open in IMG/M |
| 3300008945|Ga0115988_1000859 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 4678 | Open in IMG/M |
| 3300009091|Ga0102851_11804176 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 689 | Open in IMG/M |
| 3300009168|Ga0105104_10919344 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 514 | Open in IMG/M |
| 3300009518|Ga0116128_1074744 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae | 1029 | Open in IMG/M |
| 3300009692|Ga0116171_10004487 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 12550 | Open in IMG/M |
| 3300009692|Ga0116171_10009058 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 8231 | Open in IMG/M |
| 3300009692|Ga0116171_10022866 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 4539 | Open in IMG/M |
| 3300009692|Ga0116171_10060217 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 2414 | Open in IMG/M |
| 3300009692|Ga0116171_10116109 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 1592 | Open in IMG/M |
| 3300009692|Ga0116171_10193133 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1155 | Open in IMG/M |
| 3300009692|Ga0116171_10218231 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 1070 | Open in IMG/M |
| 3300009692|Ga0116171_10296715 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 883 | Open in IMG/M |
| 3300009692|Ga0116171_10310519 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 858 | Open in IMG/M |
| 3300009692|Ga0116171_10353521 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 791 | Open in IMG/M |
| 3300009692|Ga0116171_10439009 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 690 | Open in IMG/M |
| 3300009692|Ga0116171_10500087 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 636 | Open in IMG/M |
| 3300009692|Ga0116171_10546919 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 601 | Open in IMG/M |
| 3300009694|Ga0116170_10651397 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 552 | Open in IMG/M |
| 3300009694|Ga0116170_10680100 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 537 | Open in IMG/M |
| 3300009704|Ga0116145_1072795 | Not Available | 1517 | Open in IMG/M |
| 3300010302|Ga0116202_10457620 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 567 | Open in IMG/M |
| 3300010319|Ga0136653_10446280 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 568 | Open in IMG/M |
| 3300010339|Ga0074046_10044819 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 2956 | Open in IMG/M |
| 3300010352|Ga0116247_10005721 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 17209 | Open in IMG/M |
| 3300010352|Ga0116247_10065006 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 3352 | Open in IMG/M |
| 3300010429|Ga0116241_10511968 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 938 | Open in IMG/M |
| 3300012886|Ga0160425_1004141 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula boonei | 10030 | Open in IMG/M |
| 3300012886|Ga0160425_1006593 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula boonei | 6812 | Open in IMG/M |
| 3300012886|Ga0160425_1018996 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 2806 | Open in IMG/M |
| 3300012886|Ga0160425_1114880 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 625 | Open in IMG/M |
| 3300012931|Ga0153915_10000004 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 322542 | Open in IMG/M |
| 3300012931|Ga0153915_10000010 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 213048 | Open in IMG/M |
| 3300012931|Ga0153915_10031548 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula boonei | 5314 | Open in IMG/M |
| 3300012931|Ga0153915_11747271 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 728 | Open in IMG/M |
| 3300014204|Ga0172381_10000055 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 117369 | Open in IMG/M |
| 3300014204|Ga0172381_10003756 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 15923 | Open in IMG/M |
| 3300014204|Ga0172381_10310091 | Not Available | 1249 | Open in IMG/M |
| 3300014204|Ga0172381_10575681 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 863 | Open in IMG/M |
| 3300014205|Ga0172380_10239763 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 1401 | Open in IMG/M |
| 3300014205|Ga0172380_10548307 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 850 | Open in IMG/M |
| 3300014205|Ga0172380_11268894 | Not Available | 515 | Open in IMG/M |
| 3300014258|Ga0075315_1074793 | Not Available | 606 | Open in IMG/M |
| 3300014309|Ga0075317_1030558 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1024 | Open in IMG/M |
| 3300014309|Ga0075317_1123397 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 585 | Open in IMG/M |
| 3300014494|Ga0182017_10007061 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 8212 | Open in IMG/M |
| 3300014502|Ga0182021_10291104 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1921 | Open in IMG/M |
| 3300022553|Ga0212124_10124102 | Not Available | 1436 | Open in IMG/M |
| 3300022555|Ga0212088_10736346 | Not Available | 580 | Open in IMG/M |
| 3300025436|Ga0208103_1005996 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1898 | Open in IMG/M |
| 3300025858|Ga0209099_1191998 | Not Available | 795 | Open in IMG/M |
| 3300025858|Ga0209099_1201016 | Not Available | 769 | Open in IMG/M |
| 3300025858|Ga0209099_1219962 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon HGW-Methanomicrobiales-1 | 722 | Open in IMG/M |
| 3300025867|Ga0209098_1010250 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 6205 | Open in IMG/M |
| 3300025867|Ga0209098_1238595 | Not Available | 727 | Open in IMG/M |
| 3300027373|Ga0209016_1000080 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae | 144164 | Open in IMG/M |
| 3300027887|Ga0208980_10017587 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 4162 | Open in IMG/M |
| 3300027958|Ga0209749_1038603 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1579 | Open in IMG/M |
| 3300028032|Ga0265296_1009631 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 6729 | Open in IMG/M |
| 3300028162|Ga0268278_1035489 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1356 | Open in IMG/M |
| 3300028625|Ga0302251_1029879 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1202 | Open in IMG/M |
| 3300028628|Ga0302249_1051848 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 968 | Open in IMG/M |
| (restricted) 3300029268|Ga0247842_10287572 | Not Available | 885 | Open in IMG/M |
| (restricted) 3300029286|Ga0247841_10112126 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 2210 | Open in IMG/M |
| 3300029959|Ga0272380_10250162 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 1261 | Open in IMG/M |
| 3300031726|Ga0302321_101142411 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 891 | Open in IMG/M |
| 3300032163|Ga0315281_10270017 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1868 | Open in IMG/M |
| 3300034090|Ga0326723_0008503 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 3977 | Open in IMG/M |
| 3300034090|Ga0326723_0317997 | Not Available | 700 | Open in IMG/M |
| 3300034091|Ga0326724_0162848 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula | 1367 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 22.02% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 12.84% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 9.17% |
| Bioremediated Contaminated Groundwater | Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater | 9.17% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 6.42% |
| Bioreactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Bioreactor | 4.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.67% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 3.67% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 3.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.75% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.75% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 1.83% |
| Sediment | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment | 1.83% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.83% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.83% |
| Activated Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge | 1.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.92% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.92% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.92% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.92% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.92% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.92% |
| Brackish Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Brackish Water | 0.92% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.92% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.92% |
| Hydrocarbon Resource Environments | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000032 | Oil sands microbial community from Northern Alberta which degrade Naphthaline | Engineered | Open in IMG/M |
| 3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300000568 | Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC: | Engineered | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001279 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300001368 | Microbial communities from bioreactor (seeded with sewage sludge) at LBNL, California, USA - Biofuel metagenome 4 | Engineered | Open in IMG/M |
| 3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
| 3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
| 3300001866 | Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample SAE3-23 | Engineered | Open in IMG/M |
| 3300001881 | Bioremediated contaminated groundwater microbial communities from EPA Superfund site, New Mexico - SAE3-05 | Engineered | Open in IMG/M |
| 3300002172 | Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample SAE3-47 | Engineered | Open in IMG/M |
| 3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300004775 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA17M | Environmental | Open in IMG/M |
| 3300004776 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA14M | Environmental | Open in IMG/M |
| 3300005325 | Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample SAE3-47 | Engineered | Open in IMG/M |
| 3300005472 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site L1 Cattail | Environmental | Open in IMG/M |
| 3300005645 | Brackish water microbial communities from Lake Sakinaw in Canada: eDNA_2 (120m) | Environmental | Open in IMG/M |
| 3300008944 | T18 (1) (Live), Syntrophic microbial communities from an anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom ? benzoate enriched in lab, transferred 6 times DE NOVO (2) | Environmental | Open in IMG/M |
| 3300008945 | T18 (2) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times DE NOVO (2) | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009692 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG | Engineered | Open in IMG/M |
| 3300009694 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG | Engineered | Open in IMG/M |
| 3300009704 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG1_MetaG | Engineered | Open in IMG/M |
| 3300010302 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 325m metaG | Environmental | Open in IMG/M |
| 3300010319 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 275m metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010352 | AD_JPHWca | Engineered | Open in IMG/M |
| 3300010429 | AD_USRAca | Engineered | Open in IMG/M |
| 3300012886 | Microbial communities from bioreactor (seeded with sewage sludge) at Lawrence Berkeley National Lab, California, USA - Biofuel Metagenome 8 (Illumina Assembly) | Engineered | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014204 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG | Engineered | Open in IMG/M |
| 3300014205 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG | Engineered | Open in IMG/M |
| 3300014258 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014309 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300025436 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025858 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025867 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300027373 | Bioremediated contaminated groundwater microbial communities from EPA Superfund site, New Mexico - SAE3-05 (SPAdes) | Engineered | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027958 | Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample SAE3-47 (SPAdes) | Engineered | Open in IMG/M |
| 3300028032 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1 | Environmental | Open in IMG/M |
| 3300028162 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_55m | Environmental | Open in IMG/M |
| 3300028625 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_RA_Gln | Engineered | Open in IMG/M |
| 3300028628 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Val | Engineered | Open in IMG/M |
| 3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
| 3300029286 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m | Environmental | Open in IMG/M |
| 3300029959 | EPA Superfund site combined assembly | Engineered | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| 3300034170 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_16 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Draft_00526111 | 3300000032 | Hydrocarbon Resource Environments | MFGLPDITVIAIGSVVVVIIIALLYWGLKFNPESDS* |
| Draft_100132804 | 3300000558 | Hydrocarbon Resource Environments | MFGLPDITVIALGTVVVLIIIALVYWGLKFNPESSS* |
| Draft_100194799 | 3300000558 | Hydrocarbon Resource Environments | MLGLPDITIFAVGGVVLIITAALLYWGLTFKGHD* |
| Draft_101615622 | 3300000558 | Hydrocarbon Resource Environments | MLGLPDITIFAVGGVVLVITAALLYWGLTFKGHD* |
| Draft_100635506 | 3300000568 | Hydrocarbon Resource Environments | MFGLPDITVIAIGSVVVVIIIALLXWGLKFNPESDS* |
| Draft_105852042 | 3300000568 | Hydrocarbon Resource Environments | MYFDIMLGLPDITIVSVGITIVVVIAALLFWGLTFKGYD* |
| JGIcombinedJ13530_1000723092 | 3300001213 | Wetland | MFGLPEITILVVGITVIGVIAALLYWGLTFKGHD* |
| JGIcombinedJ13530_1005286141 | 3300001213 | Wetland | MFGLPDITILVFGVVTLVAVIALLYWGLTFEGHD* |
| JGIcombinedJ13530_1006291793 | 3300001213 | Wetland | MFGLPDITIIAVGGVVLVITAALVYWGLTFKGHD* |
| JGIcombinedJ13530_1006438642 | 3300001213 | Wetland | MFGLPDITIIAVGGVVLVITAALLYWGLTFTGHD* |
| JGIcombinedJ13530_1006951531 | 3300001213 | Wetland | MFGLPDITIIAVGGTVLIIITALTYWGLTFMGHD* |
| JGIcombinedJ13530_1010655472 | 3300001213 | Wetland | MFGLPDITVIAVGGVVLVIVVALLYWGLTFKGHD* |
| JGIcombinedJ13530_1016562692 | 3300001213 | Wetland | MFGLPDITIIAVGGVVLVITAALLYWGLTFKGHD* |
| JGIcombinedJ13530_1018947672 | 3300001213 | Wetland | MFGLPDITIIAVGGVVLVVIAALLYWGLTFGGHD* |
| JGIcombinedJ13530_1027096421 | 3300001213 | Wetland | MFGLPDITVFSVGGTVLVILIALTYWGLTFKGHD* |
| JGIcombinedJ13530_1034114332 | 3300001213 | Wetland | MLGLPDITIIAVGGVVLIITALLLYWGLTFKGHD* |
| JGI20214J14112_10084492 | 3300001279 | Wetland | MFGLPDITIIAVGGVVLVVIAALLYWGLTFRGHD* |
| JGI20225J14565_10356262 | 3300001368 | Bioreactor | MFGLPDITIIVFGGVTLVAIVALLYWGLTFRGHD* |
| Draft_101621551 | 3300001580 | Hydrocarbon Resource Environments | MIGLPDITVISIGTVVVVIIIALVYWGLKFNPESDS* |
| Draft_107031331 | 3300001605 | Hydrocarbon Resource Environments | GLPDITVIALGTVVVVIIIALVYWGLKFNPEPES* |
| JGI24729J20445_10005372 | 3300001866 | Bioremediated Contaminated Groundwater | MFGLPDITIAAVGGVVVIVIIALLYWGLTFQGHD* |
| JGI24729J20445_10088592 | 3300001866 | Bioremediated Contaminated Groundwater | MFGLPDITIIVFGIVTIIAIALLVWWGLIFKGHD* |
| JGI24729J20445_10489911 | 3300001866 | Bioremediated Contaminated Groundwater | MFGLPDITVLSMGVVVGLIVLALLYWGLKFNPKSDA* |
| JGI24729J20445_10579862 | 3300001866 | Bioremediated Contaminated Groundwater | MLGLPDITIIAVGGIVVVIIALLLYWGLTFRGHD* |
| JGI24728J21555_10100282 | 3300001881 | Bioremediated Contaminated Groundwater | MFGLPDITVAVVGGVVLVILAALVYWGLTFRGHD* |
| JGI24730J26740_100007734 | 3300002172 | Bioremediated Contaminated Groundwater | MFGLPDITILVFGGVTVVAIVALLYWGLTFKGHD* |
| MLSBCLC_101131554 | 3300002220 | Hydrocarbon Resource Environments | MFGLPDVTIAAVGSVVIVVIIALLYWGFTFRGHD* |
| MLSBCLC_101660592 | 3300002220 | Hydrocarbon Resource Environments | MIGLPDITVIALGTVVVVIIIALVYWGLKFNPEPES* |
| MLSBCLC_103513363 | 3300002220 | Hydrocarbon Resource Environments | MDMFGLPDITILTVGGAVVIIILLLLGWGLFFTGEDS* |
| JGI20214J51650_103192302 | 3300003541 | Wetland | LTSDKQVLNCIFGLPDITVLIWGVVIGLIVLALLYGGLKFNPKSDA* |
| Ga0007798_100659891 | 3300004775 | Freshwater | MLNVNMAHLIRNKMLGLPDITVYAVSGVVGIVILALLYWGLTFRGHD* |
| Ga0007800_100788522 | 3300004776 | Freshwater | MLNVNMAHLIRNKMLGLPDITVSAVSVVVVIIIIALLYWGLTFRGHD* |
| Ga0007800_100963802 | 3300004776 | Freshwater | MLNVNMAHLIRNKMFGLPDITVSAVSVVVVIIIIALLYWGLTFRGHD* |
| Ga0074199_10324242 | 3300005325 | Bioremediated Contaminated Groundwater | MLNVNMAHVIRNKMLGLPNITVYAVSGVVVIIILALLYWGLTFRGHD* |
| Ga0074280_13613 | 3300005472 | Wetland | MFGLPDVTIIVFAGVTLVAIVALLYWGLTFGGHD* |
| Ga0077109_10823762 | 3300005645 | Brackish Water | MFGLPDITIAAVGGVVIIVIIALLYWGITFRGHD* |
| Ga0115987_10140071 | 3300008944 | Sediment | TMFGLPDVTIAAVGSVVVIVIIALLYWGLTFRGHD* |
| Ga0115988_10008592 | 3300008945 | Sediment | MFGLPDITIAAVGIVVVIVIIALLYWGLTFRGHD* |
| Ga0102851_118041762 | 3300009091 | Freshwater Wetlands | MFGLPDITVMAIGSVVVVIIIALLYWGLKFNPESDS* |
| Ga0105104_109193442 | 3300009168 | Freshwater Sediment | MLGLPDITIIAVGGVVVVIIALLLYWGLTFRGHD* |
| Ga0116128_10747441 | 3300009518 | Peatland | MFGLPDITIIVFGGLTVIAIAALLYWGLTFGGHD* |
| Ga0116171_1000448710 | 3300009692 | Anaerobic Digestor Sludge | MFGLPDITIIAVGGVVLAITAALVYWGLTFQGHD* |
| Ga0116171_100090587 | 3300009692 | Anaerobic Digestor Sludge | MFGLPDITILVFGGVTLVAIVALLYWGLTFGGHD* |
| Ga0116171_100228663 | 3300009692 | Anaerobic Digestor Sludge | MFGLPDITIAVVGFVVIVSFAALLYWGLTFKGHD* |
| Ga0116171_100602171 | 3300009692 | Anaerobic Digestor Sludge | MFGLPDITLIVFGGVTIIAIAALLYWGLSFGGHD* |
| Ga0116171_101161091 | 3300009692 | Anaerobic Digestor Sludge | MFGLPDITILVFGGVTVIAIAALLYWGLTFGGHD* |
| Ga0116171_101931331 | 3300009692 | Anaerobic Digestor Sludge | MFGLPDITVLSMGIVVGVIILALLYWGLTFNPEPDN* |
| Ga0116171_102182312 | 3300009692 | Anaerobic Digestor Sludge | MFGVPDLTILVFGGVTLVAFAALLYWGLTFGGHD* |
| Ga0116171_102967152 | 3300009692 | Anaerobic Digestor Sludge | MFGLPDITIMAVGGVVLVIIVLLLYWGLTFKGHD* |
| Ga0116171_103105192 | 3300009692 | Anaerobic Digestor Sludge | MLGLPDITIIAVGGVVLVIVVALLYWGLTFKGHD* |
| Ga0116171_103535212 | 3300009692 | Anaerobic Digestor Sludge | MFGLPDITIIAVGGVVLVITAALLYWGMTFKGHD* |
| Ga0116171_104390092 | 3300009692 | Anaerobic Digestor Sludge | MFGLPDITVLSMGVVVGLIVLALLYWGLKFNPKSDT* |
| Ga0116171_105000872 | 3300009692 | Anaerobic Digestor Sludge | MFGLPDITVIAVGSVVIVIIIALLYWGLKFNTESDS* |
| Ga0116171_105469192 | 3300009692 | Anaerobic Digestor Sludge | MLGLPDITIIAVGIVLVVVIAALLYWGISFRGHD* |
| Ga0116170_106513972 | 3300009694 | Anaerobic Digestor Sludge | MFGLPEITIFAVGGVVLVVTAALLYWGLTFRRHD* |
| Ga0116170_106801002 | 3300009694 | Anaerobic Digestor Sludge | MFGLPDITVIAIGSVVVVIIIALLYWGLKFNPESSS* |
| Ga0116145_10727952 | 3300009704 | Anaerobic Digestor Sludge | MFGLPDITVASVGGVFLLSVIGLLLWGLRFQKVKV* |
| Ga0116202_104576202 | 3300010302 | Anoxic Lake Water | MLGLPDITIYAVGIVVVIIIAALLYWGLTFRGHD* |
| Ga0136653_104462802 | 3300010319 | Anoxic Lake Water | CEDNMLGLPDITIYAVGIVVVIIIAALLYWGLTFRGHD* |
| Ga0074046_100448193 | 3300010339 | Bog Forest Soil | MFGLPDITILAVGGVTVIAILALLYWGLTFRGHD* |
| Ga0116247_1000572121 | 3300010352 | Anaerobic Digestor Sludge | MFGLPDITVLSMGIVVGVIILALLYWGLKFNPKSDA* |
| Ga0116247_100650063 | 3300010352 | Anaerobic Digestor Sludge | MFGLPDITILVVGGVVLVIIIALLYWGLTFKGHD* |
| Ga0116241_105119682 | 3300010429 | Anaerobic Digestor Sludge | MFGLPEITIIAVGGVVLIVTAALLYWGLTFKGHD* |
| Ga0160425_10041413 | 3300012886 | Bioreactor | MFGLPDITILVFGGVTLVAFVALLYWGLTFKGHD* |
| Ga0160425_10065932 | 3300012886 | Bioreactor | MFGLPDITILVFGGVTLVAIVALLYWGLTFKGHD* |
| Ga0160425_10189962 | 3300012886 | Bioreactor | MFGLPDITILVYGGVTLVAIVALLYWGLTFKGHD* |
| Ga0160425_11148802 | 3300012886 | Bioreactor | MFGLPDITILVFGGVTIVAIVALLYWGLTFTGHD* |
| Ga0153915_10000004221 | 3300012931 | Freshwater Wetlands | MFGLPDITIMAVGGVVLVITIALLYWGLTFKGHD* |
| Ga0153915_10000010111 | 3300012931 | Freshwater Wetlands | MFGLPDITIIAVGGVVLVIIVALLYWGLTFKGHD* |
| Ga0153915_100315485 | 3300012931 | Freshwater Wetlands | MFGLPDITILVFGGVTLVAVIALLYWGLTFEGHD* |
| Ga0153915_117472712 | 3300012931 | Freshwater Wetlands | MLGLPDITILAVGGVVLVIIVALLYWGLTFKGHD* |
| Ga0172381_1000005512 | 3300014204 | Landfill Leachate | MFGVPNLTILVFGGVTLVAFAALLYWGLTFGGHD* |
| Ga0172381_1000375610 | 3300014204 | Landfill Leachate | MFGLPDITIIAVGGVVLVIVVALLYWGLTFKGHD* |
| Ga0172381_103100911 | 3300014204 | Landfill Leachate | MFGLPDITVIAMGTVVGIIVLALLYWGLKFNPKSDA* |
| Ga0172381_105756812 | 3300014204 | Landfill Leachate | MLGLPDITVILMGNVAGIIILVLLYWGLKYNPESDA* |
| Ga0172380_102397632 | 3300014205 | Landfill Leachate | MFGLPDITILVFGGVTVVAIVALLYWGLTFKEHD* |
| Ga0172380_105483072 | 3300014205 | Landfill Leachate | MLYVNMAHVIRNKMLGLPDITIYAVSGVVVIIILALLYWGLTFRGHD* |
| Ga0172380_112688941 | 3300014205 | Landfill Leachate | MFGLPDITILAVGGVTIVAIAALLYWGLTFGGHD* |
| Ga0075315_10747931 | 3300014258 | Natural And Restored Wetlands | MLGLPDITIAAVGIVVVIVIIALLYWGFIFRGHD* |
| Ga0075317_10305582 | 3300014309 | Natural And Restored Wetlands | MFGLPDITIAAVGIVVVIVLIALLYWGFTFRGHD* |
| Ga0075317_11233972 | 3300014309 | Natural And Restored Wetlands | MFGLPDITVAVVGGVVLVIIAALVYWGLTFRGHD* |
| Ga0182017_100070615 | 3300014494 | Fen | MFGLPDITVLAVGGVTLVVIAALLYWGLTFRGHD* |
| Ga0182021_102911041 | 3300014502 | Fen | MFGLPDITIIAVGGVVLIITAALLYWGLTFKGHD* |
| Ga0212124_101241021 | 3300022553 | Freshwater | GTMFGLPDITILVFGAVTIIAIAALVFWGITFKGHD |
| Ga0212088_107363462 | 3300022555 | Freshwater Lake Hypolimnion | TMFGLPDITIIVFGVVTIIAIAALVYWGITFKGHD |
| Ga0208103_10059962 | 3300025436 | Freshwater | MLNVNMAHLIRNKMFGLPDITVSAVSVVVVIIIIALLYWGLTFRGHD |
| Ga0209099_11919982 | 3300025858 | Anaerobic Digestor Sludge | KNYLLTCMFGLPDITIIVMGTVVGISILALLYWGLTFNPTSDS |
| Ga0209099_12010161 | 3300025858 | Anaerobic Digestor Sludge | KNYLLTCMFGLPDITIIVMGTVVGISILALLYWGLTFNPTSDN |
| Ga0209099_12199621 | 3300025858 | Anaerobic Digestor Sludge | MFGLPDITIIVMGTVVGISILALLYWGLTFNPTSD |
| Ga0209098_10102507 | 3300025867 | Anaerobic Digestor Sludge | MFGLPDITVLSMGIVVGVIILALLYWGLTFNPEPDN |
| Ga0209098_12385952 | 3300025867 | Anaerobic Digestor Sludge | MFGLPDITVISMGVVVGFIILALLYWGLKFNPESDA |
| Ga0209016_1000080101 | 3300027373 | Bioremediated Contaminated Groundwater | MFGLPDITVLSMGVVVGLIVLALLYWGLKFNPKSDA |
| Ga0208980_100175874 | 3300027887 | Wetland | MDRMFGLPDITVIAVGTTVLIVIAALIYWGITFEGHD |
| Ga0209749_10386032 | 3300027958 | Bioremediated Contaminated Groundwater | MAHVIRNKMLGLPNITVYAVSGVVVIIILALLYWGLTFRGHD |
| Ga0265296_10096315 | 3300028032 | Groundwater | MFGLPDITVIAMGTVVGIIVLALLYWGLKFNPKSDA |
| Ga0268278_10354891 | 3300028162 | Saline Water | MLGLPDITWIAYGTVAVVAVIVLIYWGLKFNPKSDA |
| Ga0302251_10298791 | 3300028625 | Activated Sludge | MLFGLPEITIIAVGGVVLVITAALVYWGLTFEGHD |
| Ga0302249_10518483 | 3300028628 | Activated Sludge | MFGLPDITVIAIGSVVVVIIIALLYWGLKFNPESDS |
| (restricted) Ga0247842_102875721 | 3300029268 | Freshwater | VIRNKMLGLPNITVYAVSGVVVIIILALLYWGLTFRGHD |
| (restricted) Ga0247841_101121263 | 3300029286 | Freshwater | MAHLIRNKMLGLPDITVYAVSGVVVIIILALLYWGLTFRGHD |
| Ga0272380_102501622 | 3300029959 | Bioremediated Contaminated Groundwater | MKYLLNYMFGLPDITVIAMGTVVGIIVLALLYWGLKFNPKSDA |
| Ga0302321_1011424111 | 3300031726 | Fen | GIMFGLPDITIIAVGGVVLIITAALLYWGLTFKGHD |
| Ga0315281_102700173 | 3300032163 | Sediment | RMFGLPDITILTVGITIVVVIAALLYWGLTFKGHD |
| Ga0326723_0008503_2_115 | 3300034090 | Peat Soil | EVNMFGLPDITIIAVGGVVLVVTAALLYWGLTFKGHD |
| Ga0326723_0157810_692_826 | 3300034090 | Peat Soil | MLTYHKLFDKMFGLPDITILTVGITLIVVIAALLYWGLTFKGHD |
| Ga0326723_0317997_481_594 | 3300034090 | Peat Soil | MDRMFGLPDITILTVGITIVIAIAALLYWGLTFKGHD |
| Ga0326724_0162848_50_175 | 3300034091 | Peat Soil | MTSYSGTMFGLPDITIIAVGGVVIIVIIALVYWGLTFRGHD |
| Ga0370487_0050045_2_124 | 3300034170 | Untreated Peat Soil | MLAYHKLIDSMFGLPDITIIVVGATVIIVIAALLYWGITFK |
| Ga0370501_0014390_2010_2144 | 3300034195 | Untreated Peat Soil | MLAYHKLIDSMFGLPDITIIVVGATVIIVIAALLYWGITFKGHD |
| ⦗Top⦘ |