| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300027373 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095509 | Gp0056883 | Ga0209016 |
| Sample Name | Bioremediated contaminated groundwater microbial communities from EPA Superfund site, New Mexico - SAE3-05 (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 324193948 |
| Sequencing Scaffolds | 15 |
| Novel Protein Genes | 15 |
| Associated Families | 7 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 1 |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae | 2 |
| All Organisms → cellular organisms → Bacteria | 3 |
| All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae | 2 |
| Not Available | 3 |
| All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 1 |
| All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → Lentisphaeria → Victivallales | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA395 | 1 |
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → unclassified Pirellulales → Pirellulales bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Bioremediated Contaminated Groundwater Microbial Communities From North Railroad Avenue Plume (Nrap), New Mexico |
| Type | Engineered |
| Taxonomy | Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater → Bioremediated Contaminated Groundwater Microbial Communities From North Railroad Avenue Plume (Nrap), New Mexico |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Espanola, New Mexico, United States | |||||||
| Coordinates | Lat. (o) | 35.992 | Long. (o) | -106.0797 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020376 | Metagenome | 224 | Y |
| F067350 | Metagenome / Metatranscriptome | 125 | Y |
| F079376 | Metagenome / Metatranscriptome | 116 | Y |
| F083634 | Metagenome | 112 | Y |
| F084812 | Metagenome / Metatranscriptome | 112 | Y |
| F086799 | Metagenome / Metatranscriptome | 110 | Y |
| F089576 | Metagenome | 109 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0209016_1000061 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 162148 | Open in IMG/M |
| Ga0209016_1000080 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae | 144164 | Open in IMG/M |
| Ga0209016_1001901 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae | 15182 | Open in IMG/M |
| Ga0209016_1006022 | All Organisms → cellular organisms → Bacteria | 5941 | Open in IMG/M |
| Ga0209016_1007092 | All Organisms → cellular organisms → Bacteria | 5176 | Open in IMG/M |
| Ga0209016_1014135 | All Organisms → cellular organisms → Bacteria | 2972 | Open in IMG/M |
| Ga0209016_1016474 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae | 2632 | Open in IMG/M |
| Ga0209016_1024219 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae | 1916 | Open in IMG/M |
| Ga0209016_1039848 | Not Available | 1275 | Open in IMG/M |
| Ga0209016_1040432 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 1261 | Open in IMG/M |
| Ga0209016_1050903 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → Lentisphaeria → Victivallales | 1040 | Open in IMG/M |
| Ga0209016_1077143 | Not Available | 737 | Open in IMG/M |
| Ga0209016_1078366 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA395 | 727 | Open in IMG/M |
| Ga0209016_1090502 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → unclassified Pirellulales → Pirellulales bacterium | 647 | Open in IMG/M |
| Ga0209016_1098900 | Not Available | 603 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0209016_1000061 | Ga0209016_1000061107 | F083634 | MLKLANQVIVLDRLNINGRLHRLSRELQIIVGHTEDRLTLSNDEFGLLVSAPTLEEGIAGISDELSMLWEIYVAEKPANLTRDALRLRSNLKSLVAAGAGS |
| Ga0209016_1000080 | Ga0209016_1000080101 | F089576 | MFGLPDITVLSMGVVVGLIVLALLYWGLKFNPKSDA |
| Ga0209016_1001901 | Ga0209016_10019018 | F083634 | MFRLADQVIVLDRLIINGRLHRLSRELRITVEHDADRLTLSNDEFGLLVSAPTLAEGIAGISDELSVLFNVYVAENPANLTRDALRLRSNLESLVTAGANS |
| Ga0209016_1006022 | Ga0209016_10060227 | F067350 | MLAWIIHKKWMKDENMLKKKVIGDAAVVAALRRGHRQELYFEQIAVFRHQFMNYSS |
| Ga0209016_1007092 | Ga0209016_10070921 | F079376 | MLPGVGDHGMSDIVIIREPGRPCVSFGVMRVCRTTEEGGRQIKHRESDSLVVPMKAGNAAGGKEATHESVV |
| Ga0209016_1014135 | Ga0209016_10141354 | F067350 | MKDENMLKKKVFGDAAVVAALRRGHRQELYFEQIAVFRH |
| Ga0209016_1016474 | Ga0209016_10164744 | F067350 | MKDENMLKKKVFDDSAVAAALRRGHRQELYFEQIAVFRH |
| Ga0209016_1024219 | Ga0209016_10242192 | F067350 | MKDENMLKKKVFGDAAGVAALRRGHRQELYFEQIAVFRH |
| Ga0209016_1039848 | Ga0209016_10398482 | F067350 | MKDENMLKKKVFGDAAVVAALRRGHRQVLYFEQIAVFRHQFMNYSG |
| Ga0209016_1040432 | Ga0209016_10404321 | F067350 | MKDEYMLKKKVFEDATVVAALRRGHRQELYFEQIAVF |
| Ga0209016_1050903 | Ga0209016_10509032 | F067350 | MKDENMLKKKVFGDATVVAALRRGYRQELYFEQIAVFRHSFMNYSG |
| Ga0209016_1077143 | Ga0209016_10771432 | F067350 | KGENMLKKKVFGDAAVVAALRRGHRQELYFEQIAVFRHQFMNYSG |
| Ga0209016_1078366 | Ga0209016_10783661 | F086799 | MKAKKVTYSRLISKGNYENAKIEIELEVEAGEKAVDVFAAAKNWVEKRITIEKLSDYMVEKAKKVMEDKRNHTLAQIEEAEEILLKAKEKDEELPF |
| Ga0209016_1090502 | Ga0209016_10905022 | F020376 | MDGKTGTRRERWMQRAEAAYRRMFEGKSEEELVTLTQREDMAVMIGKELAAFLLEEHVARDPAAQPKEASSTCCPKCGQAGAPAVQKGEELPERTLTTRAGDIGLRRQRWRCAKCRIVFFSAGRSPGAGDGRL |
| Ga0209016_1098900 | Ga0209016_10989002 | F084812 | MKKSTLNLDNHAKGLLIGLISKAINDDKSLASDDIEKLKEIKKQLQEE |
| ⦗Top⦘ |