NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F089142

Metagenome / Metatranscriptome Family F089142

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089142
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 106 residues
Representative Sequence MQFTTFVRKPFVVDAVEVTTENIAEVAKYVGDLREKEDGTPYILVDRRLVPNVFRVYPGFFMTKMGENVRCYSRKIFKEQFMVQTDEIKPWVDFMAKSGDSQ
Number of Associated Samples 87
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 66.04 %
% of genes near scaffold ends (potentially truncated) 33.03 %
% of genes from short scaffolds (< 2000 bps) 71.56 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction Yes
3D model pTM-score0.68

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (74.312 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(18.349 % of family members)
Environment Ontology (ENVO) Unclassified
(27.523 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(32.110 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.23%    β-sheet: 27.69%    Coil/Unstructured: 53.08%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.68
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF11753DUF3310 2.75
PF10926DUF2800 2.75
PF05065Phage_capsid 2.75
PF01464SLT 1.83
PF01510Amidase_2 1.83
PF03965Penicillinase_R 0.92
PF05738Cna_B 0.92
PF01391Collagen 0.92
PF02371Transposase_20 0.92
PF04860Phage_portal 0.92
PF06737Transglycosylas 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 2.75
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.92
COG3547TransposaseMobilome: prophages, transposons [X] 0.92
COG3682Transcriptional regulator, CopY/TcrY familyTranscription [K] 0.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.16 %
UnclassifiedrootN/A12.84 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_104523162All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium664Open in IMG/M
3300004463|Ga0063356_100922198All Organisms → Viruses → Predicted Viral1237Open in IMG/M
3300004633|Ga0066395_10000058All Organisms → cellular organisms → Bacteria37293Open in IMG/M
3300004643|Ga0062591_101437323All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium686Open in IMG/M
3300005276|Ga0065717_1003598All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium1226Open in IMG/M
3300005338|Ga0068868_100003625All Organisms → cellular organisms → Bacteria10777Open in IMG/M
3300005364|Ga0070673_100279338All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium1464Open in IMG/M
3300005526|Ga0073909_10000088All Organisms → cellular organisms → Bacteria34498Open in IMG/M
3300005618|Ga0068864_101423100All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium695Open in IMG/M
3300005937|Ga0081455_10228354All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium1375Open in IMG/M
3300005937|Ga0081455_10611949All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium708Open in IMG/M
3300005937|Ga0081455_10805736All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium589Open in IMG/M
3300006194|Ga0075427_10115867All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium507Open in IMG/M
3300006845|Ga0075421_100261851All Organisms → Viruses → Predicted Viral2116Open in IMG/M
3300009081|Ga0105098_10048596All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium1724Open in IMG/M
3300009094|Ga0111539_10597013All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium1286Open in IMG/M
3300009094|Ga0111539_11594662All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium757Open in IMG/M
3300009094|Ga0111539_11959817All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium679Open in IMG/M
3300009095|Ga0079224_100823786All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium1328Open in IMG/M
3300009124|Ga0118687_10219388All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium697Open in IMG/M
3300009146|Ga0105091_10352866All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium726Open in IMG/M
3300009146|Ga0105091_10474913All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium632Open in IMG/M
3300009148|Ga0105243_11166335All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium782Open in IMG/M
3300009156|Ga0111538_13726296All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium528Open in IMG/M
3300009157|Ga0105092_10000815All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes16568Open in IMG/M
3300009157|Ga0105092_10497903All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium698Open in IMG/M
3300009168|Ga0105104_10000222All Organisms → cellular organisms → Bacteria43289Open in IMG/M
3300009168|Ga0105104_10256266All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium956Open in IMG/M
3300009609|Ga0105347_1000345Not Available22754Open in IMG/M
3300009609|Ga0105347_1029351All Organisms → Viruses → Predicted Viral1913Open in IMG/M
3300010154|Ga0127503_10513436All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium1629Open in IMG/M
3300010154|Ga0127503_10776515All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium647Open in IMG/M
3300010354|Ga0129333_10039654All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium4437Open in IMG/M
3300011403|Ga0137313_1003072All Organisms → Viruses → Predicted Viral3373Open in IMG/M
3300011403|Ga0137313_1038169All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium812Open in IMG/M
3300011413|Ga0137333_1004904All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium2962Open in IMG/M
3300011415|Ga0137325_1075970All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium741Open in IMG/M
3300011417|Ga0137326_1028721All Organisms → Viruses → Predicted Viral1191Open in IMG/M
3300011432|Ga0137428_1129394All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium733Open in IMG/M
3300011445|Ga0137427_10312728All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium661Open in IMG/M
3300012142|Ga0137343_1038560All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium676Open in IMG/M
3300012212|Ga0150985_103898325All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium762Open in IMG/M
3300012212|Ga0150985_112890047All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium743Open in IMG/M
3300012469|Ga0150984_103462605All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium632Open in IMG/M
3300012469|Ga0150984_105409980All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium2847Open in IMG/M
3300012681|Ga0136613_10652243All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium564Open in IMG/M
3300012900|Ga0157292_10056349All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium1072Open in IMG/M
3300012955|Ga0164298_10652890All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium731Open in IMG/M
3300012961|Ga0164302_10302572All Organisms → Viruses → Predicted Viral1045Open in IMG/M
3300012971|Ga0126369_10000135Not Available44032Open in IMG/M
3300012984|Ga0164309_10160758All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium1505Open in IMG/M
3300012987|Ga0164307_10081794All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium1965Open in IMG/M
3300014871|Ga0180095_1000184All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium4867Open in IMG/M
3300014880|Ga0180082_1050500All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium886Open in IMG/M
3300014880|Ga0180082_1097705All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium663Open in IMG/M
3300015077|Ga0173483_10251007All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium842Open in IMG/M
3300015200|Ga0173480_10149983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1190Open in IMG/M
3300015200|Ga0173480_10449251All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium760Open in IMG/M
3300015201|Ga0173478_10767843All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium525Open in IMG/M
3300015371|Ga0132258_10679751All Organisms → Viruses → Predicted Viral2590Open in IMG/M
3300015371|Ga0132258_12588551All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium1268Open in IMG/M
3300018032|Ga0187788_10052630All Organisms → Viruses → Predicted Viral1386Open in IMG/M
3300018055|Ga0184616_10000008Not Available45948Open in IMG/M
3300018072|Ga0184635_10000724All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla8824Open in IMG/M
3300018074|Ga0184640_10356443All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium663Open in IMG/M
3300018083|Ga0184628_10057056All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium1976Open in IMG/M
3300018083|Ga0184628_10132929All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium1290Open in IMG/M
3300018481|Ga0190271_10025772All Organisms → cellular organisms → Bacteria4643Open in IMG/M
3300019889|Ga0193743_1027042All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium2819Open in IMG/M
3300021082|Ga0210380_10084922All Organisms → Viruses → Predicted Viral1391Open in IMG/M
3300021437|Ga0213917_1028709All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium624Open in IMG/M
3300022908|Ga0247779_1045262All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300022917|Ga0247777_1172181All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium706Open in IMG/M
3300023169|Ga0247762_1094802All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium828Open in IMG/M
3300024287|Ga0247690_1003485All Organisms → Viruses → Predicted Viral1942Open in IMG/M
3300025927|Ga0207687_10240434All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium1434Open in IMG/M
3300025935|Ga0207709_11604673All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium540Open in IMG/M
3300026643|Ga0207923_100076All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium939Open in IMG/M
3300027362|Ga0208320_1024373All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium699Open in IMG/M
3300027513|Ga0208685_1005602All Organisms → Viruses → Predicted Viral3365Open in IMG/M
3300027513|Ga0208685_1121496All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium560Open in IMG/M
3300027573|Ga0208454_1090840All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium712Open in IMG/M
3300027675|Ga0209077_1000016Not Available43659Open in IMG/M
3300027675|Ga0209077_1027257Not Available1543Open in IMG/M
3300027743|Ga0209593_10000102Not Available43290Open in IMG/M
3300027743|Ga0209593_10000107Not Available42993Open in IMG/M
3300027821|Ga0209811_10000094Not Available39563Open in IMG/M
3300027874|Ga0209465_10000075Not Available43923Open in IMG/M
3300027874|Ga0209465_10001028All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes12627Open in IMG/M
3300027907|Ga0207428_10904506All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium623Open in IMG/M
3300027909|Ga0209382_10293777All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium1834Open in IMG/M
3300027991|Ga0247683_1005153All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium1143Open in IMG/M
3300028009|Ga0265348_100016Not Available3574Open in IMG/M
3300028035|Ga0265347_102551All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium592Open in IMG/M
3300028646|Ga0302159_10111747All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium618Open in IMG/M
3300028676|Ga0302167_10078455All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium962Open in IMG/M
3300028772|Ga0302209_10191237All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium577Open in IMG/M
3300028868|Ga0302163_10213188All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium538Open in IMG/M
3300030019|Ga0311348_10124356All Organisms → Viruses → Predicted Viral1912Open in IMG/M
3300031057|Ga0170834_104799663All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium1020Open in IMG/M
3300034113|Ga0364937_023863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Pedococcus → Pedococcus cremeus1030Open in IMG/M
3300034115|Ga0364945_0045653All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium1213Open in IMG/M
3300034147|Ga0364925_0000190Not Available19242Open in IMG/M
3300034149|Ga0364929_0000825All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium6696Open in IMG/M
3300034149|Ga0364929_0107072All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium884Open in IMG/M
3300034690|Ga0364923_0138289All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium630Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil18.35%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment10.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.09%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.34%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment5.50%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.59%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen4.59%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter4.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.75%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere2.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.75%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.83%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.83%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.83%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.83%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.92%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.92%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.92%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.92%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.92%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.92%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.92%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005276Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006194Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009095Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300011403Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2EnvironmentalOpen in IMG/M
3300011413Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2EnvironmentalOpen in IMG/M
3300011415Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2EnvironmentalOpen in IMG/M
3300011417Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012134Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT142_2EnvironmentalOpen in IMG/M
3300012142Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT499_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012681Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06)EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300014871Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1DaEnvironmentalOpen in IMG/M
3300014880Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10DEnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015255Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019889Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021437Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17 MGEnvironmentalOpen in IMG/M
3300022908Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L221-509R-5EnvironmentalOpen in IMG/M
3300022917Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L154-409C-5EnvironmentalOpen in IMG/M
3300023169Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L081-202R-4EnvironmentalOpen in IMG/M
3300024287Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026643Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized -NN338 (SPAdes)EnvironmentalOpen in IMG/M
3300027362Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 (SPAdes)EnvironmentalOpen in IMG/M
3300027513Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)EnvironmentalOpen in IMG/M
3300027573Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)EnvironmentalOpen in IMG/M
3300027675Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027991Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK24EnvironmentalOpen in IMG/M
3300028009Plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE6EnvironmentalOpen in IMG/M
3300028035Plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE5EnvironmentalOpen in IMG/M
3300028646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_2EnvironmentalOpen in IMG/M
3300028676Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_1EnvironmentalOpen in IMG/M
3300028772Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_1EnvironmentalOpen in IMG/M
3300028868Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3EnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300034113Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17EnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034690Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10452316213300000364SoilMQFTTFVRKPFVVEAVEVTKDNISEVAKYVGDLRQKEDGTPYILVDPRLVPNVPDIFRVYPGFFMTKMGENVRCYSRKIFTEQFMAPGD
Ga0063356_10092219813300004463Arabidopsis Thaliana RhizosphereMEFKPFVRKPFVVEAVEVTKENIAEIAKYVGELREKDDGTPFIYVDRRLVPNIFRVYPGFFMTRMGDHIRCYSQKVFFEQFTESDDKIQEWVDFLNAGGLPNSRTKTG*
Ga0066395_10000058483300004633Tropical Forest SoilMDFTNFVRKPFVVEAVEVTIDNIGEVAKYVGDLREEEDGTKYILVDHRLVPNVMRVYPGFYMTKMGKKVRCYSRKIFREQFVEEDENIRPWVEFMEANSV*
Ga0062591_10143732323300004643SoilMEFTQYVRKPFIVEAVEVTVENMAEVAKYVGEMRHKDDGMPFIYVDRRLVPNVFRVYPGFYMTRMGNHIRCYSRKVFLEQFVPSHPDIVTWVDFLNNGGVENSRTKTTEGATT*
Ga0065717_100359823300005276Arabidopsis RhizosphereMQFTTFVRKPFVVEAVEVTKDNISEVAKYVGDLRQKEDGTPYILVDPRLVPNVPDIFRVYPGFFMTKMGENVRCYSRKIFTEQFMAPGDVKPWVDEMVNDFAAGGVGINIYDDKDVNVRK
Ga0068868_10000362563300005338Miscanthus RhizosphereMKIRQLLTRSKKKSPPFIRKIGNMEFTTYVRKPFVVEAVEITKENIAEVAKFVGDLREKEDGTPYILVDRRLVPNVFRVYPEFFMTKMGENVRCYSRKIFHDQFTEQTEDIEPWVKFINSDKSEAPSS*
Ga0070673_10027933823300005364Switchgrass RhizosphereMEFTTYVRKPFVVEAVEITKENIAEVAKFVGDLREKEDGTPYILVDRRLVPNVFRVYPEFFMTKMGENVRCYSRKIFHDQFTEQTEDIEPWVKFINSDKSEAPSS*
Ga0073909_10000088443300005526Surface SoilMEFATFVRKPFVVEAVEVTAANIAEVAKYVGDLREKEDGTPYILVDRRLVPNVFRVYPGFFMTKMGENVRCYSRKIFKEQFTETTDKINAWVEFMSSPEPKEAQ*
Ga0068864_10142310013300005618Switchgrass RhizosphereNMEFTTYVRKPFVVEAVEITKENIAEVAKFVGDLREKEDGTPYILVDRRLVPNVFRVYPEFFMTKMGENVRCYSRKIFHDQFTEQTEDIEPWVKFINSDKSEAPSS*
Ga0081455_1022835423300005937Tabebuia Heterophylla RhizosphereMEFTTFVRKPFVVEAVEVTAENIAEVAKYVGDLREKEDGTQYILVDRRLVPNVFRVYPGFYMTKMGENVRCYSRKIFREQFVEEDDNIRPWLEFMEKQAV*
Ga0081455_1061194913300005937Tabebuia Heterophylla RhizosphereMNFSTFVRKPFAVEAIEVTTENIAEVAKYVGDLREKEDGTPYVLVDQRLVPNVDRVYPGFYMTRMGENVRCYSKKIFREQFIEQDDKVKQWVDFVNGKEKNG*
Ga0081455_1080573623300005937Tabebuia Heterophylla RhizosphereMQFTTFVRKPFVVEAVEVTKDNISEVAKYVGDLRQKEDGTPYILVDPRLVPNVPDIFRVYPGFFMTKMGENVRCYSRKIFTEQFMEPQEVKPWVDEMINDFSVDADVGINIYDDSDVNARR*
Ga0075427_1011586713300006194Populus RhizosphereMDFDTFVRKPFVVQAVEITKENIEEVAQFVGTLRKKEDGTPYILVDQRLVPNVFRVYPGFFMTKMGENFRCYSRRIFLDQFIPKDDSTQQWLDYLNGDSDEIEVEPI
Ga0075421_10026185133300006845Populus RhizosphereMDFDTFVRKPFVVQAVEITKENIEEVAQFVGTLRKKEDGTPYILVDQRLVPNVFRVYPGFFMTKMGENFRCYSRRIFLDQFIPKDDSTQQWLDYLNGDSDEIEVEPISAPT*
Ga0105098_1004859633300009081Freshwater SedimentMETDIPISSNPTNEKRNPMEFATFVRKPFVVEAIEITAENIGEVAKYVGDLREKEDGTPYILVDRRLVPNVFKVYPGFYMTKMGENIRCYSRKIFREQFMEQTDEIKPWVDYMTGNTEPVAS*
Ga0111539_1059701313300009094Populus RhizosphereHPPDVPEPDPTPEIGKPKAMNFTTFVRKPFVVDAVEITPENIEEVAKYVGDLREKEDGTKYILVDRRLVPNVFRVYTGFYMTKMGENIRCYSRKIFKEQFTEHNDSVQPWLDFMESQDAATPVG*
Ga0111539_1159466223300009094Populus RhizosphereMEFATFVRKPFVVDAVEITTENIAEVAKYVGDLREKEDGTPYILVDRRLVPNVFKVYPGFYMTKMGENIRCYSRKIFREQFMEQTEEIKPWIDYMTGNTETVSS*
Ga0111539_1195981713300009094Populus RhizosphereLPLPNKENQMDFDTFVRKPFVVQAVEITKENIEEVAQFVGTLRKKEDGTPYILVDQRLVPNVFRVYPGFFMTKMGENFRCYSRRIFLDQFIPKDDSTQQWLDYLNGDSDEIQVEPISAPT
Ga0079224_10082378613300009095Agricultural SoilMNFNQYVRKPFVVEAVEVTEENLEEVAKFVGEVREKQGSGRYIQVDRRIVPNVYRVYPGFFMTRMGDHIRCYNPKIFHEQFVEGNPEIIAWVDFMHGKKVEEIAE*
Ga0118687_1021938823300009124SedimentMEEANKTSLGFSNHVRKPFIVEAVEITAANIHEVAKFVGDVEEKEDGTPFIKVDRRLVPNVYRVYVGFYMTRMGDHIRCYSRKVFNEQFTVLTPDIKTWVDFMNETKDV*
Ga0105091_1035286613300009146Freshwater SedimentMHFTTFVRKPFSVKAVEVTTENIAEIAKYVGDLKEKEDGTPYILVDQRMVPNVERVYPGFYMTKMGENVRCYSRRIFREQF
Ga0105091_1047491313300009146Freshwater SedimentKPFVVEAVEITNENIEQVAKHVGDLRDGDDGSKYILVDLRLVPNVDRVYPGFFMTKMGKNVRCYSRRVFREQFIENDDTVKPWVDFMEQKAGA*
Ga0105243_1116633513300009148Miscanthus RhizosphereIRQLLTRSKKKSPPFIRKIGNMEFTTYVRKPFVVEAVEITKENIAEVAKFVGDLREKEDGTPYILVDRRLVPNVFRVYPEFFMTKMGENVRCYSRKIFHDQFTEQTEDIEPWVKFINSDKSEAPSS*
Ga0111538_1372629613300009156Populus RhizosphereNKENQMDFDTFVRKPFVVQAVEITKENIEEVAQFVGTLRKKEDGTPYILVDQRLVPNVFRVYPGFFMTKMGENFRCYSRRIFLDQFIPKDDSTQQWLDYLNGDSDEIQVEPISAPT*
Ga0105092_10000815123300009157Freshwater SedimentMEFTTFVRKPFTVKGVEITAQNIEEVSKYIGELRDVGDGTKYILVDPRVVPNLEKVYTGFYMTKMGQNVRCYSRRVFREQFIEEDDSIRPWLEFMDKKGQ*
Ga0105092_1049790313300009157Freshwater SedimentMETDIPISSNQTNEKRNPMEFATFVRKPFVVEAIEITAENIGEVAKYVGDLREKEDGTPYILVDRRLVPNVFKVYPGFYMTKMGENIRCYSRKIFREQFMEQTDEIKPWVDYMTSGETSAA*
Ga0105104_10000222163300009168Freshwater SedimentMRTPRQKLEVRTRRKNEQGSSMEFTTFVRKPFTVKGVEITAQNIEEVSKYIGELRDVGDGTKYILVDPRVVPNLEKVYTGFYMTKMGQNVRCYSRRVFREQFIEEDDSIRPWLEFMDKKGQ*
Ga0105104_1025626623300009168Freshwater SedimentMEFATFVRKPFVVEAIEITAENIGEVAKYVGDLREKEDGTPYILVDRRLVPNVFKVYPGFYMTKMGENIRCYSRKIFREQFMEQTDEIKPWIDYMTGNAEPVAS*
Ga0105347_1000345123300009609SoilMQFTTFVRKPFVVDAVEVTTENIAEVAKYVGDLREKEDGTPYILVDRRLVPNVFRVYPGFFMTKMGENVRCYSRKIFKEQFMVQTDEIKPWVDFMAKSGDSQ*
Ga0105347_102935153300009609SoilMLRNRDSTKHERNPQLMDFTVFVRKPFMVMAVEVTVENINEVSKYVGDLREKEDGTPYILVDPRLVPNVERVYPGFYMTKMGENVRCYSRKIFRDQFTEQTEKNKEWVAFMNA*
Ga0127503_1051343633300010154SoilMEFTTFVRKPFVVQAVEVTAENINEVAKYIGDVREREDGTQYILVDRRLVPNVFKVYPGFFMTKMGENVRCYSRKIFREQFVEEDESIKPWVEFMEKRGV*
Ga0127503_1077651513300010154SoilMKFTTFVRKPFVVEAVEITVENISEVAKYVGDLREMEDGAPYILVDNRLVPNVNRVFPGFYMTKIGGKVRCYSKKIFREQFIEQTDEIKPWVDFMTGNDSGG*
Ga0129333_1003965443300010354Freshwater To Marine Saline GradientMDFTTFVRKPFVVEAVEITTDNIEEVAKYIGDVREKDDGTKYILVDRRLVPNVEKVYPGFFMTKMGENVRCYSRKIFREQFMERTEEVQPWLDFMESQSV*
Ga0137313_100307223300011403SoilMEFSEYVRKPFVVEAIEVTTENIAEVAKYVGEVREKEDGTPFILVDRRLIPNVFRVYPGYWMTRMGDHIRCYSRKIFLEQFVESHPDIIAWVDFMNNGGVENSRTNVGLAAVTIDVIPNGT*
Ga0137313_103816913300011403SoilIEMEFTTFVRKPFEVLAVEITKDNIAEVAKLVGDLKEKEDGTPFILVDKRLVPNVFRVFPGFWMTKMGDNIRCYSKKIFTDQFVESNEEIKQWVDWMNGVGDEPEAAEEEVA*
Ga0137333_100490413300011413SoilEVLAVEITKDNIAEVAKLVGDLKEKEDGTPFILVDKRLVPNVFRVFPGFWMTKMGDNIRCYSKKIFTDQFVESNEEIKQWVDWMNGVGDEPEAAEEDVA*
Ga0137325_107597013300011415SoilTFVRKPFVVDAVEITTENIAEVAKYVGDLREKEDGTPYILVDRRLVPNVFKVYPGFYMTKMGENIRCYSRKIFREQFMEQTDEIKPWIDYMTGNAEPSVA*
Ga0137326_102872123300011417SoilMEFATFVRKPFVVDAVEITTENIAEVAKYVGDLREKEDGTPYILVDRRLVPNVFKVYPGFYMTKMGENIRCYSRKIFREQFMEQTDEIKPWIDYMTGNAEPSVA*
Ga0137428_112939423300011432SoilFVVEAIEVTTENIAEVAKYVGEVREKEDGTPFILVDRRLIPNVFRVYPGYWMTRMGDHIRCYSRKIFLEQFVESHPDIIAWVDFMNNGGVENSRTNVGLAAVTIDVIPNGT*
Ga0137427_1031272823300011445SoilDAVEITTENIAEVAKYVGDLREKEDGTPYILVDRRLVPNVFKVYPGFYMTKMGENIRCYSRKIFREQFMEQTEEIKPWIDYMTGNTEAVSS*
Ga0137330_100124453300012134SoilMEFTTFVRKPFEVLAVEITKDNIAEVAKLVGDLKEKEDGTPFILVDKRLVPNVFRVFPGFWMTKMGDNIRCYSKKIFTDQFV
Ga0137343_103856013300012142SoilLKHNQKETRNQQMEFSEYVRKPFVVEAIEVTTENIAEVAKYVGEVREKEDGTPFILVDRRLIPNVFRVYPGYWMTRMGDHIRCYSRKIFLEQFVESHPDIIAWVDFMNNGGVENSRTNVGLAAVTIDVIPNGT*
Ga0150985_10389832513300012212Avena Fatua RhizosphereVEVTTDNISEVAKYVGDLREEDDGTQYILVDRRLVPNIARVYTGFYMTKMGKNVRCYSRKIFRDQFIEEDENVKPWVEYMASDKAEV*
Ga0150985_11289004723300012212Avena Fatua RhizosphereFVVQAVEVTVDNINEVAKYVGDVREKEDGTLYILVDRRLVPNVFRVYPGFFMTKMGENVRCYSRKIFREQFVEEDDNMRQWVEFMEKQP*
Ga0150984_10346260523300012469Avena Fatua RhizosphereMEFTPYVRKPFVVQAVEITSDNINEVAKYIGDVREREDGTQYILVDRRLVPNVFKVYPGFFMTKMGENIRCYSRKIFREQFIEEDESITPWVEFMERRG*
Ga0150984_10540998033300012469Avena Fatua RhizosphereMQIKLLPRSKADRGNHMDFKSFVRKPFVVQAVEVTVDNINEVAKYVGDVREKEDGTLYILVDRRLVPNVFRVYPGFFMTKMGENVRCYSRKIFREQFVEEDDNMRQWVEFMEKQP*
Ga0136613_1065224313300012681Polar Desert SandMDFTTFVRKPFAVEAVEVTEENIAEIAKLVGTLREKDDGSSYIHVDRRLVPNVFRVFPGFWMTKMGDNVRCYSNLVFRNQFIESSLDIENLVTLLNDHALE
Ga0157292_1005634923300012900SoilMEFTQYVRKPFLVEAVEVTAENMAEVAKYVGEMREKDDGTPFIYVDRRLVPNVFRVYPGFYMTRMGDHIRCYSRKVFLEQFVPSHPDVVAWVEFINNGDGKTQTPKGVTT*
Ga0164298_1065289013300012955SoilMQFTTFVRKPFVVEAVEVTADNIAEVAKYVGDLREEDDGTQYILVDRRLVPNIARVYTGFYMTKMGKNVRCYSRKIFRDQFIEEDENVKPWVDYMADKSEASQV*
Ga0164302_1030257233300012961SoilMQFTTFVRKPFVVEAVEVTADNIAEVAKYVGDLREEDDGTQYILVDRRLVPNIARVYTGFYMTKMGKNVRCYSRKIFRDQFIEEDENVKPWVDYMSDKAEAPQA*
Ga0126369_10000135153300012971Tropical Forest SoilMGAKIFGKHKKPDGRGQSMDFTNFVRKPFVVEAVEVTIDNIGEVAKYVGDLREEEDGTKYILVDHRLVPNVMRVYPGFYMTKMGKKVRCYSRKIFREQFVEEDENIRPWVEFMEANSV*
Ga0164309_1016075813300012984SoilQRIRMQFTTFVRKPFVVEAVEVTADNIAEVAKYVGDLREEDDGTQYILVDRRLVPNIARVYTGFYMTKMGKNVRCYSRKIFRDQFIEEDENVKPWVDYMADKSEASQV*
Ga0164307_1008179413300012987SoilPFVVEAVEVTADNIAEVAKYVGDLREEDDGTQYILVDRRLVPNIARVYTGFYMTKMGKNVRCYSRKIFRDQFIEEDENVKPWVDYMSDKAEAPQA*
Ga0180095_100018453300014871SoilMEFTTFVRKPFEVLAVEITKDNIAEVAKLVGDLKEKEDGTPFILVDKRLVPNVFRVFPGFWMTKMGDNIRCYSKKIFTDQFVESNEEIKQWVDWMNGVGDEPEAAEEDVA*
Ga0180082_105050023300014880SoilMEFTTFVRKPFEVLAVEITKDNIAEVAKLVGDLKEKEDGTPFILVDKRLVPNVFRVFPGFWMTKMGDNIRCYSKKIFTDQFVESNEEIKQWVDWMNGVGDEPEAAEEEVA*
Ga0180082_109770513300014880SoilMEFSEYVRKPFVVEAIEVTTENIAEVAKYVGEVREKEDGTPFILVDRRLIPNVFRVYPGYWMTRMGDHIRCYSRKIFLEQFVESHPDIIAWVDFMN
Ga0173483_1025100723300015077SoilMEFTQYVRKPFLVEAVEVTAENMAEVAKYVGEMREKDDGTPFIYVDRRLVPNVFRVYPGFYMTRMGDHIRCYSRKVFLEQFVQSHPDIVAWVEFINNGDGKTQTPKGVTT*
Ga0173480_1014998333300015200SoilMEFTQYVRKPFLVEAIEVTAENMAEVAKYVGEMREKDDGTPFIYVDRRLVPNVFRVYPGFYMTRMGDHIRCYSRKVFLEQFVPSHPDIVTWVDFLNNGGVENSRTKTTEGATT*
Ga0173480_1044925113300015200SoilMESGMEFSTFVRKPFIVEAVEITEENIGELAELVGALREKEDGTPYIQVDRRLVPNIYRVYPGFWMTKMGDNIRCYSQKVFREQFTRNEPDIDTWVKFMNGSPNKNIFGYESA*
Ga0173478_1076784313300015201SoilMEFSQYVRKPFLVEAVEVTAENMAEVAKYVGEMREKDDGTPFIYVDRRLVPNVFRVYPGFYMTRMGDHIRCYSRKVFLEQFVPSHPDVVAWVEFINNGDGKTQTPKGVTT*
Ga0180077_101224013300015255SoilAVEITKDNIAEVAKLVGDLKEKEDGTPFILVDKRLVPNVFRVFPGFWMTKMGDNIRCYSKKIFTDQFVESNEEIKQWVDWMNGVGDEPEAAEEDVA*
Ga0180077_102563613300015255SoilAVEITKDNIAEVAKLVGDLKEKEDGTPFILVDKRLVPNVFRVFPGFWMTKMGDNIRCYSKKIFTDQFVESNEEIKQWVDWMNGVGDEPEAAEEEVA*
Ga0132258_1067975133300015371Arabidopsis RhizosphereMALKFPSHKKNNHQGSPMEFTRFVRKPFVVEAIEITAENIEEVAKYVGDVRVEEDDGTKYILVDRRLVPNVFRVYPGFFMTKMGRNVRCYSRKIFREQFVEEDEDIRPWLDFMEVERNKTG*
Ga0132258_1258855153300015371Arabidopsis RhizosphereMNFTTFVRKPFVVDAVEVTLENIGEVAKYVGDLREKENGTPYILVDRRLVPNVDRVYPGFFMTKMGENVRCYSRKIFKEQFMQQTDEIK
Ga0187788_1005263023300018032Tropical PeatlandMDFATFVRKPFVVEAVEVTTENIAEVAKYVGDLREKEDGTPYILVDRRLVPNVYRVYPGFFMTKMGENVRCYSKKIFKEQFMSQTDEIKPWVDFMMNTTESAA
Ga0184616_10000008243300018055Groundwater SedimentMRSQTQLKRIEMEFTTFVRKPFEVLAVEITKDNIAEVAKLVGDLKEKEDGTPFILVDKRLVPNVFRVFPGFWMTKMGDNIRCYSKKIFTDQFVESNEEIKQWVDWMNGVGDEPEAAEEDV
Ga0184635_1000072463300018072Groundwater SedimentMEFATFVRKPFVVEAIEITAENIGEVAKYVGDLREKEDGTPYILVDRRLVPNVFKVYPGFYMTKMGENIRCYSRKIFREQFMEQTDEIKPWIDYMTGNAEPVAS
Ga0184640_1035644323300018074Groundwater SedimentMEFATFVRKPFVVEAIEITAENIGEVAKYVGDLREKEDGTPYILVDRRLVPNVFKVYPGFYMTKMGENIRCYSRKIFREQFMEQTDEIKPWVDYMTSGETSAA
Ga0184628_1005705663300018083Groundwater SedimentAVEITKDNIAEVAKLVGDLKEKEDGTPFILVDKRLVPNVFRVFPGFWMTKMGDNIRCYSKKIFTDQFVESNEEIKQWVDWMNGVGDEPEAAEEDVA
Ga0184628_1013292953300018083Groundwater SedimentAVEITKDNIAEVAKLVGDLKEKEDGTPFILVDKRLVPNVFRVFPGFWMTKMGDNIRCYSKKIFTDQFVESNEEIKQWVDWMNGVGDEPEAAEEEVA
Ga0190271_1002577233300018481SoilMEFTTFVRKPFVVEAVEVTSKNIAEVAKYVGDLREKEDGSPYILVDRRLVPNVFKVYPGFFMTKMGENVRCYSRKIFKEQFVEEDESIRPWIEFMEKHA
Ga0193743_102704273300019889SoilMETTTFVRKPFVVEAIEITTENIEEVAKHVGDLKEKEDGTPYILVDRRLVPNVFRVYPGFFMTKMGENIRCYSRKVFTDQFMEKDETIQPWLDFLEGGG
Ga0210380_1008492233300021082Groundwater SedimentMEFDTFVRKPFKVQAVEITRENIAEVAKYVGDLKEKDDGTPFILVDKRLVPNVFRVFPGFWMTRMGENVRCYSKKIFVEQFVQSTVEIDQWVDWMNGVGEEPEVEEVDA
Ga0213917_102870913300021437FreshwaterMEFTTYVRVPFRVEAVEITVDNIEEVAKYIGDVREKDDGTKYILVDRRLVPNVYRVFPGFFMTKMGENVRCYSRKIFLEQFAKVHTDPVDALV
Ga0247779_104526223300022908Plant LitterMEFTQYVRKPFIVEAVEVTVENMAEVAKYVGEMRHKDDGMPFIYVDRRLVPNVFRVYPGFYMTRMGNHIRCYSRKVFLEQFVPSHPDIVTWVDFLNNGGVENSRTKTTEGATT
Ga0247777_117218113300022917Plant LitterMDFTTFVRKPFVVEAVEVTAENINEVAKYIGDVREREDGTQYILVDRRLVPNVFKVYPGFFMTKMGENIRCYSRKIFKEQFIEKTAEVQPWIDFMDQQAS
Ga0247762_109480223300023169Plant LitterMEFSQYVRKPFLVEAVEVTAENMAEVAKYVGEMREKDDGTPFIYVDRRLVPNVFRVYPGFYMTRMGDHIRCYSRKVFLEQFVPSHPDVVAWVEFINNGDGKTQTPKGVTT
Ga0247690_100348533300024287SoilMLVFKDFVRKPFVVEAVEITAENIEEIAKIIGEIEEKEDGTKSIKVDRRLMPNLFRVEIGFYMTRMGDHVRCYNRKVFFRQFATLTPEIKTWVDFMTKAKS
Ga0207687_1024043423300025927Miscanthus RhizosphereMKIRQLLTRSKKKSPPFIRKIGNMEFTTYVRKPFVVEAVEITKENIAEVAKFVGDLREKEDGTPYILVDRRLVPNVFRVYPEFFMTKMGENVRCYSRKIFHDQFTEQTEDIEPWVKFINSDKSEAPSS
Ga0207709_1160467313300025935Miscanthus RhizosphereIRKIGNMEFTTYVRKPFVVEAVEITKENIAEVAKFVGDLREKEDGTPYILVDRRLVPNVFRVYPEFFMTKMGENVRCYSRKIFHDQFTEQTEDIEPWVKFINSDKSEAPSS
Ga0207923_10007633300026643SoilMQFSTFVRKPFIVDAIEVTAANIGEVAKYVGDLREKEDGTPYILVDRRLVPNVDRVYPGFFMTKMGENVRCYSRKIFRDQFIIQTPEIKPWIDFMVQNELPNGQPIA
Ga0208320_102437313300027362SoilMEFTTFVRKPFEVLAVEITKDNIAEVAKLVGDLKEKEDGTPFILVDKRLVPNVFRVFPGFWMTKMGDNIRCYSKKIFTDQFVESNEEIKQWVDWMNGVGDEPEAAEEEVA
Ga0208685_100560223300027513SoilMQFTTFVRKPFVVDAVEVTTENIAEVAKYVGDLREKEDGTPYILVDRRLVPNVFRVYPGFFMTKMGENVRCYSRKIFKEQFMVQTDEIKPWVDFMAKSGDSQ
Ga0208685_112149613300027513SoilMDFTVFVRKPFMVMAVEVTVENINEVSKYVGDLREKEDGTPYILVDPRLVPNVERVYPGFYMTKMGENVRCYSRKIFRDQFTEQTEKNKEWVAFMNA
Ga0208454_109084013300027573SoilFTVFVRKPFMVMAVEVTVENINEVSKYVGDLREKEDGTPYILVDPRLVPNVERVYPGFYMTKMGENVRCYSRKIFRDQFTEQTEKNKEWVAFMNA
Ga0209077_1000016413300027675Freshwater SedimentMDFTTYVRKPFVVEAVEITVANIGSIAKFVGDLREKEDGSPYILVDPRLVPNIERVYPGFFMTKMGENIRCYSRRIFKDQFMVQDDQIKPWVDYMMGDRSAA
Ga0209077_102725723300027675Freshwater SedimentMSTEKSEDWKVDSMHFTTFVRKPFSVKAVEVTTENIAEIAKYVGDLKEKEDGTPYILVDQRMVPNVERVYPGFYMTKMGENVRCYSRRIFREQFTEQNDTIKPWVEFMAGIGPEPILND
Ga0209593_10000102173300027743Freshwater SedimentMEFTTFVRKPFTVKGVEITAQNIEEVSKYIGELRDVGDGTKYILVDPRVVPNLEKVYTGFYMTKMGQNVRCYSRRVFREQFIEEDDSIRPWLEFMDKKGQ
Ga0209593_10000107143300027743Freshwater SedimentMETDIPISSNPTNEKRNPMEFATFVRKPFVVEAIEITAENIGEVAKYVGDLREKEDGTPYILVDRRLVPNVFKVYPGFYMTKMGENIRCYSRKIFREQFMEQTDEIKPWVDYMTGNTEPVAS
Ga0209811_10000094123300027821Surface SoilMEFATFVRKPFVVEAVEVTAANIAEVAKYVGDLREKEDGTPYILVDRRLVPNVFRVYPGFFMTKMGENVRCYSRKIFKEQFTETTDKINAWVEFMSSPEPKEAQ
Ga0209465_10000075123300027874Tropical Forest SoilMDFTNFVRKPFVVEAVEVTIDNIGEVAKYVGDLREEEDGTKYILVDHRLVPNVMRVYPGFYMTKMGKKVRCYSRKIFREQFVEEDENIRPWVEFMEANSV
Ga0209465_10001028163300027874Tropical Forest SoilMHFTTFVRKPFVVEAVEVTVDNIEEVAKYVGDLREKEDGTKYILVDRRLVPNVFRVYPGFFMTKMGENVRCYSRKIFKEQFVEEDENVKPWVEFMSAQA
Ga0207428_1090450613300027907Populus RhizosphereMDFDTFVRKPFVVQAVEITKENIEEVAQFVGTLRKKEDGTPYILVDQRLVPNVFRVYPGFFMTKMGENFRCYSRRIFLDQFIPKDDSTQQWLDYLNGDSDEIQVEPISAPT
Ga0209382_1029377753300027909Populus RhizosphereMDFDTFVRKPFVVQAVEITKENIEEVAQFVGTLRKKEDGTPYILVDQRLVPNVFRVYPGFFMTKMGENFRCYSRRIFLDQFIPKDDSTQQWLDYLNGDSDEIEVEPISAPT
Ga0247683_100515333300027991SoilKMEFATFVRKPFPVQAVEVTAENIAEVAKYVGDLREKDDGTPYILVDRRLVPNVFRVYPGFFMTRMGENVRCYSRKIFKEQFIQETEQIKEMADVINGNSQ
Ga0265348_10001663300028009Plant LitterMNFTTFVRKPFVVDAIEVTSENIAEVAKYVGDLREKEDGTPYILVDRRLVPNVFRVYPGFFMTKMGENVRCYSRKIFKEQFIVQTAEIKPWVEIMGKNDTAA
Ga0265347_10255113300028035Plant LitterMNFTTFVRKPFVVDAIEVTSENIAEVAKYVGDLREKEDGTPYILVDRRLVPNVFRVYPGFFMTKMGENVRCYSRKIFKEQFIVQTAEIKPWVEIMGKNDT
Ga0302159_1011174723300028646FenRKPFIVQAVEVTTENIEEVAKYIGDVREREDGTQYILVDRRLVPNVFKVYPGFFMTKMGENVRCYSRKIFKDQFIESTDDIKKWVEFLDDEERKTA
Ga0302167_1007845533300028676FenMIARLRTVKPFTRKRHSQNGINMEFKTFVRKPFIVQAVEVTTENIEEVAKYIGDVREREDGTQYILVDRRLVPNVFKVYPGFFMTKMGENVRCYSRKIFKDQFIESTDDIKKWVEFLDDEERKTA
Ga0302209_1019123723300028772FenMIARLRTVKPFTRKRHSQNGINMEFKTFVRKPFIVQAVEVTTENIEEVAKYIGDVREREDGTQYILVDRRLVPNVFKVYPGFFMTKMGENVRCYSRKIFKDQFIESTDDIKKWVE
Ga0302163_1021318823300028868FenPFTRKRHSQNGINMEFKTFVRKPFIVQAVEVTTENIEEVAKYIGDVREREDGTQYILVDRRLVPNVFKVYPGFFMTKMGENVRCYSRKIFKDQFIESTDDIKKWVEFLDDEERKTA
Ga0311348_1012435623300030019FenMEFKTFVRKPFIVQAVEVTTENIEEVAKYIGDVREREDGTQYILVDRRLVPNVFKVYPGFFMTKMGENVRCYSRKIFKDQFIESTDDIKKWVEFLDDEERKTA
Ga0170834_10479966323300031057Forest SoilMNFTTFVRKPFVVDAVEVTAENIAEVAKYVGDLREKEDGTPYILVDRRLVPNVFRVYPGFFMTKMGENVRCYSRKIFKEQFIIQTPEIKPWVEIMGKNDQGTAA
Ga0364937_023863_700_10293300034113SedimentVEAIEVTTENIAEVAKYVGEVREKEDGTPFILVDRRLIPNVFRVYPGYWMTRMGDHIRCYSRKIFLEQFVESHPDIIAWVDFMNNGGVENSRTNVGLAAVTIDVIPNGT
Ga0364945_0045653_288_6023300034115SedimentMEFATFVRKPFVVDAVEITTENIAEVAKYVGDLREKEDGTPYILVDRRLVPNVFKVYPGFYMTKMGENIRCYSRKIFREQFMEQTEEIKPWIDYMTGNTEAVSS
Ga0364925_0000190_13185_135503300034147SedimentMEFSEYVRKPFVVEAIEVTTENIAEVAKYVGEVREKEDGTPFILVDRRLIPNVFRVYPGYWMTRMGDHIRCYSRKIFLEQFVESHPDIIAWVDFMNNGGVENSRTNVGLAAVTIDVIPNG
Ga0364929_0000825_4966_52983300034149SedimentMEFTTFVRKPFEVLAVEITKDNIAEVAKLVGDLKEKEDGTPFILVDKRLVPNVFRVFPGFWMTKMGDNIRCYSKKIFTDQFVESNEEIKQWVDWMNGVGDEPEAAEEDVA
Ga0364929_0107072_589_8823300034149SedimentLAVEITKDNIAEVAKLVGDLKEKEDGTPFILVDKRLVPNVFRVFPGFWMTKMGDNIRCYSKKIFTDQFVESNEEIKQWVDWMNGVGDEPEAAEEEVA
Ga0364923_0138289_2_3103300034690SedimentMEFSEYVRKPFVVEAIEVTTENIAEVAKYVGEVREKEDGTPFILVDRRLIPNVFRVYPGYWMTRMGDHIRCYSRKIFLEQFVESHPDIIAWVDFMNNGGVENS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.