Metagenome / Metatranscriptome Family F084812

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F084812
Family Type	Metagenome / Metatranscriptome
Number of Sequences	112
Average Sequence Length	49 residues
Representative Sequence	MTKSSALKLDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN
Number of Associated Samples	48
Number of Associated Scaffolds	112

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	79.28 %
% of genes near scaffold ends (potentially truncated)	12.50 %
% of genes from short scaffolds (< 2000 bps)	65.18 %
Associated GOLD sequencing projects	37
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (66.964 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (76.786 % of family members)
Environment Ontology (ENVO)	Unclassified (93.750 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (83.036 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 41.56% β-sheet: 0.00% Coil/Unstructured: 58.44%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.63
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 112 Family Scaffolds
PF01381	HTH_3	8.93
PF12686	DUF3800	5.36
PF00589	Phage_integrase	4.46
PF00072	Response_reg	3.57
PF02899	Phage_int_SAM_1	3.57
PF00378	ECH_1	1.79
PF00990	GGDEF	1.79
PF00211	Guanylate_cyc	1.79
PF06296	RelE	1.79
PF03781	FGE-sulfatase	1.79
PF17191	RecG_wedge	1.79
PF01926	MMR_HSR1	0.89
PF06114	Peptidase_M78	0.89
PF13614	AAA_31	0.89
PF14317	YcxB	0.89
PF08984	DUF1858	0.89
PF13460	NAD_binding_10	0.89
PF00462	Glutaredoxin	0.89
PF00483	NTP_transferase	0.89
PF01047	MarR	0.89
PF01875	Memo	0.89
PF06250	YhcG_C	0.89
PF09954	DUF2188	0.89
PF01841	Transglut_core	0.89
PF01810	LysE	0.89
PF13411	MerR_1	0.89
PF02272	DHHA1	0.89
PF13581	HATPase_c_2	0.89
PF04773	FecR	0.89
PF06445	GyrI-like	0.89
PF01656	CbiA	0.89
PF00899	ThiF	0.89
PF00892	EamA	0.89
PF00578	AhpC-TSA	0.89
PF01042	Ribonuc_L-PSP	0.89
PF00155	Aminotran_1_2	0.89
PF04055	Radical_SAM	0.89
PF13426	PAS_9	0.89
PF01145	Band_7	0.89
PF13421	Band_7_1	0.89
PF00398	RrnaAD	0.89

COG ID	Name	Functional Category	% Frequency in 112 Family Scaffolds
COG4973	Site-specific recombinase XerC	Replication, recombination and repair [L]	3.57
COG4974	Site-specific recombinase XerD	Replication, recombination and repair [L]	3.57
COG1262	Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain	Posttranslational modification, protein turnover, chaperones [O]	1.79
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	1.79
COG4737	Uncharacterized conserved protein	Function unknown [S]	1.79
COG0030	16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity)	Translation, ribosomal structure and biogenesis [J]	0.89
COG0251	Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family	Defense mechanisms [V]	0.89
COG1355	Predicted class III extradiol dioxygenase, MEMO1 family	General function prediction only [R]	0.89
COG4804	Predicted nuclease of restriction endonuclease-like (RecB) superfamily, DUF1016 family	General function prediction only [R]	0.89

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	66.96 %
Unclassified	root	N/A	33.04 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	66.96 %
Unclassified	root	N/A	33.04 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	66.96 %
Unclassified	root	N/A	33.04 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.04 %
Spirochaetes	phylum	All Organisms → cellular organisms → Bacteria → Spirochaetes	21.43 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	4.46 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.79 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.04 %
unclassified Spirochaetota	no rank	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota	14.29 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	4.46 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	1.79 %
Spirochaetia	class	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia	0.89 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.04 %
Spirochaetae bacterium HGW-Spirochaetae-5	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5	13.39 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	4.46 %
Candidatus Melainabacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria	1.79 %
Leptospirales	order	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales	0.89 %
Spirochaetes bacterium ADurb.Bin218	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin218	0.89 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.04 %
Spirochaetae bacterium HGW-Spirochaetae-5	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5	13.39 %
Candidatus Gastranaerophilales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria → Candidatus Gastranaerophilales	1.79 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	1.79 %
Desulfobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	0.89 %
Leptospiraceae	family	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae	0.89 %
Spirochaetes bacterium ADurb.Bin218	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin218	0.89 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.04 %
Spirochaetae bacterium HGW-Spirochaetae-5	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5	13.39 %
unclassified Candidatus Gastranaerophilales	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria → Candidatus Gastranaerophilales → unclassified Candidatus Gastranaerophilales	1.79 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.79 %
Leptospira	genus	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira	0.89 %
Desulfobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	0.89 %
Spirochaetes bacterium ADurb.Bin218	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin218	0.89 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.04 %
Spirochaetae bacterium HGW-Spirochaetae-5	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5	13.39 %
Candidatus Gastranaerophilales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria → Candidatus Gastranaerophilales → unclassified Candidatus Gastranaerophilales → Candidatus Gastranaerophilales bacterium	1.79 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.79 %
Leptospira	genus	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira	0.89 %
Desulfobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	0.89 %
Spirochaetes bacterium ADurb.Bin218	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin218	0.89 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.89 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2044078019\|MiccSRB_F31IBB102F2D3V	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5	544	Open in IMG/M
2044078019\|MiccSRB_F31IBB102GLB8G	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5	535	Open in IMG/M
2044078019\|MiccSRB_F31IBB102HQPOD	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5	538	Open in IMG/M
2070309003\|MiccSRB_contig14173	Not Available	1354	Open in IMG/M
3300000470\|M590M1_1000184	All Organisms → cellular organisms → Bacteria	122003	Open in IMG/M
3300000568\|Draft_10046009	All Organisms → cellular organisms → Bacteria	23980	Open in IMG/M
3300000568\|Draft_10068096	All Organisms → cellular organisms → Bacteria	68281	Open in IMG/M
3300000568\|Draft_10173734	All Organisms → cellular organisms → Bacteria	8578	Open in IMG/M
3300002024\|MIS_1128028	Not Available	1078	Open in IMG/M
3300002446\|NAPDCCLC_10074781	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria → Candidatus Gastranaerophilales → unclassified Candidatus Gastranaerophilales → Candidatus Gastranaerophilales bacterium	3263	Open in IMG/M
3300004063\|Ga0055483_10104923	All Organisms → cellular organisms → Bacteria	878	Open in IMG/M
3300005263\|Ga0071346_1000661	All Organisms → cellular organisms → Bacteria	101173	Open in IMG/M
3300005403\|Ga0074197_1016473	All Organisms → cellular organisms → Bacteria → Spirochaetes	2036	Open in IMG/M
3300009666\|Ga0116182_1344969	Not Available	600	Open in IMG/M
3300009669\|Ga0116148_1163303	Not Available	1002	Open in IMG/M
3300009681\|Ga0116174_10058194	All Organisms → cellular organisms → Bacteria	2234	Open in IMG/M
3300009681\|Ga0116174_10184037	All Organisms → cellular organisms → Bacteria	1066	Open in IMG/M
3300009681\|Ga0116174_10475778	Not Available	571	Open in IMG/M
3300009682\|Ga0116172_10405300	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5	641	Open in IMG/M
3300009685\|Ga0116142_10505798	All Organisms → cellular organisms → Bacteria	574	Open in IMG/M
3300009688\|Ga0116176_10001079	All Organisms → cellular organisms → Bacteria	21638	Open in IMG/M
3300009690\|Ga0116143_10428232	All Organisms → cellular organisms → Bacteria	663	Open in IMG/M
3300009692\|Ga0116171_10000224	All Organisms → cellular organisms → Bacteria	59926	Open in IMG/M
3300009692\|Ga0116171_10000829	All Organisms → cellular organisms → Bacteria	32062	Open in IMG/M
3300009692\|Ga0116171_10003169	All Organisms → cellular organisms → Bacteria	15265	Open in IMG/M
3300009692\|Ga0116171_10010107	All Organisms → cellular organisms → Bacteria	7674	Open in IMG/M
3300009692\|Ga0116171_10011796	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	6952	Open in IMG/M
3300009692\|Ga0116171_10031385	All Organisms → cellular organisms → Bacteria	3693	Open in IMG/M
3300009692\|Ga0116171_10229682	Not Available	1037	Open in IMG/M
3300009692\|Ga0116171_10408317	All Organisms → cellular organisms → Bacteria → Spirochaetes	722	Open in IMG/M
3300009692\|Ga0116171_10420524	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	708	Open in IMG/M
3300009692\|Ga0116171_10477121	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5	655	Open in IMG/M
3300009693\|Ga0116141_10184813	Not Available	1163	Open in IMG/M
3300009693\|Ga0116141_10491102	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5	620	Open in IMG/M
3300009713\|Ga0116163_1003381	Not Available	8987	Open in IMG/M
3300009713\|Ga0116163_1017755	All Organisms → cellular organisms → Bacteria	3312	Open in IMG/M
3300009713\|Ga0116163_1077025	All Organisms → cellular organisms → Bacteria	1319	Open in IMG/M
3300009713\|Ga0116163_1111339	Not Available	1035	Open in IMG/M
3300009713\|Ga0116163_1173722	Not Available	771	Open in IMG/M
3300009713\|Ga0116163_1174885	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5	768	Open in IMG/M
3300009713\|Ga0116163_1193486	All Organisms → cellular organisms → Bacteria → Spirochaetes	718	Open in IMG/M
3300009713\|Ga0116163_1281341	Not Available	560	Open in IMG/M
3300009772\|Ga0116162_10038293	All Organisms → cellular organisms → Bacteria	2373	Open in IMG/M
3300009772\|Ga0116162_10118787	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin218	1189	Open in IMG/M
3300009772\|Ga0116162_10202391	Not Available	850	Open in IMG/M
3300009772\|Ga0116162_10263625	Not Available	719	Open in IMG/M
3300009772\|Ga0116162_10389632	Not Available	566	Open in IMG/M
3300009775\|Ga0116164_10096495	Not Available	1419	Open in IMG/M
3300009775\|Ga0116164_10309049	Not Available	668	Open in IMG/M
3300009776\|Ga0116154_10110435	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5	1237	Open in IMG/M
3300009776\|Ga0116154_10387466	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5	597	Open in IMG/M
3300009778\|Ga0116151_10499968	Not Available	542	Open in IMG/M
3300009779\|Ga0116152_10198592	Not Available	1036	Open in IMG/M
3300009780\|Ga0116156_10241476	All Organisms → cellular organisms → Bacteria → Spirochaetes	939	Open in IMG/M
3300009782\|Ga0116157_10175892	Not Available	1198	Open in IMG/M
3300009782\|Ga0116157_10677989	Not Available	516	Open in IMG/M
3300010346\|Ga0116239_10061103	All Organisms → cellular organisms → Bacteria	3420	Open in IMG/M
3300010346\|Ga0116239_10407819	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5	921	Open in IMG/M
3300010346\|Ga0116239_10408530	All Organisms → cellular organisms → Bacteria → Spirochaetes	920	Open in IMG/M
3300010346\|Ga0116239_10877907	Not Available	558	Open in IMG/M
3300010349\|Ga0116240_10121091	Not Available	2010	Open in IMG/M
3300010350\|Ga0116244_10022369	All Organisms → cellular organisms → Bacteria	5878	Open in IMG/M
3300010350\|Ga0116244_10050631	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3434	Open in IMG/M
3300010350\|Ga0116244_10069992	All Organisms → cellular organisms → Bacteria	2773	Open in IMG/M
3300010350\|Ga0116244_10114108	All Organisms → cellular organisms → Bacteria	2019	Open in IMG/M
3300010350\|Ga0116244_10470017	Not Available	832	Open in IMG/M
3300010350\|Ga0116244_10671627	Not Available	672	Open in IMG/M
3300010350\|Ga0116244_10836181	Not Available	591	Open in IMG/M
3300010351\|Ga0116248_10111900	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria → Candidatus Gastranaerophilales → unclassified Candidatus Gastranaerophilales → Candidatus Gastranaerophilales bacterium	2418	Open in IMG/M
3300010351\|Ga0116248_10306356	All Organisms → cellular organisms → Bacteria	1230	Open in IMG/M
3300010351\|Ga0116248_10791932	Not Available	661	Open in IMG/M
3300010352\|Ga0116247_10037606	All Organisms → cellular organisms → Bacteria	4776	Open in IMG/M
3300010352\|Ga0116247_10322374	All Organisms → cellular organisms → Bacteria	1230	Open in IMG/M
3300010352\|Ga0116247_10522174	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira	912	Open in IMG/M
3300010352\|Ga0116247_10574310	Not Available	860	Open in IMG/M
3300010352\|Ga0116247_10692332	Not Available	765	Open in IMG/M
3300010356\|Ga0116237_10504053	Not Available	1059	Open in IMG/M
3300010356\|Ga0116237_11082853	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5	670	Open in IMG/M
3300010429\|Ga0116241_10161827	All Organisms → cellular organisms → Bacteria	1877	Open in IMG/M
3300010429\|Ga0116241_10572324	Not Available	879	Open in IMG/M
3300014833\|Ga0119870_1036983	All Organisms → cellular organisms → Bacteria → Spirochaetes	1666	Open in IMG/M
3300015214\|Ga0172382_10462205	All Organisms → cellular organisms → Bacteria	939	Open in IMG/M
3300018030\|Ga0187869_10365678	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5	690	Open in IMG/M
3300019213\|Ga0179950_1035822	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5	1799	Open in IMG/M
3300019225\|Ga0179949_1044612	All Organisms → cellular organisms → Bacteria	1652	Open in IMG/M
3300020048\|Ga0207193_1023794	All Organisms → cellular organisms → Bacteria	7477	Open in IMG/M
3300020048\|Ga0207193_1098859	All Organisms → cellular organisms → Bacteria	2668	Open in IMG/M
3300020048\|Ga0207193_1242037	All Organisms → cellular organisms → Bacteria	1373	Open in IMG/M
3300020048\|Ga0207193_1366516	Not Available	976	Open in IMG/M
3300020048\|Ga0207193_1390039	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	934	Open in IMG/M
3300020048\|Ga0207193_1541926	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5	772	Open in IMG/M
3300020048\|Ga0207193_1866258	Not Available	519	Open in IMG/M
3300025611\|Ga0209408_1004800	All Organisms → cellular organisms → Bacteria	6479	Open in IMG/M
3300025611\|Ga0209408_1006341	All Organisms → cellular organisms → Bacteria	5267	Open in IMG/M
3300025611\|Ga0209408_1006842	All Organisms → cellular organisms → Bacteria	4965	Open in IMG/M
3300025611\|Ga0209408_1097329	Not Available	779	Open in IMG/M
3300025611\|Ga0209408_1155805	Not Available	560	Open in IMG/M
3300025702\|Ga0209203_1110023	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetae bacterium HGW-Spirochaetae-5	906	Open in IMG/M
3300025847\|Ga0209607_1127375	All Organisms → cellular organisms → Bacteria → Spirochaetes	1046	Open in IMG/M
3300025856\|Ga0209604_1344785	All Organisms → cellular organisms → Bacteria	536	Open in IMG/M
3300025858\|Ga0209099_1000945	All Organisms → cellular organisms → Bacteria	32065	Open in IMG/M
3300025858\|Ga0209099_1004763	All Organisms → cellular organisms → Bacteria	10132	Open in IMG/M
3300025858\|Ga0209099_1005169	All Organisms → cellular organisms → Bacteria	9550	Open in IMG/M
3300025858\|Ga0209099_1006876	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	7825	Open in IMG/M
3300025858\|Ga0209099_1007605	All Organisms → cellular organisms → Bacteria	7313	Open in IMG/M
3300025858\|Ga0209099_1146984	All Organisms → cellular organisms → Bacteria	960	Open in IMG/M
3300025858\|Ga0209099_1250762	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	657	Open in IMG/M
3300025861\|Ga0209605_1358068	Not Available	509	Open in IMG/M
3300027373\|Ga0209016_1098900	Not Available	603	Open in IMG/M
3300028603\|Ga0265293_10055679	All Organisms → cellular organisms → Bacteria	3571	Open in IMG/M
3300033169\|Ga0334887_1008067	All Organisms → cellular organisms → Bacteria	7610	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Engineered	Engineered	85.71%
Environmental	Environmental	14.29%

Habitat	Taxonomy	Distribution
Wastewater	Engineered → Wastewater	80.36%
Aquatic	Environmental → Aquatic	14.29%
Solid Waste	Engineered → Solid Waste	1.79%
Bioremediation	Engineered → Bioremediation	1.79%
Lab Enrichment	Engineered → Lab Enrichment	0.89%
Bioreactor	Engineered → Bioreactor	0.89%

Habitat	Taxonomy	Distribution
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	76.79%
Freshwater	Environmental → Aquatic → Freshwater	12.50%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	2.68%
Marine	Environmental → Aquatic → Marine	1.79%
Landfill	Engineered → Solid Waste → Landfill	1.79%
Tetrachloroethylene And Derivatives	Engineered → Bioremediation → Tetrachloroethylene And Derivatives	1.79%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.89%
Defined Media	Engineered → Lab Enrichment → Defined Media	0.89%
Anaerobic	Engineered → Bioreactor → Anaerobic	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	76.79%
Lake	Environmental → Aquatic → Freshwater → Lake	6.25%
Storm Water	Environmental → Aquatic → Freshwater → Storm Water	3.57%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	2.68%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified	1.79%
Tetrachloroethylene	Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene	1.79%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.89%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.89%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.89%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.89%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.89%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.89%
Anaerobic Media	Engineered → Lab Enrichment → Defined Media → Anaerobic Media	0.89%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	76.79%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	6.25%
Drainage Pipe Biofilm	Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm	3.57%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	2.68%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified → Unclassified	1.79%
Unclassified	Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified	1.79%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.89%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.89%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.89%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.89%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.89%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.89%
Unclassified	Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified	0.89%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	76.79%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	6.25%
Concrete Drainage Pipe Biofilm	Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm	3.57%
Hydrocarbon Resource Environments	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments	2.68%
Landfill Leachate	Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate	1.79%
Bioremediated Contaminated Groundwater	Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater	1.79%
Anaerobic Enrichment Culture	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture	0.89%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.89%
Sinkhole Freshwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater	0.89%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.89%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.89%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.89%
Hydrocarbon Resource Environments	Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments	0.89%
Sludge	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge	0.89%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2044078019	Concrete drainage pipe biofilm microbial communities from Ohio, US, sample, 12383	Environmental	Open in IMG/M
2070309003	Concrete drainage pipe biofilm microbial communities from Ohio, US - sample 12383, Newbler assembly	Environmental	Open in IMG/M
3300000470	Microbial Communities from Little Sippewissett Salt Marsh, Woods Hole, MA that are anoxygenic and photosynthetic, Photosynthetic Consortia grown using light of 590nm sample 1	Environmental	Open in IMG/M
3300000568	Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC:	Engineered	Open in IMG/M
3300002024	Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1k-1.5k	Environmental	Open in IMG/M
3300002446	Oil sands microbial community from Northern Alberta which degrade Naphthaline	Engineered	Open in IMG/M
3300004063	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2	Environmental	Open in IMG/M
3300005263	Freshwater pond sediment microbial communities from Middleton WI, enriched with Humic Acid Only under anaerobic conditions - HA Sample 3	Environmental	Open in IMG/M
3300005403	Bioremediated contaminated groundwater microbial communities from EPA Superfund site, New Mexico - SAE3-05 reassembly with SPADES	Engineered	Open in IMG/M
3300009666	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG	Engineered	Open in IMG/M
3300009669	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG	Engineered	Open in IMG/M
3300009681	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG	Engineered	Open in IMG/M
3300009682	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG	Engineered	Open in IMG/M
3300009685	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG	Engineered	Open in IMG/M
3300009688	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG	Engineered	Open in IMG/M
3300009690	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG	Engineered	Open in IMG/M
3300009692	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG	Engineered	Open in IMG/M
3300009693	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG	Engineered	Open in IMG/M
3300009713	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaG	Engineered	Open in IMG/M
3300009772	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC105_MetaG	Engineered	Open in IMG/M
3300009775	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC109_MetaG	Engineered	Open in IMG/M
3300009776	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG	Engineered	Open in IMG/M
3300009778	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG	Engineered	Open in IMG/M
3300009779	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC119_MetaG	Engineered	Open in IMG/M
3300009780	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG	Engineered	Open in IMG/M
3300009782	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG	Engineered	Open in IMG/M
3300010346	AD_USMOca	Engineered	Open in IMG/M
3300010349	AD_HKTAca	Engineered	Open in IMG/M
3300010350	AD_HKSTca	Engineered	Open in IMG/M
3300010351	AD_USPNca	Engineered	Open in IMG/M
3300010352	AD_JPHWca	Engineered	Open in IMG/M
3300010356	AD_USDEca	Engineered	Open in IMG/M
3300010429	AD_USRAca	Engineered	Open in IMG/M
3300014833	Activated sludge microbial communities from Shanghai, China - wastewater treatment plant - influent sewage	Engineered	Open in IMG/M
3300015214	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R metaG	Engineered	Open in IMG/M
3300018030	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100	Environmental	Open in IMG/M
3300019213	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNHW2_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019225	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNHW1_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300025611	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025702	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC109_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025847	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025856	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025858	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025861	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG (SPAdes)	Engineered	Open in IMG/M
3300027373	Bioremediated contaminated groundwater microbial communities from EPA Superfund site, New Mexico - SAE3-05 (SPAdes)	Engineered	Open in IMG/M
3300028603	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R	Engineered	Open in IMG/M
3300033169	Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_18_07-R1	Engineered	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
MiccSRB12980600	2044078019	Concrete Drainage Pipe Biofilm	MSKQSNLSLDNWSKGLLISLITKAISSDKDMTPDDIEKLKEIKKQLQEI
MiccSRB9043810	2044078019	Concrete Drainage Pipe Biofilm	MSKQSILKLDNWGKGLLISIISKAISSDKDITQDDIEKLKE
MiccSRB2380330	2044078019	Concrete Drainage Pipe Biofilm	MAKESSLKLDNWSKGLLISIISKAISNDKDITQDDIEKLKEIKKQLQEIN
MiccSRB_01066930	2070309003	Concrete Drainage Pipe Biofilm	MSKQSILKLDNWGKGLLISIISKAISSDKDITQDDIEKLKEIKKQLQEIQPPDKK
M590M1_100018437	3300000470	Salt Marsh	MSNSIKLDNYGKGLLVNIISKAISNDRDLTEDDVEKLKEIKKQLQEG*
Draft_1004600911	3300000568	Hydrocarbon Resource Environments	MIKNEAFKIDNYGKGLLVGLISKAISNDRDLTDDDIEKLKEIKKQLQEN*
Draft_1006809620	3300000568	Hydrocarbon Resource Environments	MTKSSALKLDNYGKGLLVNLISKAISNDRDLTDDDIEKLKEIKKQLQER*
Draft_101737343	3300000568	Hydrocarbon Resource Environments	MKKSALKLDNYGKGLLVSIISKSISNDKDLTPDDIEKLKEIKKQLQET*
MIS_11280283	3300002024	Sinkhole Freshwater	MAKTSSMKLDDWSKGLLISIISKAISSDKDITQDDIEKLKEIKKQLQEI*
NAPDCCLC_100747813	3300002446	Hydrocarbon Resource Environments	MTKNESFKIDNYGKGLLVGLISKAISNDRDLTDDDIEKLKEIKKQLQEN*
Ga0055483_101049232	3300004063	Natural And Restored Wetlands	MPKLTNLKLDDWGKGLLVNLISKAISNDKDLTSDDIDKLKIIKKQLQESIT*
Ga0071346_1000661103	3300005263	Anaerobic Enrichment Culture	MKKSSLNLDNHGKGLLIGLISKAINDDKNLASDDIEKLKEIKKQLQGE*
Ga0074197_10164732	3300005403	Bioremediated Contaminated Groundwater	MVKESTLKLDNWSKGLLISLISKAVSSDKDITQDDIEKLKEIKKQLQEI*
Ga0116182_13449691	3300009666	Anaerobic Digestor Sludge	MTKNEAFKIDNYGKGLLVGLISKAISNDRDLTDDDIEKLKEIKKQLQEN*
Ga0116148_11633031	3300009669	Anaerobic Digestor Sludge	MSKNESFKIDNYGKGLLVNLISKAISNDRDLTDDDIEKLKEIKKQLQEN*
Ga0116174_100581941	3300009681	Anaerobic Digestor Sludge	MKKSILKLDNYGKGLLVSIISKSISNDKDLTPDDVEKLKEIKKQ
Ga0116174_101840372	3300009681	Anaerobic Digestor Sludge	MAKSNALKLDNYGKGLLVNLISKAISNDRDLTDYDIEKLKEIKKQLQEN*
Ga0116174_104757781	3300009681	Anaerobic Digestor Sludge	MTKNESFKIDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN*
Ga0116172_104053002	3300009682	Anaerobic Digestor Sludge	MAKESSLKLDNWSKGLLISIISKAISNDKDITQDDIEKLKELKKQLQEN*
Ga0116142_105057982	3300009685	Anaerobic Digestor Sludge	MDYKMPKLTNLKLDDWGKGLLVNIISKAISNDKDLTNDDIEKLKLIKKQLQESIS*
Ga0116176_1000107920	3300009688	Anaerobic Digestor Sludge	MTKSNSIKLDNYGKGLLVGLISKAISNDRDLTDDDIDKLKEIKKQLQEN*
Ga0116143_104282322	3300009690	Anaerobic Digestor Sludge	MTKSSALKLDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN*
Ga0116171_1000022438	3300009692	Anaerobic Digestor Sludge	MSKNSIINLDNWGKGLLVNIISKALSNDRDLTADDIEKLKEIKKKLQEVY*
Ga0116171_100008293	3300009692	Anaerobic Digestor Sludge	MAKQSILKLDNWSKGLLISIISKAISSDKDITHDDIEKLKEIKKQLQETQPPDKK*
Ga0116171_1000316920	3300009692	Anaerobic Digestor Sludge	MAKQSDLKLDNWSKGLLISLISKAISSDKDITQDDIEKLKEIKKQLQEI*
Ga0116171_100101074	3300009692	Anaerobic Digestor Sludge	MKKSSLILDNHGKGLLIGLISKAINDDKSLASDDIEKLKEIKKQLQEE*
Ga0116171_100117962	3300009692	Anaerobic Digestor Sludge	MKKSSLNLDNHGKGLLIGLISKAINDDKTLASDDIEKLKEIKKQLQEE*
Ga0116171_100313852	3300009692	Anaerobic Digestor Sludge	MAKGSSLKLDNWSKGLLINLISKAIGSNKDITPDDIEKLKEIKKQLQEI*
Ga0116171_102296822	3300009692	Anaerobic Digestor Sludge	MAKESSLKFDNWSKGLLISIISKAISNDKDITQDDIEKLKELKKQLQEN*
Ga0116171_104083171	3300009692	Anaerobic Digestor Sludge	MNKNNIRIDDWGKGHLVTIINKAIGNDKDLTRDDIEKLKEIKKLLQGI*
Ga0116171_104205242	3300009692	Anaerobic Digestor Sludge	MKKSRLNLDNHGKGLLIQLISKAINNDKSLTSDDVEKLKEIKKQLQEE*
Ga0116171_104771212	3300009692	Anaerobic Digestor Sludge	MSKQSTLKLDNWSKGLLISIISKAISNDKDITQDDIEKLKELKKQLQETQPQDKK*
Ga0116141_101848132	3300009693	Anaerobic Digestor Sludge	MPKLTNLKLDDWGKGLLVNIISKAISNDKDMTNDDIEKLKLIKKQLQESIS*
Ga0116141_104911021	3300009693	Anaerobic Digestor Sludge	MTKQSTLKLDDWSKGLLINLISKAIRNDKDITQDDVEKLKEIKKQLQEI*
Ga0116163_10033818	3300009713	Anaerobic Digestor Sludge	MKKTDLKLDNYGRGLLVSIVSKAISNDRDLTPDDIEKLKEIKKQLQEA*
Ga0116163_10177555	3300009713	Anaerobic Digestor Sludge	MTKSNALKIDNYGKGLLVSLISKAISNDRDLTDDDIEKLKDIKKQLQEN*
Ga0116163_10770252	3300009713	Anaerobic Digestor Sludge	MKKSVLKLDNYGKGLLVSIISKSISNDKDLTPDDVEKLKEIKKQLQES*
Ga0116163_11113391	3300009713	Anaerobic Digestor Sludge	MIKKSSNSLDNWGKGLLINLISKSISNDKNLTQDDIEKLKKIKKELQEI*
Ga0116163_11737222	3300009713	Anaerobic Digestor Sludge	MINKSSIKLDNWGKGLLINLISKSISNDKNLTQDDIEKLKEIKKQLQEI*
Ga0116163_11748851	3300009713	Anaerobic Digestor Sludge	MAKNESFKIDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN*
Ga0116163_11934861	3300009713	Anaerobic Digestor Sludge	MTKSNSIKLDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN*
Ga0116163_12813412	3300009713	Anaerobic Digestor Sludge	FKIDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN*
Ga0116162_100382932	3300009772	Anaerobic Digestor Sludge	MKKTDLKLDNYGRGLLVSIVSKAISNDRDLTPDDIEKLKEIKKQLQET*
Ga0116162_101187871	3300009772	Anaerobic Digestor Sludge	MRHKKMKKNNSPITLDNYGKGLLIGIISRAISEDKSLAPDDIEKLKEIKKELQDI*
Ga0116162_102023912	3300009772	Anaerobic Digestor Sludge	MKKTDLKLDNYGRGLLVSIVSKAISNDRYLTPDDIEKLREIKKQLQEA*
Ga0116162_102636252	3300009772	Anaerobic Digestor Sludge	MAKNESFKIDNYGKGLLVNLISKAISNDRDLTDDDIEKLKEIKKQLQEN*
Ga0116162_103896321	3300009772	Anaerobic Digestor Sludge	KSSIKLDNWGKGLLINLISKSISNDKNLTQDDIEKLKEIKKQLQEI*
Ga0116164_100176401	3300009775	Anaerobic Digestor Sludge	NYGKGLLVSIISKSISNDKDLTPDDVEKLKEIKKQLQES*
Ga0116164_100964951	3300009775	Anaerobic Digestor Sludge	MIKKSSISLDNWGKGLLINLISKSISNDKNLTQDDIEKLKDIKKQLQEI*
Ga0116164_103090492	3300009775	Anaerobic Digestor Sludge	MNKMSTIKLDNWGKGLLLAIISKAMSSDRELTQDDLNKLKEIKKQLQDA
Ga0116154_101104354	3300009776	Anaerobic Digestor Sludge	MAKESSLKLDDWSKGLLISIISKAMSSDKDITQDDIEKLKEIKKQLQEI*
Ga0116154_103874662	3300009776	Anaerobic Digestor Sludge	MTKMSNLKLDNWSKGLLISIISKAISSDKDITQDDIEKLKEIKKQLQEI*
Ga0116151_104999682	3300009778	Anaerobic Digestor Sludge	MAKNEAFKIDNYGKGLLVNLISKAISNDRDLTDDDIEKLKEIKKQLQEN*
Ga0116152_101985921	3300009779	Anaerobic Digestor Sludge	LKKKTDLKLDNYGRGLLVSIVSKAISNDRYLTPDDIEKLREIKKQLQEA*
Ga0116156_102414763	3300009780	Anaerobic Digestor Sludge	MTKSNALKIDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN*
Ga0116157_101758923	3300009782	Anaerobic Digestor Sludge	MTKSNALKIDNYGKGLLVSLISKAISNDRDLTDDDIEKLKESKKQLQEN*
Ga0116157_106779891	3300009782	Anaerobic Digestor Sludge	MKKSILKLDNYGKGLLVSIISKSISNDKDLTPDDIEKLKEIKKQLQEN*
Ga0116239_100611031	3300010346	Anaerobic Digestor Sludge	MKKSILKLDNYGKGLLVSIISKSISNDKDLTPDDVEKLKEIKKQLQES*
Ga0116239_104078191	3300010346	Anaerobic Digestor Sludge	MTKNESFKIDNYGKGLLVNLISKAISNDRDLTDDDIEKLKEIKKQLQE
Ga0116239_104085304	3300010346	Anaerobic Digestor Sludge	MTKSNALKIDNYGKGLLVNLISKAISNDRDLTDDDIEKLKEIKKQLQEN*
Ga0116239_108779071	3300010346	Anaerobic Digestor Sludge	MIKKSGISLDNWVKGLLISLISKSISNDKNLTQDDIEKLKDIKKQLQEI*
Ga0116240_101210911	3300010349	Anaerobic Digestor Sludge	MKKTNLKLDNYGRRLLVSIVSKAISNDRYLTPDDIEKLREIKKQLQEA*
Ga0116244_100223698	3300010350	Anaerobic Digestor Sludge	MNKMSTIKLDNWGKGLLLAIISKAMSSDRELTQDD
Ga0116244_100506316	3300010350	Anaerobic Digestor Sludge	MNKSNTYKLNNYGKGLLVNIISKAISNDRDLTDDDIEKLKEIKKLLQEN*
Ga0116244_100699924	3300010350	Anaerobic Digestor Sludge	MNKMSTIKLDNWGKGLLLAIISKAMSSDRELTQDDLNKLKEIKKQLQDAAVKITGSI*
Ga0116244_101141082	3300010350	Anaerobic Digestor Sludge	MAKSNALKLDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN*
Ga0116244_104700171	3300010350	Anaerobic Digestor Sludge	MTKSNAIKLDNYGKGLLVNLISKAISNDRDLTDDDIEKLKEIKKQLQEN*
Ga0116244_106716272	3300010350	Anaerobic Digestor Sludge	MKKSNSITLDNYSRGLLVGIISRAISEDKSLTPDDIEKLKEIKKELQGS*
Ga0116244_108361811	3300010350	Anaerobic Digestor Sludge	MKSKSTKLELDNYGAGLLIGIISRALSSDKSLTEYDIEKLREIKTQLQESYN*
Ga0116248_101119003	3300010351	Anaerobic Digestor Sludge	MTKNESFKIDNYGKGLLVSLISKAISNDRDLTDDDIDKLKEIKKQLQEN*
Ga0116248_103063561	3300010351	Anaerobic Digestor Sludge	LSPYFFKAENSMSKKSSLSLDNWGKGLLVNIISKAISNDKDLTPDDIEKLKEIKKQLQEN
Ga0116248_107919322	3300010351	Anaerobic Digestor Sludge	MINKSSIKLDNWGKGLLLNLISKSISNDKNLTQDDIEKLKEIKKQLQEI*
Ga0116247_100376064	3300010352	Anaerobic Digestor Sludge	MKKRSLKLDNHGKGLLIGLISKAINDDKSLAPDDVDKLKEIKKQLQEE*
Ga0116247_103223742	3300010352	Anaerobic Digestor Sludge	MKKSTLKLDNYGKGLLVSIISKSISNDKDLTPDDVEKLKEIKKQLQES*
Ga0116247_105221741	3300010352	Anaerobic Digestor Sludge	MAKQSNLKLDNWSKGLLINIISKAISNDKDMTPDDIEKLKE
Ga0116247_105743101	3300010352	Anaerobic Digestor Sludge	MKKNSFNLDNYGKGLLIGIISKAISEDKNLTPDDIEKLKAIKKQLQEN*
Ga0116247_106923321	3300010352	Anaerobic Digestor Sludge	MAKVNSLKLDNWSKGLLINLISKAISSDKDITQDDIEKLKEIKKQLQDM*
Ga0116237_105040535	3300010356	Anaerobic Digestor Sludge	MKKSSLNLDNYGKGLLIGIISKAISEDKSLTADDIEKLKEIKKQLQES*
Ga0116237_110828532	3300010356	Anaerobic Digestor Sludge	MTKNESFKIDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEI
Ga0116241_101618272	3300010429	Anaerobic Digestor Sludge	MAKESSSLKLDNWSKGLLISIISKAISNDKDITQDDIEKLKELKKQLQEN*
Ga0116241_105723242	3300010429	Anaerobic Digestor Sludge	MKKSSLTLDNHGKGLLIGLISKAINDDKSLASDDIEKLKEIKKQLQEE*
Ga0119870_10369835	3300014833	Activated Sludge	MAKMSSLKLDNWSKGLLISIISKAISGDREMTPDDIEKLKEIKKLL
Ga0172382_104622051	3300015214	Landfill Leachate	MKKNTSITLDNYEKGLLIGIISRAISDDKNLASDDIEKLKELKKELQEI*
Ga0187869_103656781	3300018030	Peatland	MKTNNKLELDNWSKGLLINLISKAISNDKDLTQDDIEKLRAIKKQLQEN
Ga0179950_10358224	3300019213	Anaerobic Digestor Sludge	DNWGKGLLVNIISKALSNDRDLTADDIEKLKEIKKKLQEVY
Ga0179949_10446121	3300019225	Anaerobic Digestor Sludge	MSKNSIVNLDNWGKGLLVNIISKALSNDRDLTADDIEKLKEIKKKLQEVY
Ga0207193_10237948	3300020048	Freshwater Lake Sediment	MKKSSLNLDNHGKGLLIGLITKAINDDKSLAADDIEKLKDIKKLLQEE
Ga0207193_10988593	3300020048	Freshwater Lake Sediment	MAKESNLKLDNWSKGLLIGIISKAISSDRDMTPDDIEKLKEIKKQLQEI
Ga0207193_12420371	3300020048	Freshwater Lake Sediment	MKKNSLTLDNHGKGLLIGLISKAINDDKTLAADDIEKLKEIKKQLQGD
Ga0207193_13665163	3300020048	Freshwater Lake Sediment	MAKESSLKLDNWSKGLLISLISKAISSDKDITQDDIEKLKEIKKQLQEI
Ga0207193_13900391	3300020048	Freshwater Lake Sediment	MAKESSLKLDNWSKGLLISLISKAISSDKDITQDDIE
Ga0207193_15419262	3300020048	Freshwater Lake Sediment	MTKMSNLKLDNWSKGLLISIISKAISSDKDITQDDIEKLKEIKKQLQEI
Ga0207193_18662581	3300020048	Freshwater Lake Sediment	MAKMSSLNLDNWSKGLLISLISKAISNDKDITQDDIEKLKEIKKQLQEI
Ga0209408_10048002	3300025611	Anaerobic Digestor Sludge	MKKSVLKLDNYGKGLLVSIISKSISNDKDLTPDDVEKLKEIKKQLQES
Ga0209408_10063417	3300025611	Anaerobic Digestor Sludge	MKKTDLKLDNYGRGLLVSIVSKAISNDRDLTPDDIEKLKEIKKQLQEA
Ga0209408_10068425	3300025611	Anaerobic Digestor Sludge	MTKSNALKIDNYGKGLLVSLISKAISNDRDLTDDDIEKLKDIKKQLQEN
Ga0209408_10973293	3300025611	Anaerobic Digestor Sludge	MINKSSIKLDNWGKGLLINLISKSISNDKNLTQDDIEKLKEIKKQLQEI
Ga0209408_11558051	3300025611	Anaerobic Digestor Sludge	FKIDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN
Ga0209203_11100231	3300025702	Anaerobic Digestor Sludge	KSSISLDNWGKGLLINLISKSISNDKNLTQDDIEKLKDIKKQLQEI
Ga0209607_11273751	3300025847	Anaerobic Digestor Sludge	MTKSNSIKLDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN
Ga0209604_13447852	3300025856	Anaerobic Digestor Sludge	MPKLTNLKLDDWGKGLLVNIISKAISNDKDMTNDDIEKLKLIKKQLQESIS
Ga0209099_10009458	3300025858	Anaerobic Digestor Sludge	MAKQSILKLDNWSKGLLISIISKAISSDKDITHDDIEKLKEIKKQLQETQPPDKK
Ga0209099_100476316	3300025858	Anaerobic Digestor Sludge	MAKQSDLKLDNWSKGLLISLISKAISSDKDITQDDIEKLKEIKKQLQEI
Ga0209099_10051699	3300025858	Anaerobic Digestor Sludge	MKKSSLILDNHGKGLLIGLISKAINDDKSLASDDIEKLKEIKKQLQEE
Ga0209099_10068762	3300025858	Anaerobic Digestor Sludge	MKKSSLNLDNHGKGLLIGLISKAINDDKTLASDDIEKLKEIKKQLQEE
Ga0209099_10076056	3300025858	Anaerobic Digestor Sludge	MSKNSIINLDNWGKGLLVNIISKALSNDRDLTADDIEKLKEIKKKLQEVY
Ga0209099_11469842	3300025858	Anaerobic Digestor Sludge	MSKQSTLKLDNWSKGLLISIISKAISNDKDITQDDIEKLKELKKQLQEN
Ga0209099_12507621	3300025858	Anaerobic Digestor Sludge	MKKSRLNLDNHGKGLLIQLISKAINNDKSLTSDDVEKLKEIKKQLQEE
Ga0209605_13580682	3300025861	Anaerobic Digestor Sludge	MTKSNALKIDNYGKGLLVSLISKAISNDRDLTDDDIEKLKEIKKQLQEN
Ga0209016_10989002	3300027373	Bioremediated Contaminated Groundwater	MKKSTLNLDNHAKGLLIGLISKAINDDKSLASDDIEKLKEIKKQLQEE
Ga0265293_100556792	3300028603	Landfill Leachate	MKKNTSITLDNYEKGLLIGIISRAISDDKNLASDDIEKLKELKKELQEI
Ga0334887_10080676	3300033169	Sludge	MKKKNTEISLDNHGKGLLIGIISRALSEDKSLAPDDIDKLKEIKKQLQEV

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F084812

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences