2070309003: Concrete drainage pipe biofilm microbial communities from Ohio, US - sample 12383, Newbler assembly

Overview

Basic Information

• IMG/M Taxon OID: 2070309003
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0046156 | Gp0051716 | Ga0011043
• Sample Name: Concrete drainage pipe biofilm microbial communities from Ohio, US - sample 12383, Newbler assembly
• Sequencing Status: Permanent Draft
• Sequencing Center: 454 Life Sciences
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 77842783
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Concrete Drainage Pipe Biofilm Microbial Communities From Ohio, Us
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm Microbial Communities From Ohio, Us

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → artificial channel → biofilm material
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Surface (non-saline)

Location Information

• Location: Ohio, USA
• Coordinates
  • Lat. (^o): 39.8
  • Long. (^o): -84.3
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014467	Metagenome / Metatranscriptome	263	Y
F084812	Metagenome / Metatranscriptome	112	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
MiccSRB_contig01447	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	919
MiccSRB_contig14173	Not Available	1354

Sequences

Scaffold ID	Protein ID	Family	Sequence
MiccSRB_contig01447	MiccSRB_00214150	F014467	MKKTTTAVVATIAALALGSSALATMQLQKEYKAKDPKANCASCHTDKMPKKDKHDLNDLGKKVKGATGADGKVDWSKV
MiccSRB_contig14173	MiccSRB_01066930	F084812	MSKQSILKLDNWGKGLLISIISKAISSDKDITQDDIEKLKEIKKQLQEIQPPDKK