NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F082766

Metagenome / Metatranscriptome Family F082766

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082766
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 73 residues
Representative Sequence SQANYEKIFQLAVPLYCPTEDQEGNLYTVSTNGDVYQVTEGQMEVAFSTGGQPSGLVFDHQGSSFIADQAH
Number of Associated Samples 99
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 7.48 %
% of genes near scaffold ends (potentially truncated) 51.33 %
% of genes from short scaffolds (< 2000 bps) 94.69 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.64

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (93.805 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(22.124 % of family members)
Environment Ontology (ENVO) Unclassified
(55.752 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(59.292 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.04%    β-sheet: 32.32%    Coil/Unstructured: 63.64%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.64
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF08450SGL 43.36
PF03088Str_synth 12.39
PF01436NHL 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 55.75
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 43.36


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.69 %
UnclassifiedrootN/A5.31 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001199|J055_10126773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila975Open in IMG/M
3300001200|BBAY65_12186645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea516Open in IMG/M
3300005069|Ga0071350_1220387All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300005662|Ga0078894_10786052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea834Open in IMG/M
3300005941|Ga0070743_10217792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea624Open in IMG/M
3300006029|Ga0075466_1070576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum990Open in IMG/M
3300006100|Ga0007806_1053401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea773Open in IMG/M
3300006357|Ga0075502_1455657All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea889Open in IMG/M
3300006394|Ga0075492_1472491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum776Open in IMG/M
3300006396|Ga0075493_1004306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum853Open in IMG/M
3300006396|Ga0075493_1329721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea911Open in IMG/M
3300006401|Ga0075506_1650261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea874Open in IMG/M
3300006403|Ga0075514_1693333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea836Open in IMG/M
3300006803|Ga0075467_10173347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1220Open in IMG/M
3300006803|Ga0075467_10210425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1076Open in IMG/M
3300006803|Ga0075467_10213619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1066Open in IMG/M
3300006803|Ga0075467_10238043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea993Open in IMG/M
3300006803|Ga0075467_10244570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea976Open in IMG/M
3300006803|Ga0075467_10245525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea974Open in IMG/M
3300006917|Ga0075472_10162396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1097Open in IMG/M
3300007715|Ga0102827_1163554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea515Open in IMG/M
3300007722|Ga0105051_10168466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1689Open in IMG/M
3300007860|Ga0105735_1056652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea780Open in IMG/M
3300007862|Ga0105737_1087782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea779Open in IMG/M
3300007864|Ga0105749_1053296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea820Open in IMG/M
3300008938|Ga0103741_1042220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea860Open in IMG/M
3300009026|Ga0102829_1296104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea538Open in IMG/M
3300009071|Ga0115566_10266545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1020Open in IMG/M
3300009124|Ga0118687_10427189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea515Open in IMG/M
3300009161|Ga0114966_10621504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea600Open in IMG/M
3300009172|Ga0114995_10227116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1033Open in IMG/M
3300009422|Ga0114998_10219469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea900Open in IMG/M
3300009432|Ga0115005_10437330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1039Open in IMG/M
3300009434|Ga0115562_1140274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea911Open in IMG/M
3300009436|Ga0115008_10763126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea706Open in IMG/M
3300009495|Ga0115571_1132649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1055Open in IMG/M
3300009544|Ga0115006_10528268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1034Open in IMG/M
3300009550|Ga0115013_11010030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea592Open in IMG/M
3300009593|Ga0115011_12257780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea503Open in IMG/M
3300012504|Ga0129347_1080901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea740Open in IMG/M
3300012767|Ga0138267_1181890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea873Open in IMG/M
3300013233|Ga0172420_10913353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea656Open in IMG/M
3300013295|Ga0170791_10864937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea818Open in IMG/M
3300016742|Ga0182052_1283916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea667Open in IMG/M
3300017280|Ga0186684_115758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea760Open in IMG/M
3300017772|Ga0181430_1211411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea552Open in IMG/M
3300018410|Ga0181561_10440025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea589Open in IMG/M
3300018418|Ga0181567_10722403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea635Open in IMG/M
3300018692|Ga0192944_1019652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea944Open in IMG/M
3300018982|Ga0192947_10109571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea917Open in IMG/M
3300019017|Ga0193569_10402369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea528Open in IMG/M
3300019021|Ga0192982_10131298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum863Open in IMG/M
3300019036|Ga0192945_10079698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1004Open in IMG/M
3300019045|Ga0193336_10153201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea864Open in IMG/M
3300019103|Ga0192946_1022979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea930Open in IMG/M
3300019123|Ga0192980_1039581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea903Open in IMG/M
3300019131|Ga0193249_1069086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea848Open in IMG/M
3300021336|Ga0210307_1356801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea968Open in IMG/M
3300021928|Ga0063134_1022446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea894Open in IMG/M
3300021941|Ga0063102_1012093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea780Open in IMG/M
3300021957|Ga0222717_10614640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea568Open in IMG/M
3300021962|Ga0222713_10310612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1000Open in IMG/M
3300023439|Ga0256752_1051147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea947Open in IMG/M
3300024343|Ga0244777_10553648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea701Open in IMG/M
3300025680|Ga0209306_1083553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea969Open in IMG/M
3300025848|Ga0208005_1070455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1087Open in IMG/M
3300025887|Ga0208544_10136535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1066Open in IMG/M
3300025887|Ga0208544_10144642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1026Open in IMG/M
3300025887|Ga0208544_10147444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1013Open in IMG/M
3300025887|Ga0208544_10156259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea974Open in IMG/M
3300026495|Ga0247571_1059636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea867Open in IMG/M
3300027687|Ga0209710_1125604All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea968Open in IMG/M
3300027736|Ga0209190_1147522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1024Open in IMG/M
3300027810|Ga0209302_10480931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea552Open in IMG/M
3300027849|Ga0209712_10596774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea614Open in IMG/M
3300027883|Ga0209713_10318880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1034Open in IMG/M
3300028282|Ga0256413_1323881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea541Open in IMG/M
3300028335|Ga0247566_1031351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea870Open in IMG/M
3300031113|Ga0138347_11052014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea733Open in IMG/M
3300031211|Ga0307974_1048757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1999Open in IMG/M
3300031393|Ga0307967_1155089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea706Open in IMG/M
3300031394|Ga0307963_1131663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea699Open in IMG/M
3300031522|Ga0307388_10396615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea893Open in IMG/M
3300031522|Ga0307388_10530037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea777Open in IMG/M
3300031569|Ga0307489_10303769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1032Open in IMG/M
3300031621|Ga0302114_10149763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1025Open in IMG/M
3300031729|Ga0307391_10780294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea547Open in IMG/M
3300031729|Ga0307391_10922799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea504Open in IMG/M
3300031734|Ga0307397_10592847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea520Open in IMG/M
3300031735|Ga0307394_10399453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea550Open in IMG/M
3300031737|Ga0307387_10281121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea984Open in IMG/M
3300031738|Ga0307384_10248173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea800Open in IMG/M
3300031788|Ga0302319_11307368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea661Open in IMG/M
3300032462|Ga0335396_10441647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea834Open in IMG/M
3300032463|Ga0314684_10309695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea917Open in IMG/M
3300032521|Ga0314680_10408121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea845Open in IMG/M
3300032522|Ga0314677_10628100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea565Open in IMG/M
3300032540|Ga0314682_10293578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea888Open in IMG/M
3300032616|Ga0314671_10281619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea902Open in IMG/M
3300032707|Ga0314687_10296373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea878Open in IMG/M
3300032708|Ga0314669_10411222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea741Open in IMG/M
3300032725|Ga0314702_1144914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea883Open in IMG/M
3300032742|Ga0314710_10170652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea871Open in IMG/M
3300032752|Ga0314700_10399635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea730Open in IMG/M
3300032754|Ga0314692_10359410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea788Open in IMG/M
3300033572|Ga0307390_10384208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea855Open in IMG/M
3300033572|Ga0307390_10513581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea742Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine22.12%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous18.58%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater11.50%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine7.96%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.54%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.54%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.65%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water2.65%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.65%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water2.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.77%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.77%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.77%
Lab-Scale Ebpr BioreactorEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Lab-Scale Ebpr Bioreactor1.77%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.89%
LoticEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic0.89%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.89%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.89%
Hydrothermal Fe-Rich MatEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat0.89%
MarineEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine0.89%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.89%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.89%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.89%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.89%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.89%
Enhanced Biological Phosphorus Removal BioreactorEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor0.89%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.89%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001199Lotic microbial communities from nuclear landfill site in Hanford, Washington, USA - IFRC combined assemblyEnvironmentalOpen in IMG/M
3300001200Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY65Host-AssociatedOpen in IMG/M
3300005069Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005678Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V91307 Phage SequencingEngineeredOpen in IMG/M
3300005688Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V92809 Phage SequencingEngineeredOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006100Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006417Combined Assembly of Gp0110018, Gp0110022, Gp0110020EngineeredOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300007722Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300007860Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3umEnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013233Combined Assembly of Gp0198154, Gp0198156, Gp0198157, Gp0198161EnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300016742Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011511BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017280Metatranscriptome of coastal eukaryotic communities from Ligurian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 638 ?mol photons light - Strombidium inclinatum S3 (MMETSP0208)Host-AssociatedOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300023439Hydrothermal Fe-rich mat microbial community from TAG Site, Mid-Atlantic Ridge, Atlantic Ocean - 665-MMA12EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031113Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S7_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031211Saline water microbial communities from Organic Lake, Antarctica - #784EnvironmentalOpen in IMG/M
3300031393Saline water microbial communities from Organic Lake, Antarctica - #648EnvironmentalOpen in IMG/M
3300031394Saline water microbial communities from Organic Lake, Antarctica - #594EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300032462Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032725Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
J055_1012677333300001199LoticMAAQIQANFEKLFQIAVPIYCPVEDNKGTLYIVSTNGEVYEVNEGTPKPSFTTGGQPTSLVFDSEGSAFIADMGY*
BBAY65_1218664523300001200Macroalgal SurfaceMANFEKLFQTAVPLYCPVEDNEGNMYVVSTNGEVYLTNDGQMNPAFSTGGQPTSLVFDQEGSAFIADMGY*
Ga0071350_122038713300005069FreshwaterMVTRQPANFEKLFQMAVPLYCPTEDQDGNLFTVSTNGDVYQVQEGQMDVAFTTGGQPTGLVFDTQGSSFIADQAHQAILS*
Ga0078894_1078605223300005662Freshwater LakeYCPTEDHEGNLYTVSTNGDVYQVQEGQMDVAFTTGGQPTGLVFDTLGSSFIADQAHQAILS*
Ga0074427_10908713300005678Lab-Scale Ebpr BioreactorVEDNKGTLFIVSTNGEVYEVNEGTLKPSFSTGGQPTSLVFDQEGSAFIADMGY*
Ga0074437_12937013300005688Lab-Scale Ebpr BioreactorYCPVEDNKGTLFIVSTNGEVYEVNEGTLKPSFSTGGQPTSLVFDQEGSAFIADMGY*
Ga0070743_1021779223300005941EstuarineMTNTVQANFEKLFQLAVPLYCPTEDSEGNLFAVSTNGDVYQVNEGQMEVAFSTGGQPTGLVFDQHGSSFIAD*
Ga0075466_107057623300006029AqueousMANVSQANYEKIFQLAVPLYCPTEDQEGNLYTVSTNGDVYQVTEGQMEVAFSTGGQPSGLVFDHQGSSFIADQAH*
Ga0007806_105340113300006100FreshwaterMVTRQPANFEKLFQVAVPLYCPTEDQDGNLYTVSTNGDVYQVQEGQMDVAFTTGGQPTGLVFDTQGSSFIADQAH*
Ga0075502_145565713300006357AqueousMVLSQPANYEKQFQLAVPLFCPTEDAEGILYMVSTNGDVYQVSDGQLDVAFSTGGQPTGLVFDSQGSSFVADLAH*
Ga0075492_147249113300006394AqueousFQLAVPLYCPTEDQEGNLYTVSTNGDVYQVTEGQMEVAFSTGGQPSGLVFDHQGSSFIADQAH*
Ga0075493_100430623300006396AqueousSQANYEKIFQLAVPLYCPTEDQEGNLYTVSTNGDVYQVTEGQMEVAFSTGGQPSGLVFDHQGSSFIADQAH*
Ga0075493_132972113300006396AqueousPANYERMFQLNVPLYGPTEDSEGNLFAVSTNGDVYQMTSEGAMEVAFSTGGQPTGLVFDMQGSSFIADMAH*
Ga0075506_165026123300006401AqueousMVLSQPANYEKQFQLAVPLYCPTEDSDGILYMVSTNGDVYQVSDGQLDVAFSTGGQPTGLVFDSQGSSFVADLAHQAILS*
Ga0075514_169333323300006403AqueousLSQPANYEKQFQLAVPLYCPTEDSDGILYMVSTNGDVYQVSDGQLDVAFSTGGQPTGLVFDSQGSSFVADLAHQAILS*
Ga0069787_1077619523300006417Enhanced Biological Phosphorus Removal BioreactorYCPAEDNKGTLFIVSTNGEVYEVNEGTLKPSFSTGGQPTSLVFDQEGSAFIADMGY*
Ga0075467_1005671943300006803AqueousPVTKFNLNMANVSPANYEKLFQLAVPLYCPTEDSDGNLFAVSTNGDVYQVNEGQMEVAFSTGGQPTGLVFDQ*
Ga0075467_1017334713300006803AqueousMVNASPANYERLFQLNVPLYCPTEDSEGNLFAVSTNGDVYQMTSEGAMEVAFSTGGQPTGLVFDMQGSSFIADMAHQAILS*
Ga0075467_1021042513300006803AqueousLNVPLYGPTEDSEGNLFAVSTNGDVYQMTSEGAMEVAFSTGGQPTGLVFDMQGSSFIADMAHQAILS*
Ga0075467_1021361933300006803AqueousVPLYGPTEDSEGNLFAVSTNGDVYQMTSEGAMEVAFSTGGQPTGLVFDMQGSSFIADMAH
Ga0075467_1023804313300006803AqueousMVNQSPANYERMFQLNVPLYGPTEDSEGNLFAVSTNGDVYQMTSEGAMEVAFSTGGQPTGLVFDMQGSSFIADMAH*
Ga0075467_1024457013300006803AqueousMTNTVQANFEKLFQLAVPLYCPTEDSEGNLFAVSTNGDVYQVNEGQMEVAFSTGGQPTGLVFDQHGSSFIADQAH*
Ga0075467_1024552513300006803AqueousVPLYCPTEDQEGNLYTVSTNGDVYQVTEGQMEVAFSTGGQPTGLVFDHQGSSFIADQAH*
Ga0075472_1016239623300006917AqueousMVSTSPANYERLFQLNVPLYCPTEDSEGNLFAVSTNGDVYQMTSEGAMEVAFSTGGQPTGLVFDMQGSSFIADMAH*
Ga0102827_116355413300007715EstuarinePLYCPCEDAEGTLYCVSTNGDVYQVTEGQMEVAFSTGGQPAGLVFDQQGSSFIADQAHQAVLSEVFTEQG*
Ga0105051_1016846613300007722FreshwaterMVTRQSANFEKLFQVAVPLYCPTEDQDGNLYTVSTNGDVYQVQEGQMDVAFTTGGQPTGLVFDTQGSSFIAD*
Ga0105735_105665213300007860Estuary WaterCPTEDSEGNLFAVSTNGDIYQVNEGQMEVAFSTGGQPTGLVFDQQGSSFIADLAH*
Ga0105737_108778213300007862Estuary WaterLAVPLYCPTEDSEGNLFAVSTNGDVYQVNEGQMEVAFSTGGQPTGLVFDQHGSSFIAD*
Ga0105749_105329613300007864Estuary WaterTVQANFEKLFQLAVPLYCPTEDSEGNLFAVSTNGDVYQVNEGQMEVAFSTGGQPTGLVFDQHGSSFIAD*
Ga0103741_104222013300008938Ice Edge, Mcmurdo Sound, AntarcticaNKYHNFKFKMANVTQANCEKHFQLAVPLYCPTEDQDGTLFCVSTNGDVYQVTEGNLEVAFSTGGQPSGLVFDHQGSSFIADQAHQAILS*
Ga0102829_129610413300009026EstuarineLAVPLFCPTEDQEGNLYTVSTNGDVYQVTEGQMEVAFSTGGQPTGLVFDHQGSSFIAD*
Ga0115566_1026654533300009071Pelagic MarineMNITQANYEKQFQLAVPLFCPTEDNEGNLYCVSTNGDVYQVTEGQMEVAFSTGGQPCGLVYDHQGSSFIADIAH*
Ga0118687_1042718913300009124SedimentPTEDQEGNLYAVSTNGDVYQVSEGVMDVAFSTGGQLTGLVFDHQGSSFIADQAH*
Ga0114966_1062150413300009161Freshwater LakeMVTRQPANFEKLFQVAVPLYCPTEDQDGNLYTVSTNGDVYQVTEGQMDVAFTTGGQPTGLVFDTQGSSFIADQAH*
Ga0114995_1022711613300009172MarinePKTPKPHNIDKFPIYLIIYNFKFKMTNVVQANCEKHFQLAVPLYCPTEDQDGTLFCVSTNGDVYQVTEGNLEVAFSTGGQPSGLVFDHQGSSFIAD*
Ga0114998_1021946933300009422MarineCPTEDQDGTLFCVSTNGDVYQVTEGNLEVAFSTGGQPSGLVFDHQGSSFIAD*
Ga0115005_1043733043300009432MarineMANYTQANYEKLFQLAVPLYCPCEDAEGTLYCVSTNGDVYQVTEGQMEVAFSTGGQPAGLVFDQQGSSFIADQAHQAVLS*
Ga0115562_114027423300009434Pelagic MarineMNITQANFEKLFQLAVPLFCPTEDNEGNLYCVSTNGDVYQVNEGQMEVAFSTGGQPCGLVYDHQGSSFIADIAHQAILS*
Ga0115008_1076312613300009436MarineMANYTQANYEKLFQLAVPLYCPTEDAEGTLYCVSTNGDVYQVTEGQMEVAFSTGGQPAGLVFDQQGSSFIADQAHQAVLS*
Ga0115571_113264913300009495Pelagic MarineMANYTQANYEKLFQLAVPLYCPCEDADGTLYCVSTNGDVYQVTEGQMEVAFSTGGQPAGLVFDQQGSSFIADQAHQAVLS*
Ga0115006_1052826823300009544MarineMANQTPANYERLFQSNVPLYGPTEDSEGNLFAVSTNGDVYQMTSEGAMEVAFSTGGQPTGLVFDMQGSSFIADQAHQAILS*
Ga0115013_1101003013300009550MarinePKTPKPLYLGVIIFQMANVTHTQANYEKLFQLAVPLFCPTEDQEGNLYLVSTNGDVYHVTSEGQMEVAFSTGGQPSGLVFDHQGSSFIAYQAH*
Ga0115011_1225778023300009593MarineMAMNATVVDCETMFQTVGPLFSPTQDSDGNLFAVSTNGDVYQVTEGNLEVAFSTGGQPSGLVFDHQGSSFIADQAHQAILS*
Ga0129347_108090123300012504AqueousMANVQPANYERLFQSPVPLYCPTEDGEGTLFTVSTNGDVFQLSQEGAMEVAFSTGGQPTGLVFDQQGSSFIAD*
Ga0138267_118189023300012767Polar MarineQANYEKLFQLAVPLYCPCEDAEGTLYCVSTNGDVYQVTEGQMEVAFSTGGQPAGLVFDQQGSSFIADQAHQAVLS*
Ga0172420_1091335313300013233MarinePANFEVLFNLAVPLYCPTEDSEHNLYAISTNGDVYQVTEGQMEVAFQTGGQPTALIFDSQGSSFIADQAHQAIMS*
Ga0170791_1086493713300013295FreshwaterYLKMVTRQPANFEKLFQMAVPLYCPTEDQDGNLFTVSTNGDVYQVQEGQMDVAFTTGGQPTGLVFDTQGSSFIADQAHQAILS*
Ga0182052_128391613300016742Salt MarshNFEKLFQLAVPLYCPTEDSEGNLFAVSTNGDVYQVNEGQMEVAFSTGGQPTGLVFDQHGSSFIADQAH
Ga0186684_11575813300017280Host-AssociatedLTQANFEKLFQLTTPLSCPTEDPEGNLYVVSANGDVYQMSEGTLEVAFSTGGQPSGMVFDNHNSSFIADLAHQAILC
Ga0181430_121141123300017772SeawaterAQMSVPLYCPTEDSDGDLFCVSTNGDVFQMTPEGSMEVTFSTGGQPTGLVFDMQGSSFIA
Ga0181561_1044002513300018410Salt MarshMTNTVQANFEKLFQLAVPLYCPTEDSEGNLFAVSTNGDVYQVNEGQMEVAFSTGGQPTGLVFDQHGSSFIADQAH
Ga0181567_1072240323300018418Salt MarshMANITHTQANYEKLFQLAVPLFCPTEDAEGNLYMVSTNGDVYHVSSEGQMEVAFSTGGQPSGLVFDHQGSSFIADQAHQAILS
Ga0192944_101965213300018692MarineHGDNFKFKMTNVTQANCEKHFQLAVPLYCPTEDQDGTLFCVSTNGDVYQVTEGNLEVAFSTGGQPSGLVFDHQGSSFIAD
Ga0192947_1010957133300018982MarineTWDNFKFKMTNVTQANCEKHFQLAVPLYCPTEDQDGTLFCVSTNGDVYQVTEGNLEVAFSTGGQPSGLVFDHQGSSFIAD
Ga0193569_1040236913300019017MarineMINQTPANYERLFQSNVPLYGPTEDSEGNLFAVSTNGDVYQMTSEGAMEVAFSTGGQPTGLVFDMQGSSFIADMAH
Ga0192982_1013129833300019021MarineAVPLYCPCEDQDGNLYTVSTNGDVYQVTEGQMEVAFSTGGQPSGLVFDQQGSSFIADQAHQAILS
Ga0192945_1007969843300019036MarineTWAQSTWGIYNFKFKMTNVTQANCEKHFQLAVPLYCPTEDQDGTLFCVSTNGDVYQVTEGNLEVAFSTGGQPSGLVFDHQGSSFIAD
Ga0193336_1015320133300019045MarineLPVPLYCPTEDQEGNLYAVSTNGDVYQVTEGQMDVAFSTGGQPTGLVFDHQGSSFIAD
Ga0192946_102297913300019103MarineMGIYNFKFKMTNVTQANCEKHFQLAVPLYCPTEDQDGTLFCVSTNGDVYQVTEGNLEVAFSTGGQPSGLVFDHQGSSFIAD
Ga0192980_103958123300019123MarineFQLAVPLYCPCEDAEGTLYCVSTNGDVYQVTEGQMEVAFSTGGQPAGLVFDQQGSSFIADQAHQAVLS
Ga0193249_106908633300019131MarineNVVPHSQANFEKLFQLAVPLYCPTEDHEGNLYMVSTNGDIYHVSNEGQMEVAFSTGGQPSGLVFDHQGSSFIADQAHQAILS
Ga0210307_135680123300021336EstuarineMTNTVQANFEKLFQLAVPLYCPTEDSEGNLFAVSTNGDVYQVNEGQMEVAFSTGGQPTGLVFDQHGSSFIAD
Ga0063134_102244613300021928MarineIIKIIMDNTTPANYERLAQMSVPLFCPTEDSDGNLFCVSTNGDVFQMTPEGSMEVTFSTGGQPSGLVFDMQGSSFIADQAHQAILS
Ga0063102_101209313300021941MarineIIKMANYTQANYEKLFQLAVPLYCPCEDAEGTLYCVSTNGDVYQVTEGQMEVAFSTGGQPAGLVFDQQGSSFIADQAHQAVLS
Ga0222717_1061464023300021957Estuarine WaterMANYTPANFEKLFQLAVPLYCPTEDQEGNLYTVSTNGDVYQVTDGQMEVAFSTGGQPSGLVFDHQGSSFIAD
Ga0222713_1031061213300021962Estuarine WaterMANVSPANYEKIFQLAVPLYCPTEDQEGNLYCVSTNGDVYQVTEGQMEVAFSTGGQPSGLVFDHQGSSFIADQAHQAILS
Ga0256752_105114713300023439Hydrothermal Fe-Rich MatVLFNLAVPLYCPTEDSEHNLYAISTNGDVYQVTEGQMEVAFQTGGQPTALIFDSQGSSFIADQAHQAIMS
Ga0244777_1055364823300024343EstuarineVPLYCPTEDSEGNLFCVSTNGDVFQVTPEGAAEVTFSTGGQPTGLVFDLQGSSFIAD
Ga0209306_108355313300025680Pelagic MarineMNITQANYEKQFQLAVPLFCPTEDNEGNLYCVSTNGDVYQVTEGQMEVAFSTGGQPCGLVYDHQGSSFIADIAH
Ga0208005_107045523300025848AqueousMVSTSPANYERLFQLNVPLYCPTEDSEGNLFAVSTNGDVYQMTSEGAMEVAFSTGGQPTGLVFDMQGSSFIADMAH
Ga0208544_1013653513300025887AqueousMVNQSPANYERMFQLNVPLYGPTEDSEGNLFAVSTNGDVYQMTSEGAMEVAFSTGGQPTGLVFDMQGSSFIADMAH
Ga0208544_1014464213300025887AqueousMVNASPANYERLFQLNVPLYGPTEDSEGNLFAVSTNGDVYQMTSEGAMEVAFSTGGQPTGLVFDMQGSSFIADMAHQAILS
Ga0208544_1014744413300025887AqueousMVNASPANYERLFQLNVPLYCPTEDSEGNLFAVSTNGDVYQMTSEGAMEVAFSTGGQPTGLVFDMQGSSFIADMAHQAILS
Ga0208544_1015625913300025887AqueousVPLYCPTEDQEGNLYTVSTNGDVYQVTEGQMEVAFSTGGQPTGLVFDHQGSSFIADQAH
Ga0247571_105963613300026495SeawaterTNYTQANYEKLFQLAVPLYCPCEDAEGTLYCVSTNGDVYQVTEGQMEVAFSTGGQPAGLVFDQQGSSFIADQAHQAVLS
Ga0209710_112560413300027687MarinePKTPKPHNIDKFPIYLIIYNFKFKMTNVVQANCEKHFQLAVPLYCPTEDQDGTLFCVSTNGDVYQVTEGNLEVAFSTGGQPSGLVFDHQGSSFIAD
Ga0209190_114752223300027736Freshwater LakeMVTRQPANFEKLFQVAVPLYCPTEDQDGNLYTVSTNGDVYQVTEGQMDVAFTTGGQPTGLVFDTQGSSFIADQAH
Ga0209302_1048093123300027810MarineMANITHTQANYEKLFQLAVPLFCPTEDAEGNLYMVSTNGDVYHVSAEGQMEVAFSTGGQPSGLVFDHQGSSFIADQAHQAILS
Ga0209712_1059677413300027849MarineMANYTQANYEKLFQLAVPLYCPCEDAEGTLYCVSTNGDVYQVTEGQMEVAFSTGGQPAGLVFDQQGSSFIADQAHQAVLS
Ga0209713_1031888023300027883MarineMANQTPANYERLFQSNVPLYGPTEDSEGNLFAVSTNGDVYQMTSEGAMEVAFSTGGQPTGLVFDMQGSSFIADQAHQAILS
Ga0256413_132388113300028282SeawaterKMANYTQANYEKLFQLAVPLYCPCEDAEGTLYCVSTNGDVYQVTEGQMEVAFSTGGQPAGLVFDQQGSSFIADQAHQAVLS
Ga0247566_103135123300028335SeawaterANYTQANYEKLFQLAVPLYCPCEDAEGTLYCVSTNGDVYQVTEGQMEVAFSTGGQPAGLVFDQQGSSFIADQAHQAVLS
Ga0138347_1105201423300031113MarineSQHSVPLYCPTEDSEGNLFAVSTNGDIYQMTSEGAMEVAFSTGGQPTGLVFDMQGSSFIADMAH
Ga0307974_104875723300031211Saline WaterMVTTQQANYERLFQLAVPLFCPTEDADGNLFCVSTNGDIFRVYEEGGGVEPVSSTGGQPTGLVFDNQGSSFIAD
Ga0307967_115508923300031393Saline WaterERLFQLAVPLFCPTEDADGNLFCVSTNGDIFRVYEEGGGVEPVSSTGGQPTGLVFDNQGSSFIAD
Ga0307963_113166313300031394Saline WaterMVTTQQANYERLFQLAVPLFCPTEDADGNLFCVSTNGDIFRVYEEGGGVEPVSSTGGQPTGLVFDNQGS
Ga0307388_1039661513300031522MarineITQTPANYERLFQSNVPLYCPTEDSEGNLFAVSTNGDVYQMTSEGAMEVAFSTGGQPTGLVFDMQGSSFIAD
Ga0307388_1053003713300031522MarineANCEKHFQLAVPLYCPTEDQDGTLFCVSTNGDVYQVTEGNLEVAFSTGGQPSGLVFDHQGSSFIAD
Ga0307489_1030376913300031569Sackhole BrineMVNETPANYERLFQSNVPLYCPTEDSEGNLFAVSTNGDVYQMTAEGAMEVAFSTGGQPTGLVFDMQGSSFIADMAHQAILS
Ga0302114_1014976333300031621MarineMNTTQANFEKLFQLAVPLFCPTEDNEGNLYCVSTNGDVYQVNEGQMEVAFSTGGQPCGLVYDHQGSSFIADIAHQAILS
Ga0307391_1078029423300031729MarineYCPTEDSEGNLFAVSTNGDIYQMTAEGSMEVAFSTGGQPTGLVFDMQGSSFIADMAH
Ga0307391_1092279913300031729MarineNVTQANCEKHFQLAVPLYCPTEDQDGTLFCVSTNGDVYQVTEGNLEVAFSTGGQPSGLVFDHQGSSFIADQAHQAILS
Ga0307397_1059284713300031734MarineQANCEKHFQLAVPLYCPTEDQDGTLFCVSTNGDVYQVTEGNLEVAFSTGGQPSGLVFDHQGSSFIAD
Ga0307394_1039945323300031735MarineANYTQANYEKLFQLAVPLYCPCEDAEGTLYCVSTNGDVYQVTEGQMEVAFSTGVQPAGLVFDQQGSSFIADQAHQAVLS
Ga0307387_1028112133300031737MarineYERLFQSNVPLYCPTEDSEGNLFAVSTNGDVYQMTSEGAMEVAFSTGGQPTGLVFDMQGSSFIAD
Ga0307384_1024817333300031738MarineYCPCEDAEGTLYCVSTNGDVYQVTEGQMEVAFSTGGQPAGLVFDQQGSSFIADQAHQAVL
Ga0302319_1130736823300031788BogMVTRQPANFEKLFQVAVPLYCPTEDQNGNLYTVSTNGDVYQVTEGQMDVAFTTGGQPTGLVFDTQGSSFIADQAHQAILS
Ga0335396_1044164723300032462FreshwaterMVTRQSANFEKLFQVAVPLYCPTEDQDGNLYTVSTNGDVYQVQEGQMDVAFTTGGQPTGLVFDTQGSSFIAD
Ga0314684_1030969513300032463SeawaterKNMNITQANFEKLFQLAVPLFCPTEDNEGNLYCVSTNGDVYQVNEGQMEVAFSTGGQPCGLVYDHQGSSFIADIAHQAILS
Ga0314680_1040812133300032521SeawaterITQANFEKLFQLAVPLFCPTEDNEGNLYCVSTNGDVYQVNEGQMEVAFSTGGQPCGLVYDHQGSSFIADIAHQAILS
Ga0314677_1062810013300032522SeawaterLAVPLFCPTEDNEGNLYCVSTNGDVYQVNEGQMEVAFSTGGQPCGLVYDHQGSSFIADIAHQAILS
Ga0314682_1029357833300032540SeawaterFKNMNITQANFEKLFQLAVPLFCPTEDNEGNLYCVSTNGDVYQVNEGQMEVAFSTGGQPCGLVYDHQGSSFIADIAHQAILS
Ga0314682_1041454413300032540SeawaterEDQDGTLFCVSTNGDVYQVTEGNLEVAFSTGGQPSGLVFDHQGSSFIAD
Ga0314671_1028161913300032616SeawaterTNVVQANCEKHFQLAVPLYCPTEDQDGTLFCVSTNGDVYQVTEGNLEVAFSTGGQPSGLVFDHQGSSFIAD
Ga0314687_1029637333300032707SeawaterNITQANFEKLFQLAVPLFCPTEDNEGNLYCVSTNGDVYQVNEGQMEVAFSTGGQPCGLVYDHQGSSFIADIAHQAILS
Ga0314669_1041122233300032708SeawaterMNITQANFEKLFQLAVPLFCPTEDNEGNLYCVSTNGDVYQVNEGQMEVAFSTGGQPCGLVYDHQGSSFIADIAHQAILS
Ga0314681_1037413713300032711SeawaterPTEDNEGNLYCVSTNGDVYQVNEGQMEVAFSTGGQPCGLVYDHQGSSFIADIAHQAILS
Ga0314702_114491413300032725SeawaterNMNITQANFEKLFQLAVPLFCPTEDNEGNLYCVSTNGDVYQVNEGQMEVAFSTGGQPCGLVYDHQGSSFIADIAHQAILS
Ga0314710_1017065213300032742SeawaterQANFEKLFQLAVPLFCPTEDNEGNLYCVSTNGDVYQVNEGQMEVAFSTGGQPCGLVYDHQGSSFIADIAHQAILS
Ga0314700_1039963513300032752SeawaterQLAVPLYCPCEDAEGTLYCVSTNGDVYQVTEGQMEVAFSTGGQPAGLVFDQQGSSFIADQAHQAVLS
Ga0314692_1035941033300032754SeawaterMNITQANFEKLFQLAVPLFCPTEDSEGNLYCVSTNGDVYQVNEGQMEVAFSTGGQPCGLVYDHQGSSFIADIAHQAILS
Ga0307390_1038420813300033572MarineQANCEKHFQLAVPLYCPTEDQDGTLFCVSTNGDVYQVTEGNLEVAFSTGGQPSGLVFDHQGSSFIADQAHQAILS
Ga0307390_1051358113300033572MarineKNTKMISQTPANYERLFQSNVPLYCPTEDSDGNLFAVSTNGDVYQMTSEGSMEVAFSTGGQPTGLVFDM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.