3300005678: Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V91307 Phage Sequencing

Overview

Basic Information

• IMG/M Taxon OID: 3300005678
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111422 | Gp0115862 | Ga0074427
• Sample Name: Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V91307 Phage Sequencing
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Queensland
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 30190100
• Sequencing Scaffolds: 1
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia
• Type: Engineered
• Taxonomy: Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Lab-Scale Ebpr Bioreactor → Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: St. Lucia, Queensland Australia
• Coordinates
  • Lat. (^o): -27.49999
  • Long. (^o): 153.012098
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082766	Metagenome / Metatranscriptome	113	Y
F095570	Metagenome / Metatranscriptome	105	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0074427_106851	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	711

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0074427_106851	Ga0074427_1068511	F095570	IIMTEYLYDRDNPKSALRQRITGIEGFFYGLPNINERAEMVNRALLKENDNDITKFANQLKKPRDNA*
Ga0074427_109087	Ga0074427_1090871	F082766	VEDNKGTLFIVSTNGEVYEVNEGTLKPSFSTGGQPTSLVFDQEGSAFIADMGY*