| Basic Information | |
|---|---|
| Family ID | F080668 |
| Family Type | Metagenome |
| Number of Sequences | 115 |
| Average Sequence Length | 46 residues |
| Representative Sequence | TGVDERVMTINELFANPKLNYEVLRRLQAGQVSISISGEQAAKTGEF |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.39 % |
| % of genes from short scaffolds (< 2000 bps) | 92.17 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.130 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.739 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.870 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.913 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.00% β-sheet: 0.00% Coil/Unstructured: 68.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF00149 | Metallophos | 2.61 |
| PF02272 | DHHA1 | 2.61 |
| PF02900 | LigB | 1.74 |
| PF13442 | Cytochrome_CBB3 | 1.74 |
| PF01734 | Patatin | 1.74 |
| PF13676 | TIR_2 | 0.87 |
| PF13091 | PLDc_2 | 0.87 |
| PF00196 | GerE | 0.87 |
| PF13281 | MAP3K_TRAF_bd | 0.87 |
| PF02653 | BPD_transp_2 | 0.87 |
| PF01447 | Peptidase_M4 | 0.87 |
| PF02868 | Peptidase_M4_C | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 1.74 |
| COG3227 | Zn-dependent metalloprotease (Neutral protease B) | Posttranslational modification, protein turnover, chaperones [O] | 1.74 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 1.74 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 1.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.13 % |
| All Organisms | root | All Organisms | 40.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459023|GZGNO2B02IHH1B | Not Available | 505 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10031441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1431 | Open in IMG/M |
| 3300001976|JGI24752J21851_1009988 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300005328|Ga0070676_10982537 | Not Available | 633 | Open in IMG/M |
| 3300005332|Ga0066388_105800585 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300005364|Ga0070673_100457182 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300005455|Ga0070663_101108890 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300005458|Ga0070681_10521966 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300005459|Ga0068867_102288124 | Not Available | 513 | Open in IMG/M |
| 3300005467|Ga0070706_101527486 | Not Available | 610 | Open in IMG/M |
| 3300005544|Ga0070686_100318924 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300005713|Ga0066905_100154782 | Not Available | 1657 | Open in IMG/M |
| 3300005764|Ga0066903_101328568 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300005764|Ga0066903_103955761 | Not Available | 795 | Open in IMG/M |
| 3300005764|Ga0066903_104141227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 776 | Open in IMG/M |
| 3300005764|Ga0066903_106546872 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005764|Ga0066903_107225379 | Not Available | 575 | Open in IMG/M |
| 3300005764|Ga0066903_108229509 | Not Available | 533 | Open in IMG/M |
| 3300006058|Ga0075432_10462212 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300006162|Ga0075030_101241700 | Not Available | 585 | Open in IMG/M |
| 3300009147|Ga0114129_10042380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum | 6410 | Open in IMG/M |
| 3300009545|Ga0105237_12572844 | Not Available | 519 | Open in IMG/M |
| 3300009792|Ga0126374_10165536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1359 | Open in IMG/M |
| 3300010046|Ga0126384_10167091 | Not Available | 1710 | Open in IMG/M |
| 3300010046|Ga0126384_10382599 | Not Available | 1183 | Open in IMG/M |
| 3300010046|Ga0126384_10587765 | Not Available | 973 | Open in IMG/M |
| 3300010048|Ga0126373_12557796 | Not Available | 569 | Open in IMG/M |
| 3300010366|Ga0126379_10663228 | Not Available | 1134 | Open in IMG/M |
| 3300010376|Ga0126381_103635985 | Not Available | 604 | Open in IMG/M |
| 3300010398|Ga0126383_10203685 | Not Available | 1902 | Open in IMG/M |
| 3300010398|Ga0126383_11816553 | Not Available | 698 | Open in IMG/M |
| 3300010398|Ga0126383_13238515 | Not Available | 532 | Open in IMG/M |
| 3300010399|Ga0134127_11937031 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300012350|Ga0137372_10633261 | Not Available | 781 | Open in IMG/M |
| 3300012353|Ga0137367_10868919 | Not Available | 623 | Open in IMG/M |
| 3300012896|Ga0157303_10096974 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300012951|Ga0164300_10838495 | Not Available | 574 | Open in IMG/M |
| 3300012971|Ga0126369_10046720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 3674 | Open in IMG/M |
| 3300012971|Ga0126369_12756996 | Not Available | 575 | Open in IMG/M |
| 3300015374|Ga0132255_100102515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. AK1 | 3891 | Open in IMG/M |
| 3300016294|Ga0182041_10291688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1348 | Open in IMG/M |
| 3300016294|Ga0182041_10621416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 951 | Open in IMG/M |
| 3300016294|Ga0182041_11486364 | Not Available | 623 | Open in IMG/M |
| 3300016319|Ga0182033_11186304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 684 | Open in IMG/M |
| 3300016319|Ga0182033_11306701 | Not Available | 652 | Open in IMG/M |
| 3300016341|Ga0182035_11152895 | Not Available | 691 | Open in IMG/M |
| 3300016341|Ga0182035_11425552 | Not Available | 622 | Open in IMG/M |
| 3300016387|Ga0182040_11645820 | Not Available | 547 | Open in IMG/M |
| 3300016422|Ga0182039_10418379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1141 | Open in IMG/M |
| 3300016445|Ga0182038_10411396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phreatobacteraceae → Phreatobacter → Phreatobacter oligotrophus | 1136 | Open in IMG/M |
| 3300016445|Ga0182038_10509533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1027 | Open in IMG/M |
| 3300017943|Ga0187819_10691550 | Not Available | 575 | Open in IMG/M |
| 3300017959|Ga0187779_10340418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 967 | Open in IMG/M |
| 3300017966|Ga0187776_10227434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1184 | Open in IMG/M |
| 3300017973|Ga0187780_10113990 | Not Available | 1865 | Open in IMG/M |
| 3300021420|Ga0210394_11177484 | Not Available | 659 | Open in IMG/M |
| 3300021560|Ga0126371_10119303 | All Organisms → cellular organisms → Bacteria | 2659 | Open in IMG/M |
| 3300023073|Ga0247744_1081501 | Not Available | 562 | Open in IMG/M |
| 3300025912|Ga0207707_10410420 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300025932|Ga0207690_10697270 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300026054|Ga0208659_1004761 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300026067|Ga0207678_11006606 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300026089|Ga0207648_11104200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 744 | Open in IMG/M |
| 3300026720|Ga0207440_102993 | Not Available | 518 | Open in IMG/M |
| 3300026779|Ga0207471_100837 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300026829|Ga0207580_1001352 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300026853|Ga0207443_1008595 | Not Available | 574 | Open in IMG/M |
| 3300027330|Ga0207777_1098816 | Not Available | 503 | Open in IMG/M |
| 3300027371|Ga0209418_1072410 | Not Available | 617 | Open in IMG/M |
| 3300027428|Ga0207617_101076 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300027430|Ga0207561_102797 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300027911|Ga0209698_11316879 | Not Available | 528 | Open in IMG/M |
| 3300031231|Ga0170824_123947209 | Not Available | 622 | Open in IMG/M |
| 3300031474|Ga0170818_110411095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6182 | Open in IMG/M |
| 3300031573|Ga0310915_11069266 | Not Available | 561 | Open in IMG/M |
| 3300031679|Ga0318561_10565368 | Not Available | 626 | Open in IMG/M |
| 3300031681|Ga0318572_10477340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 743 | Open in IMG/M |
| 3300031747|Ga0318502_10186805 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1195 | Open in IMG/M |
| 3300031763|Ga0318537_10023987 | Not Available | 2141 | Open in IMG/M |
| 3300031768|Ga0318509_10793278 | Not Available | 524 | Open in IMG/M |
| 3300031771|Ga0318546_10790960 | Not Available | 668 | Open in IMG/M |
| 3300031794|Ga0318503_10064545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1132 | Open in IMG/M |
| 3300031821|Ga0318567_10419492 | Not Available | 759 | Open in IMG/M |
| 3300031859|Ga0318527_10105669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1159 | Open in IMG/M |
| 3300031879|Ga0306919_10119585 | Not Available | 1883 | Open in IMG/M |
| 3300031879|Ga0306919_10884854 | Not Available | 685 | Open in IMG/M |
| 3300031879|Ga0306919_11179864 | Not Available | 582 | Open in IMG/M |
| 3300031890|Ga0306925_10840056 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 950 | Open in IMG/M |
| 3300031910|Ga0306923_12002530 | Not Available | 588 | Open in IMG/M |
| 3300031912|Ga0306921_12049297 | Not Available | 608 | Open in IMG/M |
| 3300031942|Ga0310916_10951781 | Not Available | 718 | Open in IMG/M |
| 3300031942|Ga0310916_11188685 | Not Available | 631 | Open in IMG/M |
| 3300031946|Ga0310910_10348227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phreatobacteraceae → Phreatobacter → Phreatobacter oligotrophus | 1170 | Open in IMG/M |
| 3300031947|Ga0310909_10116503 | Not Available | 2164 | Open in IMG/M |
| 3300031947|Ga0310909_10496626 | Not Available | 1023 | Open in IMG/M |
| 3300031954|Ga0306926_10758102 | Not Available | 1173 | Open in IMG/M |
| 3300031954|Ga0306926_11100301 | Not Available | 940 | Open in IMG/M |
| 3300031962|Ga0307479_10514599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1180 | Open in IMG/M |
| 3300032003|Ga0310897_10003717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4110 | Open in IMG/M |
| 3300032003|Ga0310897_10149179 | Not Available | 981 | Open in IMG/M |
| 3300032025|Ga0318507_10375988 | Not Available | 619 | Open in IMG/M |
| 3300032035|Ga0310911_10069461 | Not Available | 1878 | Open in IMG/M |
| 3300032035|Ga0310911_10552466 | Not Available | 668 | Open in IMG/M |
| 3300032060|Ga0318505_10398676 | Not Available | 650 | Open in IMG/M |
| 3300032060|Ga0318505_10473774 | Not Available | 591 | Open in IMG/M |
| 3300032076|Ga0306924_10341210 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1718 | Open in IMG/M |
| 3300032076|Ga0306924_11263066 | Not Available | 795 | Open in IMG/M |
| 3300032076|Ga0306924_11558338 | Not Available | 698 | Open in IMG/M |
| 3300032091|Ga0318577_10382413 | Not Available | 673 | Open in IMG/M |
| 3300032094|Ga0318540_10137332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1167 | Open in IMG/M |
| 3300032094|Ga0318540_10550779 | Not Available | 556 | Open in IMG/M |
| 3300032179|Ga0310889_10234487 | Not Available | 863 | Open in IMG/M |
| 3300032261|Ga0306920_102750161 | Not Available | 671 | Open in IMG/M |
| 3300033004|Ga0335084_10197919 | All Organisms → cellular organisms → Bacteria | 2087 | Open in IMG/M |
| 3300033290|Ga0318519_10939890 | Not Available | 535 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.30% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.22% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.74% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.74% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.74% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.87% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.87% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.87% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023073 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5 | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026054 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026720 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A2w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026779 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A2w-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300026829 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A3-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300026853 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A5w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027428 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A2-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027430 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A1-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FA3_02644500 | 2170459023 | Grass Soil | MTLNELFANPKLNVEITRRLEAGQESVSISGNDAAKTGEF |
| AF_2010_repII_A1DRAFT_100314411 | 3300000597 | Forest Soil | MTINELFTNPKLNDDVMRRLQAGQTPISISGQQAAKTGEF* |
| JGI24752J21851_10099881 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLIELFANPKLNAEITRQLAAGQRSVSISGEDAAKTGEF* |
| Ga0070676_109825371 | 3300005328 | Miscanthus Rhizosphere | VGVDERIMTLNELFANPKLNLEITRRLEAGQKSVSISGEDAAKTGEF* |
| Ga0066388_1058005852 | 3300005332 | Tropical Forest Soil | VGVDERIMTLIELFANPKLNSEITRRLAEGQRSVSISGEDAAKTGEF* |
| Ga0070673_1004571822 | 3300005364 | Switchgrass Rhizosphere | TLNELFANPKLNSEITRQLAAGQRSVSISGEDAAKTGEF* |
| Ga0070663_1011088902 | 3300005455 | Corn Rhizosphere | VVGVDGRVLTINELFANPKLNLEITRRLEGGQKSVSISSEDAAKTAQF* |
| Ga0070681_105219662 | 3300005458 | Corn Rhizosphere | VGVDERVVTLNELFANPKLNLEITRRIEAGQKSVSISGEDAAKTGEF* |
| Ga0068867_1022881242 | 3300005459 | Miscanthus Rhizosphere | HALMRAVGVDERVVTLNELFANPKLNLEITRRIEAGQKSVSISGEDAAKTGEF* |
| Ga0070706_1015274862 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ERVVTLNELFANPKLNLEITRRIEAGQKLVSISGEDAAKTGEF* |
| Ga0070686_1003189241 | 3300005544 | Switchgrass Rhizosphere | LGFHALMRAVGVDERIMTLNELFANPKLNSEITRQLAAGQRSVSISGEDAAKTGEF* |
| Ga0066905_1001547821 | 3300005713 | Tropical Forest Soil | IGVDERILTLNELFANPKLNLEITQQLKAGQKPISISGKDAAKTGEF* |
| Ga0066903_1013285683 | 3300005764 | Tropical Forest Soil | KVMTINELFVNPKLNDDVTRRLQASQAPISISGEQAAKTGEF* |
| Ga0066903_1039557612 | 3300005764 | Tropical Forest Soil | ALMRLIGVDERVMTMNELFANPELNAKVVRRLNSGEKTISMSGEQAAMTGEF* |
| Ga0066903_1041412271 | 3300005764 | Tropical Forest Soil | HTLMRWTGVDERVMTLNELFANPKLNVEVMRRLGAGQASISISGEEAVRTAEF* |
| Ga0066903_1065468722 | 3300005764 | Tropical Forest Soil | GVDERIMTLIELFANPKLNSEITRRLAEGQRSVSISGEDAAKTGEF* |
| Ga0066903_1072253791 | 3300005764 | Tropical Forest Soil | ERVMTINELFANPKLNDEVLRRLQAGQASISISAEQAAKTGEF* |
| Ga0066903_1082295091 | 3300005764 | Tropical Forest Soil | ELFVNPKLNDEVMRRLQAGQTPISISGEQAANTGEF* |
| Ga0075432_104622122 | 3300006058 | Populus Rhizosphere | VMTLIELFANPKLNAEITRQLAAGQRSVSISGEDAAKTGEF* |
| Ga0075030_1012417001 | 3300006162 | Watersheds | MTINELFANPKLNDEVMRRLQAGQASISISGEHAAKTGEF* |
| Ga0114129_100423801 | 3300009147 | Populus Rhizosphere | TLNELFANPKLNLEITQQLKAGQKPISISGKDAVKTAEF* |
| Ga0105237_125728442 | 3300009545 | Corn Rhizosphere | RAVGVDERIMTLNELFANPKLNSEITRQLAAGQRSVSISGEDAAKTGEF* |
| Ga0126374_101655363 | 3300009792 | Tropical Forest Soil | WTGVDERVMTINELFVNPKLNDEVIRRLQAGQTAISISGEQAAKTGEF* |
| Ga0126384_101670913 | 3300010046 | Tropical Forest Soil | GFHTLMRWTGVDERIMTINELFVNPKLNDEVMRRLQAGQTPISISGEQAANTGEF* |
| Ga0126384_103825991 | 3300010046 | Tropical Forest Soil | VDERIMTLNELFANPKLNLEIARRLEAGQKSVSISGEDAANTGEF* |
| Ga0126384_105877654 | 3300010046 | Tropical Forest Soil | VDERIMTLNELFANPKLNLEIARRLEAGQKSVSISGEDAAKTGEF* |
| Ga0126373_125577961 | 3300010048 | Tropical Forest Soil | ALMRWTGVDERVMTINELFVNPKLNDEVMSRLQAGQASISISGEQAAKTGEF* |
| Ga0126379_106632281 | 3300010366 | Tropical Forest Soil | LMRGAGVDERIMTLNELFANPKLNLEIARRLEAGQKSVSISGEDAAKTGEF* |
| Ga0126381_1036359852 | 3300010376 | Tropical Forest Soil | GVDERILTLNELFANPKLNLEITQQLKAGQKPISISGKDAAKTGEF* |
| Ga0126383_102036851 | 3300010398 | Tropical Forest Soil | LMRWTGVDEKVMTINELFANPKLNDDVMRRLQAGQTPVSISGQQAAKTGEF* |
| Ga0126383_118165532 | 3300010398 | Tropical Forest Soil | LMQQIGVDERILTLNELFANPKLNLEITQQLKAGQKPISISGKDAAKTGEF* |
| Ga0126383_132385151 | 3300010398 | Tropical Forest Soil | QQIGVDERILTLNELFANPKLNLEITQQLKAGQKPISISGKDAAKTGEF* |
| Ga0134127_119370312 | 3300010399 | Terrestrial Soil | ERIMTLNELFANPKLNSEITRQLAAGQRSVSISGEDAAKTGEF* |
| Ga0137372_106332611 | 3300012350 | Vadose Zone Soil | NELFANPELNVEVMRRLGAGQASISISGEEAVRTAEF* |
| Ga0137367_108689192 | 3300012353 | Vadose Zone Soil | MGVDERVMTLNELFANPELNVEVMRRLGAGQASISISGEEAVRTAEF* |
| Ga0157303_100969742 | 3300012896 | Soil | VGVDERVMTLIELFANPKLNAEITRQLAAGQRSVSISGEDAAKTGEF* |
| Ga0164300_108384952 | 3300012951 | Soil | MRAVGVDERIMTLNELFANPKLNSEITRQLAAGQRSVSISGEDAAKTGEF* |
| Ga0126369_100467201 | 3300012971 | Tropical Forest Soil | VDERIMTLNELFANPKLNVEITNRLNAGQKLVSISGEDAAKTGEF* |
| Ga0126369_127569961 | 3300012971 | Tropical Forest Soil | GVDERIMTINELFVNPKLNDEVMRRLQAGQTPISISGEQAANTGEF* |
| Ga0132255_1001025151 | 3300015374 | Arabidopsis Rhizosphere | FHALMRAVGVDERIMTLNELFANPKLNVEITRRLEAGQRSVAISGEDAAKTAEF* |
| Ga0182041_102916881 | 3300016294 | Soil | IMTLNELFANPKLNLEITRRLQAGQKSISVSGEEAGKTGEF |
| Ga0182041_106214161 | 3300016294 | Soil | LMRWMGVDERVMTINELFVNPKLNDEVIRRLQAGQAAISISGEQAAKTGEF |
| Ga0182041_114863642 | 3300016294 | Soil | RWTGVDERIMTINELFVNPKLNDEVMRRLQAGQTPVSISGEQAAKTGEF |
| Ga0182033_111863041 | 3300016319 | Soil | NELFANPKLNLEITRRLEAGQKSVSISGEDAAKTGEF |
| Ga0182033_113067011 | 3300016319 | Soil | TGVDERVMTINELFANPKLNYEVLRRLQAGQVSISISGEQAAKTGEF |
| Ga0182035_111528952 | 3300016341 | Soil | ERIMTLNELFANPKLNLEITRRLQAGQKSISVSGEEAGKTGEF |
| Ga0182035_114255521 | 3300016341 | Soil | LFVNPKLNDEVMRRLQAGQASISISGEQAAKTGEF |
| Ga0182040_116458201 | 3300016387 | Soil | ELFVNPKLNDEVMRRLQAGQTPISISGEQAAKTGEF |
| Ga0182039_104183793 | 3300016422 | Soil | NEKVMTINELFANPKLNDDAMRRLQAGQKAISISGEQAAKTGEF |
| Ga0182038_104113961 | 3300016445 | Soil | VDERVMTLNELFANPKLNAEVMRRLGAGQASISISGEEAVRTAEF |
| Ga0182038_105095332 | 3300016445 | Soil | RPGFHALMRWMGVDERVMTINELFVNPKLNDEVIRRLQAGQTAISISGEQAAKTGEF |
| Ga0187819_106915501 | 3300017943 | Freshwater Sediment | MTINELFANPKLNDDVMRRLQAGQTPISISGEQAAKTGEF |
| Ga0187779_103404182 | 3300017959 | Tropical Peatland | MRWTGVDERVATINELFANPRLNDEVKRRLGAGQASVAISAAEAARTAEF |
| Ga0187776_102274342 | 3300017966 | Tropical Peatland | MRWTGVDEKVMTINELFVNPKLNDEVLHRLQAGQASISISGEQAATTGEF |
| Ga0187780_101139903 | 3300017973 | Tropical Peatland | WTGVDEKVMTVNELFANPKLNDEVLHRLQAGQASITISGEQAAKTGEF |
| Ga0210394_111774841 | 3300021420 | Soil | ELFANPKLNDDVMRRLQAGQTPISISGEQAAKTGEF |
| Ga0126371_101193035 | 3300021560 | Tropical Forest Soil | WTGVDEKVMTINELFVNPKLNDDVTRRLQAGQASISISGEQAAKTGEF |
| Ga0247744_10815012 | 3300023073 | Soil | ERMMTLNELFANPKLNSEITRQLAAGQRSVSISGEDAAKTGEF |
| Ga0207707_104104201 | 3300025912 | Corn Rhizosphere | VGVDERVVTLNELFANPKLNLEITRRIEAGQKSVSISGEDAAKTGEF |
| Ga0207690_106972702 | 3300025932 | Corn Rhizosphere | VGVDERIMTLNELFANPKLNLEITRRLEAGQKSVSISGEDAAKTGEF |
| Ga0208659_10047612 | 3300026054 | Natural And Restored Wetlands | ERVLTLNELFANPKLNLEITRRLEAGQKSVSISGEDAAKTGEF |
| Ga0207678_110066061 | 3300026067 | Corn Rhizosphere | VVGVDGRVLTINELFANPKLNLEITRRLEGGQKSVSISSEDAAKTAQF |
| Ga0207648_111042002 | 3300026089 | Miscanthus Rhizosphere | PGIHALLRWTGVDERVLTLNELFANPKLNVEVARRLKDGQASISISGEAAAKTGEF |
| Ga0207440_1029932 | 3300026720 | Soil | RLGFHALMQAVGVDERVMTLIELFANPKLNAEITRQLAAGQRSVSISGEDAAKTGEF |
| Ga0207471_1008372 | 3300026779 | Soil | FHALMQAVGVDERVMTLIELFANPKLNAEITRQLAAGQRSVSISGEDAAKTGEF |
| Ga0207580_10013521 | 3300026829 | Soil | LIELFANPKLNAEITRQLAAGQRSVSISGEDAAKTGEF |
| Ga0207443_10085951 | 3300026853 | Soil | LGFHALMQAVGVDERVMTLIELFANPKLNAEITRQLAAGQRSVSISGEDAAKTGEF |
| Ga0207777_10988162 | 3300027330 | Tropical Forest Soil | FNNRAGFHTLMRWTGVDEKVMTINELFANPKLNDDVMRRLQAGQTPISISGEQAAKTGQF |
| Ga0209418_10724102 | 3300027371 | Forest Soil | GFHALMRWTGVDERVMTINELFANPKLNDEVLRRLQSGQASISISAEQAAKTGEF |
| Ga0207617_1010761 | 3300027428 | Soil | DERVMTLIELFANPKLNAEITRQLAAGQRSVSISGEDAAKTGEF |
| Ga0207561_1027971 | 3300027430 | Soil | MQAVGVDERVMTLIELFANPKLNAEITRQLAAGQRSVSISGEDAAKTGEF |
| Ga0209698_113168792 | 3300027911 | Watersheds | RWTGVDERVMTINELFANPKLNDEVMRRLQAGQASISISGEHAAKTGEF |
| Ga0170824_1239472092 | 3300031231 | Forest Soil | DERVMTINELFVNPKLNDEVMRQLQAGQASISISGEQAAKTGEF |
| Ga0170818_1104110956 | 3300031474 | Forest Soil | GVDERVMTLNELFANPKLNVEITRRLEAGQESVSISGNDAAKTGEF |
| Ga0310915_110692662 | 3300031573 | Soil | ELFVNPKLNDEVMRRLQAGQTPVSISGEQAAKTGQF |
| Ga0318561_105653681 | 3300031679 | Soil | FHTLMRWTGVDEKVMTINELFANPKLNDDVMRRLQAGQTPISISGQQAAKTGEF |
| Ga0318572_104773401 | 3300031681 | Soil | HALMRGVGVDERIMTLNELFANPKLNIEITRRLEAGQKSVSISGEDAAKTGEF |
| Ga0318502_101868051 | 3300031747 | Soil | GVGVDERIMTLNELFANPKLNIEITRRLEAGQKSVSISGEDAAKTGEF |
| Ga0318537_100239871 | 3300031763 | Soil | LFVNPKLNDEVMRRLQAGQTSISISGEQAANTGEF |
| Ga0318509_107932782 | 3300031768 | Soil | MTINELFVNPKLNDEVIRRLQAGQTAISISGEQAAKTGEF |
| Ga0318546_107909602 | 3300031771 | Soil | IGVDEKVITINELFANPKLNGEIVRRLQTGHESISISGQDAAITGEF |
| Ga0318503_100645453 | 3300031794 | Soil | ELFANPKLNDEVMRRLQAGQTSISISGEQAANTGEF |
| Ga0318567_104194921 | 3300031821 | Soil | LMRWTGVDEKVMTINELFANPKLNDDVMRRLQAGQTPISISGQQAAKTGEF |
| Ga0318527_101056692 | 3300031859 | Soil | RIMTLNELFANPKLNIEITRRLEAGQKSVSISGEDAAKTGEF |
| Ga0306919_101195853 | 3300031879 | Soil | TINELFANPKLNDEVMRRLQAGQTSISISGEQAANTGEF |
| Ga0306919_108848542 | 3300031879 | Soil | LFANPKLNDDLMRRLQAGQTPISISGEQAAKTGEF |
| Ga0306919_111798641 | 3300031879 | Soil | ELFANPKLNDDAMRRLQAGQKAISISGEQAAKTGEF |
| Ga0306925_108400562 | 3300031890 | Soil | GYFNNRAGFHTLMRWTGVDEKVMTINELFANPKLNDDLMRRLQAGQTPISISGEQAAKTGEF |
| Ga0306923_120025301 | 3300031910 | Soil | INELFANPKLNDDVMRRLQAGQIPISISGEQAAKTGEF |
| Ga0306921_120492971 | 3300031912 | Soil | PGFHALMRWMGVDERVMTINELFANPKLNDEVLRRLQAGQVSISISGEQAAKTGEF |
| Ga0310916_109517812 | 3300031942 | Soil | RWTGVNEKVMTINELFANPKLNDDAMRRLQAGQKAISISGEQAAKTGEF |
| Ga0310916_111886852 | 3300031942 | Soil | NRAGFHTLMRWTGVDERIMTINELFVNPKLNDEVMRRLQAGQTPISISGEQAANTGEF |
| Ga0310910_103482271 | 3300031946 | Soil | ELFANPKLNAEVMRRLGAGQASISISGEEAVRTAEF |
| Ga0310909_101165033 | 3300031947 | Soil | LFVNPKLNDEVMRRLQAGQTPVSISGEQAAKTGEF |
| Ga0310909_104966261 | 3300031947 | Soil | LNELFANPKLNLEITRRLQAGQKSISVSGEEAGKTGEF |
| Ga0306926_107581021 | 3300031954 | Soil | EKVMTINELFANPKLNDDLMRRLQAGQTPISISGEQAAKTGEF |
| Ga0306926_111003011 | 3300031954 | Soil | NRAGFHTLMRWTGVDEKVMTINELFANPKLNDDVMRRLQAGQTPISISGEQAAKTGEF |
| Ga0307479_105145991 | 3300031962 | Hardwood Forest Soil | NELFANPKLNDDVMRRLQAGQTPISISGEQAAKTGEF |
| Ga0310897_100037175 | 3300032003 | Soil | TLNELFANPKLNLEITRRIEAGQKSVSISGEDAAKTGEF |
| Ga0310897_101491791 | 3300032003 | Soil | GVDERVMTLNELFANPELNVEVMRRLGAGQASISISGEEAVKTAEF |
| Ga0318507_103759882 | 3300032025 | Soil | HTLMRWTGVDEKVMTINELFANPKLNDDVMRRLQAGQTPISISGEQAAKTGQF |
| Ga0310911_100694613 | 3300032035 | Soil | YFNNRAGFHTLMRWTGVDEKVMTINELFANPKLNDDVMRRLQAGQTPISISGQQAAKTGE |
| Ga0310911_105524661 | 3300032035 | Soil | RPGFHALMRWTGVDEKVMTINELFANPKLNDEVLHRLQAGQASISISGEQAAQTGEF |
| Ga0318505_103986761 | 3300032060 | Soil | MRWTGVDEKVMTINELFANPKLNDDVMRRLQAGQTPISISGQQAAKTGEF |
| Ga0318505_104737741 | 3300032060 | Soil | WTGVDEKVMTINELFANPKLNDDVMRRLQAGQTPISISGEQAAKTGQF |
| Ga0306924_103412102 | 3300032076 | Soil | ELFVNPKLNDEVIRRLQAGQAAISISGEQAAKTGEF |
| Ga0306924_112630663 | 3300032076 | Soil | GVDDRIMTINELFVNPKLNDEVMRRLQAGQTPVSISGEQAAKTGEF |
| Ga0306924_115583381 | 3300032076 | Soil | PGFHALMRWMGVDERVMTINELFVNPKLNDEVMRRLQAGQASISISGEQAAKTGEF |
| Ga0318577_103824131 | 3300032091 | Soil | EKVMTIIVLFANPKLIDVVMRRLQAGQTPISISGEQAAKTGQF |
| Ga0318540_101373321 | 3300032094 | Soil | WTGVDEKVMTINELFANPKLNDDVMRRLQAGQTPISISGQQAAKTGEF |
| Ga0318540_105507791 | 3300032094 | Soil | PGFHNLMRLIGVDEKVITINELFANPKLNGEIVRRLQTGHESISISGQDAAITGEF |
| Ga0310889_102344872 | 3300032179 | Soil | ELFANPKLNVEVMRRLGAGQASISISGEEAVRTAEF |
| Ga0306920_1027501611 | 3300032261 | Soil | TLMRWTGVDEKVMTINELFANPKLNDDLMRRLQAGQTPISISGEQAAKTGEF |
| Ga0335084_101979191 | 3300033004 | Soil | TLNELFANPKLNIEITRRLEAGQKSVSISGEDAARTGEF |
| Ga0318519_109398901 | 3300033290 | Soil | FHNLMRLIGVDEKVITINELFANPKLNGEIVRRLQTGHESISISGQDAAITGEF |
| ⦗Top⦘ |