NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F078742

Metagenome / Metatranscriptome Family F078742

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F078742
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 91 residues
Representative Sequence MEELSVGSGSDLIDNGWLEIEEDGSWDVLSSTSLGEEGVESIITTTDGFVGWHLTIWLDSVLEAEELPACVTDLDTGLTDVDGNDF
Number of Associated Samples 111
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 85.96 %
% of genes near scaffold ends (potentially truncated) 59.48 %
% of genes from short scaffolds (< 2000 bps) 98.28 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction Yes
3D model pTM-score0.17

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (63.793 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(24.138 % of family members)
Environment Ontology (ENVO) Unclassified
(59.483 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(56.897 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.16%    β-sheet: 0.00%    Coil/Unstructured: 86.84%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.17
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF03953Tubulin_C 3.45
PF00091Tubulin 3.45



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.66 %
UnclassifiedrootN/A35.34 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000557|SL_8KL_010_SEDDRAFT_10162910Not Available643Open in IMG/M
3300002039|LBB32012_10037381All Organisms → cellular organisms → Eukaryota1526Open in IMG/M
3300003681|Ga0008457_1007873All Organisms → cellular organisms → Eukaryota1257Open in IMG/M
3300003721|Ga0008275_108693Not Available1193Open in IMG/M
3300003909|JGI26087J52781_1027742All Organisms → cellular organisms → Eukaryota603Open in IMG/M
3300004785|Ga0058858_1412216All Organisms → cellular organisms → Eukaryota560Open in IMG/M
3300005841|Ga0068863_101472742Not Available689Open in IMG/M
3300005987|Ga0075158_10343622Not Available842Open in IMG/M
3300006403|Ga0075514_1228338All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Giardiinae → Giardia → Giardia intestinalis938Open in IMG/M
3300006404|Ga0075515_10075120All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Giardiinae → Giardia → Giardia intestinalis1275Open in IMG/M
3300007329|Ga0079240_1379683All Organisms → cellular organisms → Eukaryota666Open in IMG/M
3300007667|Ga0102910_1120185All Organisms → cellular organisms → Eukaryota613Open in IMG/M
3300007725|Ga0102951_1090999Not Available868Open in IMG/M
3300007725|Ga0102951_1095079All Organisms → cellular organisms → Eukaryota847Open in IMG/M
3300008993|Ga0104258_1089216All Organisms → cellular organisms → Eukaryota → Opisthokonta576Open in IMG/M
3300009057|Ga0102892_1086487Not Available606Open in IMG/M
3300009068|Ga0114973_10681248All Organisms → cellular organisms → Eukaryota524Open in IMG/M
3300009432|Ga0115005_11340700Not Available584Open in IMG/M
3300009434|Ga0115562_1318896All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Giardiinae → Giardia → Giardia intestinalis530Open in IMG/M
3300009436|Ga0115008_11452507Not Available529Open in IMG/M
3300009436|Ga0115008_11599136Not Available506Open in IMG/M
3300009442|Ga0115563_1381911All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Giardiinae → Giardia → Giardia intestinalis501Open in IMG/M
3300009507|Ga0115572_10440323All Organisms → cellular organisms → Eukaryota726Open in IMG/M
3300009606|Ga0115102_10531736Not Available685Open in IMG/M
3300009790|Ga0115012_11551601All Organisms → cellular organisms → Eukaryota571Open in IMG/M
3300010987|Ga0138324_10462784All Organisms → cellular organisms → Eukaryota626Open in IMG/M
3300012522|Ga0129326_1266762All Organisms → cellular organisms → Eukaryota873Open in IMG/M
3300012523|Ga0129350_1141377All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Oomycota987Open in IMG/M
3300012709|Ga0157608_1069924All Organisms → cellular organisms → Eukaryota → Opisthokonta575Open in IMG/M
3300012953|Ga0163179_12150948All Organisms → cellular organisms → Eukaryota516Open in IMG/M
3300016732|Ga0182057_1005275All Organisms → cellular organisms → Eukaryota638Open in IMG/M
3300016734|Ga0182092_1079398All Organisms → cellular organisms → Eukaryota1408Open in IMG/M
3300016737|Ga0182047_1531519All Organisms → cellular organisms → Eukaryota574Open in IMG/M
3300016739|Ga0182076_1209704All Organisms → cellular organisms → Eukaryota612Open in IMG/M
3300016766|Ga0182091_1013937All Organisms → cellular organisms → Eukaryota → Opisthokonta773Open in IMG/M
3300016781|Ga0182063_1123188All Organisms → cellular organisms → Eukaryota694Open in IMG/M
3300017985|Ga0181576_10422895All Organisms → cellular organisms → Eukaryota828Open in IMG/M
3300018599|Ga0188834_1014939All Organisms → cellular organisms → Eukaryota806Open in IMG/M
3300018759|Ga0192883_1011933All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Giardiinae → Giardia → Giardia intestinalis1416Open in IMG/M
3300018781|Ga0193380_1023155All Organisms → cellular organisms → Eukaryota949Open in IMG/M
3300018825|Ga0193048_1033350All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Giardiinae → Giardia → Giardia intestinalis775Open in IMG/M
3300018871|Ga0192978_1102166Not Available515Open in IMG/M
3300018926|Ga0192989_10026723All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Giardiinae → Giardia → Giardia intestinalis1409Open in IMG/M
3300018975|Ga0193006_10181857Not Available621Open in IMG/M
3300019048|Ga0192981_10267640All Organisms → cellular organisms → Eukaryota648Open in IMG/M
3300019081|Ga0188838_101024All Organisms → cellular organisms → Eukaryota1276Open in IMG/M
3300019099|Ga0193102_1013847All Organisms → cellular organisms → Eukaryota733Open in IMG/M
3300019116|Ga0193243_1020073All Organisms → cellular organisms → Eukaryota872Open in IMG/M
3300019149|Ga0188870_10049649All Organisms → cellular organisms → Eukaryota1015Open in IMG/M
3300020013|Ga0182086_1251078All Organisms → cellular organisms → Eukaryota → Sar564Open in IMG/M
3300020014|Ga0182044_1345648All Organisms → cellular organisms → Eukaryota808Open in IMG/M
3300020441|Ga0211695_10407485Not Available516Open in IMG/M
3300021334|Ga0206696_1280664All Organisms → cellular organisms → Eukaryota619Open in IMG/M
3300021348|Ga0206695_1799265Not Available710Open in IMG/M
3300021353|Ga0206693_1501293All Organisms → cellular organisms → Eukaryota1427Open in IMG/M
3300021355|Ga0206690_10182171All Organisms → cellular organisms → Eukaryota708Open in IMG/M
3300021882|Ga0063115_1000660Not Available1465Open in IMG/M
3300021913|Ga0063104_1002165All Organisms → cellular organisms → Eukaryota1429Open in IMG/M
3300021921|Ga0063870_1008585Not Available575Open in IMG/M
3300021960|Ga0222715_10336595Not Available845Open in IMG/M
3300022513|Ga0242667_1003952All Organisms → Viruses → Predicted Viral1094Open in IMG/M
3300022528|Ga0242669_1043927Not Available744Open in IMG/M
3300023175|Ga0255777_10610412All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Giardiinae → Giardia → Giardia intestinalis539Open in IMG/M
3300023674|Ga0228697_107928All Organisms → cellular organisms → Eukaryota998Open in IMG/M
3300023691|Ga0228704_115387Not Available615Open in IMG/M
3300024343|Ga0244777_10602580All Organisms → cellular organisms → Eukaryota665Open in IMG/M
3300024343|Ga0244777_10938629All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Maleae → Malus → Malus domestica503Open in IMG/M
3300025645|Ga0208643_1171795All Organisms → cellular organisms → Eukaryota532Open in IMG/M
3300025701|Ga0209771_1115378Not Available870Open in IMG/M
3300025704|Ga0209602_1227950Not Available533Open in IMG/M
3300025890|Ga0209631_10486188Not Available552Open in IMG/M
3300026449|Ga0247593_1086591Not Available613Open in IMG/M
3300027810|Ga0209302_10085808All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens1609Open in IMG/M
3300027833|Ga0209092_10583234Not Available561Open in IMG/M
3300028124|Ga0228621_1062702All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Giardiinae → Giardia → Giardia intestinalis556Open in IMG/M
3300028575|Ga0304731_11363408Not Available506Open in IMG/M
3300028672|Ga0257128_1063948All Organisms → cellular organisms → Eukaryota760Open in IMG/M
3300030591|Ga0247626_1269043Not Available507Open in IMG/M
3300030720|Ga0308139_1008861All Organisms → cellular organisms → Eukaryota1372Open in IMG/M
3300030721|Ga0308133_1008891All Organisms → cellular organisms → Eukaryota1420Open in IMG/M
3300030722|Ga0308137_1050218Not Available744Open in IMG/M
3300030725|Ga0308128_1005585All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens1419Open in IMG/M
3300030729|Ga0308131_1030939All Organisms → cellular organisms → Eukaryota1118Open in IMG/M
3300030938|Ga0138299_10250734Not Available1568Open in IMG/M
3300031099|Ga0308181_1065342Not Available723Open in IMG/M
3300031542|Ga0308149_1011384All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens1096Open in IMG/M
3300031557|Ga0308148_1005177All Organisms → cellular organisms → Eukaryota1417Open in IMG/M
3300031558|Ga0308147_1005834All Organisms → cellular organisms → Eukaryota1447Open in IMG/M
3300031569|Ga0307489_11176056Not Available553Open in IMG/M
3300031579|Ga0308134_1021065All Organisms → cellular organisms → Eukaryota1496Open in IMG/M
3300031580|Ga0308132_1019436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens1403Open in IMG/M
3300031580|Ga0308132_1019574All Organisms → cellular organisms → Eukaryota1398Open in IMG/M
3300031581|Ga0308125_1011172All Organisms → cellular organisms → Eukaryota1430Open in IMG/M
3300031602|Ga0307993_1028769All Organisms → cellular organisms → Eukaryota → Opisthokonta1392Open in IMG/M
3300031626|Ga0302121_10190592Not Available582Open in IMG/M
3300031725|Ga0307381_10344611All Organisms → cellular organisms → Eukaryota542Open in IMG/M
3300032019|Ga0315324_10338089All Organisms → cellular organisms → Eukaryota545Open in IMG/M
3300032463|Ga0314684_10663079Not Available603Open in IMG/M
3300032470|Ga0314670_10250140Not Available908Open in IMG/M
3300032481|Ga0314668_10207450All Organisms → cellular organisms → Eukaryota999Open in IMG/M
3300032491|Ga0314675_10433840All Organisms → cellular organisms → Eukaryota654Open in IMG/M
3300032616|Ga0314671_10706256Not Available541Open in IMG/M
3300032617|Ga0314683_10815105All Organisms → cellular organisms → Eukaryota562Open in IMG/M
3300032617|Ga0314683_10966674Not Available503Open in IMG/M
3300032650|Ga0314673_10632062Not Available551Open in IMG/M
3300032711|Ga0314681_10153322Not Available1179Open in IMG/M
3300032724|Ga0314695_1378344Not Available538Open in IMG/M
3300032726|Ga0314698_10136033All Organisms → cellular organisms → Eukaryota1078Open in IMG/M
3300032727|Ga0314693_10090390All Organisms → cellular organisms → Eukaryota1371Open in IMG/M
3300032734|Ga0314706_10497945Not Available586Open in IMG/M
3300032745|Ga0314704_10208873All Organisms → cellular organisms → Eukaryota1055Open in IMG/M
3300032746|Ga0314701_10150354All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Giardiinae → Giardia → Giardia intestinalis1016Open in IMG/M
3300032748|Ga0314713_10050047All Organisms → cellular organisms → Eukaryota1459Open in IMG/M
3300032754|Ga0314692_10162421All Organisms → cellular organisms → Eukaryota1167Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine24.14%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater14.66%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine9.48%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh8.62%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater6.03%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.31%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.45%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.45%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.59%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.59%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.72%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.72%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water1.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.86%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.86%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.86%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.86%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.86%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.86%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.86%
Alkaline SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.86%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.86%
Delisea PulchraHost-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.86%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.86%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000557Alkaline sediment microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 8KL_010_SEDEnvironmentalOpen in IMG/M
3300002039Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_LB_B3Host-AssociatedOpen in IMG/M
3300003681Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_48_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003682Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_03_M0_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003721Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003909Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_DNAEnvironmentalOpen in IMG/M
3300004785Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005987Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNAEngineeredOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006404Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007329Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 c16 Surf_B metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009057Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012709Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300016732Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016734Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016739Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016781Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101409CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017985Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018599Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dTEnvironmentalOpen in IMG/M
3300018759Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000759 (ERX1789554-ERR1719287)EnvironmentalOpen in IMG/M
3300018781Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001992 (ERX1789655-ERR1719256)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019081Metatranscriptome of marine microbial communities from Baltic Sea - GS676_3p0_dTEnvironmentalOpen in IMG/M
3300019099Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000927 (ERX1782419-ERR1712084)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300020013Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020441Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006)EnvironmentalOpen in IMG/M
3300021334Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021882Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022513Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022528Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023175Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaGEnvironmentalOpen in IMG/M
3300023674Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 90R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023691Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17_Aug_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025704Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028124Seawater microbial communities from Monterey Bay, California, United States - 25DEnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300028672Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030591Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030722Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030725Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1298_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030729Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1108_32.2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030938Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031542Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_331_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031557Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_328_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031558Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_325_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031581Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1286_33.1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031656Marine microbial communities from water near the shore, Antarctic Ocean - #67EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032019Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 21515EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032726Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SL_8KL_010_SEDDRAFT_1016291023300000557Alkaline SedimentVEELSVGTGSDFVNNGRLQVEEDTSGDVLASTSLGEEGVEGIITTSDSLVRGHLSVGLDTVLEAEELPACVTNLDTGLTNVNG
LBB32012_1003738143300002039Delisea PulchraVEQLSVGTGSDLIDYGRLEVKEDGSWDVLASSSLAEEGVEGIVSSSDGLIRWHLTVWLDTVLKAEQFPTGVTNLNTSLSDMD*
Ga0008457_100787313300003681SeawaterVEQLSVGSGTDFIDNGGFEIEEYGSGDVFAGTSLGEEGVEGVVTTTDGLIGGHLTVRLNSVLEAEELPACVTDLDTGLTDVDRNDFSHYDDK
Ga0008456_100851713300003682SeawaterMSSGEVVSGIFLSGDELLGVEKLSVGSGSDLIDNGGLKIEEDGSGDVLASTSLGEEGVESVVTATDSLIGWHLTVRLDSVLEAEEFPAGVTNLDTGLTDVDRNDFSHCDVWS
Ga0008275_10869313300003721MarineMEELSVGTSSNLINDGWLKIEHDSSWDVLTGTSLGEEGVEGIVTTTDGFIGWHLTVWLNSVLEAEELPACVTDLDTGLTDVDGNDFSHYEVEE
JGI26087J52781_102774223300003909MarineMEELSVGTSSNLINDGWLKIEHDSSWDVLTGTSLGEEGVEGIVTTTDGFIRWHLTVWLNSVLKAEKLPAGVTNLDTGLTDVDGNDFSHYEVEE
Ga0058858_141221623300004785Host-AssociatedMEELSVGTSSDFIDDGWLEIEEDGSWDVLAGTGFGEEGVESIITTSDGLVRWHLTIRLDTVFKAEKFPAGVTDLDTSLTDVNTDDFSH
Ga0068863_10147274213300005841Switchgrass RhizosphereVEELPVGTSSTSIDNSGFQVEENTYGDVLASTSLGEEYVESIIITSNSLIRGHLSVRLNSVFETEEFPAGVTYLDTGLTNVD*
Ga0075158_1034362223300005987Wastewater EffluentVEELSVGTSPDLVDDSGFKIEEDAAGNVLSGTGLAEEGVEGIITATDGFIGGHLSVRLDSVLEAEEFPAGIADLNTSLTNVNGDNFSHEETFELI*
Ga0075514_122833833300006403AqueousMEELSVGSSSNLINNGWLKIEEDGSWDVLSGTSLGEEGVESIITTTDGFIGWHLTIWLDSVLEAEKLPAGVTNLDTGLT
Ga0075515_1007512033300006404AqueousMEELSVGSSSNLINNGWLKIEEDGSWDVLSGTSLGEEGVESIITTTDGFIGWHLTIWLDSVLEAEKLPAGVTNLDTGLTDVDGNDFSH
Ga0079240_137968323300007329MarineVEQLTVGTSTDFIDDGWLEIEEYTSWDVLASTSLGEEGVESVITTTDGFIGWHLTIRLDTVLEAEKLPAGVTNLDTGLTDVDGN
Ga0102910_112018523300007667EstuarineMEELSVGTSSNLINDGWLKIEHDSSWDVLTGTSLGEEGVEGIVTTTDGFIRWHLTVWLNSVLKAEKLPAGVTNLDTGLSDVDGNDFSHCMKFEKFEKVK*
Ga0102951_109099923300007725WaterMEELSVGSGSNLIDNGWLEIKEDASWDVLTSSGLREEGVEGIITTSDGFVGWHLTIWLDSVLEAEELPACVTNLDTGLTDVDRNNLSHG*
Ga0102951_109507913300007725WaterVEELSVGSGSDLINDGWLEIEEDASWDVLSSSGLGEEGVESIITTTDGFVGWHLTIWLDSVLKAEELPAGITDLDTSLSDVD*
Ga0104258_108921623300008993Ocean WaterMEQLTVGTSADFIDNSGFEIEENATGDVLTGTSLGEEGVESIIATTDSLIGGHLTIRLNTVLKAEKFPAGVTNLDTGLTDMDRNDFTHYD
Ga0102892_108648713300009057EstuarineMEELSVGTSSNLINDGWLKIEHDSSWDVLTGTSLGEEGVEGIVTTTDGFIGWHLTVWLNSVLEAEELPACVTDLDTGLTDVDGNDFSHYEVEEVVKIKINYKFLQVSPL*
Ga0114973_1068124813300009068Freshwater LakeDFIDDGGFQIEENTSGHVFASSGLGEEGVEGIVTASNGLVRWHLAVWLNTMLKAEEFPAGVTYLDTGLSNVD*
Ga0115005_1134070013300009432MarineVEQLSIGTGSDFIDNGGFEIEEDGSGDVLTSTSLGEEGVEGVVTTTDSLIGGHLTVRLNSVLEAEKFPACVTDLDTGLTDVDRNDFSHCDVEIILGLKL*
Ga0115562_131889613300009434Pelagic MarineDELLWMEELSVGSGSDLIDNGWLEIEEDSSWDVLTSTSLGEEGVESVITTTDGFVGWHLTVWLDSVLKAEKLPAGVTNLDTGLTDVD*
Ga0115008_1145250713300009436MarineVEQLSVGSGTDFIDNGGFEIEEDGSGDVFAGTSLGEEGVEGVVTTTDGLIGGHLTVRLNSVLEAEELPACVTDLDTGLTDVDRNDFSHYDDKMGLFKRL*
Ga0115008_1159913613300009436MarineMEELSVGSGSDLIDNGWLEIEEDSSWDVLTGTSLGEEGVESVITTTDGFVGWHLTVRLDSVLEAEKLPAGVTDLDTALSDMDRNNFSHDEKFLK*
Ga0115563_138191113300009442Pelagic MarineSVGSGSDLIDNGWLEIEEDSSWDVLTSTGLGEEGVEGIVTTTDGFIGWHLTVRLDSVLEAEKLPAGVTNLDTGLTDVDGNDFSHDEVVGFCKK*
Ga0115572_1044032313300009507Pelagic MarineVEQLSVGTGSDLIDNGWLEIEEDSSWDVFTSTSLGEEGVEGIVTTTDRFIRWHLTVRLDSVLEAEKFPAGVTDLDTGLTDVDRNDFSHCVCFVF*
Ga0115102_1053173613300009606MarineVEQLSVGSGTDFIDNGGFEIEEYGSGDVFAGTSLGEEGVEGVVTTTDGLIGGHLTVRLNSVLEAEELPACVTDLDTGLSDVDRNDFS
Ga0115012_1155160123300009790MarineMEELSVGSGSDLIDNGWLEIEEYGSWDVLSGTSLGEEGVEGIVTTTNGFVGWHLTIWLDSVLEAEKLPAGVTNLDTGLTDVDGNDFSHVEKWSVFCKKGK*
Ga0138324_1046278413300010987MarineMEELPVCSSSDLIDDGWLKIKEDGSWNVLASTSLGEEGVESIITATDGLVRGHLAVRLDAVLEAEKFPGGITDLDTSLTEMDIDNFAHIASL*
Ga0129326_126676223300012522AqueousMEELSVSSSSNFIDYGWLEIEEDTSWDVLSSTGLREEGVEGIITTTDGLIGGHLAIRLDTVLKAVQLPAGVTDLDTALANVD*
Ga0129350_114137723300012523AqueousLSVGSSSDFIDNGWLEIKEDSSWDMLTSTGFREEGVEGIITATDGFVGWHLTIWLDSVLKAEKFPASVTDLDTGLSDMDRDNLSHLKGE
Ga0157608_106992413300012709FreshwaterVEELSVGTSSDFIDNGWFKINEDSSGDVLAGTSLREEGVEGIITTTDGLVRWHLAVRLDTVFQAEKFPAGVTDLDTTLTDVNRNDFSHLLGSL
Ga0163179_1215094813300012953SeawaterVGSILLTGDELLGVEELSVGTSSDLIDNGGFEIEEDASGDVLASTSLGEEGVESIIATTDSLVGWHLTVWLDTVLEAEELPACVTDLDTGLTNVD*
Ga0182057_100527523300016732Salt MarshMEELSVGSSSNLINNGWLKIEEDGSWDVLSGTSLGEEGVESIITTTDGFIGWHLTIWLDSVLKAEKLPACITDL
Ga0182092_107939813300016734Salt MarshMEKLSVGSSSNFIDDCWFKIKEDSSWDMLSGTGFREEGVEGIITATDGFIRRHLTIWLDSVLKAEKFPACVTDLDTGLTNMNRNDLSHCVFL
Ga0182047_153151913300016737Salt MarshMEKLSVGSSSNFIDDCWFKIKEDSSWDMLSGTGFREEGVEGIITATDGFIRRHLTIWLDSVLKAEKFPACVTDLDTGLTNMNRNDLSH
Ga0182076_120970423300016739Salt MarshVSSGEVVGSIFFTGDELLWVEELSVGTSSNLINDGWLKIKEDSSWDVFTGTGFGEEGVEGVITTTDGFIGWHLTVWLDTVLKAEKLPAGVTDLETSLTDVD
Ga0182091_101393713300016766Salt MarshMEELSVGSGSDLIDNGWLEIEEDGSWDVLSSTSLGEEGVESIITTTDGFVGWHLTIWLDSVLEAEELPACVTDLDTGLTDVDGNDF
Ga0182063_112318813300016781Salt MarshMEELSVGSSSNLINNGWLKIEEDGSWDVLSGTSLGEEGVESIITTTDGFIGWHLTIWLDSVLEAEKLPAGITNLDTGLTDVDGNDF
Ga0181576_1042289523300017985Salt MarshMEELSVGSSSNLINDGWLKIEHDSSWDVLTGTSLGEEGVEGIVTTTDGFIGWHLTVWLNSVLEAEKLPACVTDLDTGLTDVDGNDFSHCMKFEKFEKVK
Ga0188834_101493913300018599Freshwater LakeMEELSVGSGSDLIDNGWLEIEEDSSWDVLTGTSLGEEGVEGIVTTTDGFIGWHLTVWLNSVLEAEKLPACVTDLDTGLTDVDGNDFSHYEVEEVVKIKINYKVLQVSPL
Ga0192883_101193313300018759MarineMEELSVSSGSNFIDNGWLEIEEDGSWNVLTSTSLGEEGVESVVTTTDRFVGWHLTVWLDSVLEAEEFPTGVTNLKTGLTDMD
Ga0193380_102315533300018781MarineVEELSVGSGSDFIDDGGFEIEEDGSGDVLSSTSLGEEGVEGVVTTTDGLVGGHLTVRLDTVLEAEELPACVTDLDTGLSNVD
Ga0193048_103335023300018825MarineMEELSVGTGSNLIDNGWFEIEEDGSWDVFTSTSLGEEGVESVITTTDGFVGWHLTVRLDSVLEAEKLPAGVTDLDTGLTDVDG
Ga0192978_110216613300018871MarineMEELSVSSGSNFIDDGWFEIEEDGSWDVLTSTSLGEEGVESVVTTTDRFIGWHLTIRLDSVLEAEELPACVTDLDTGLTDVD
Ga0192989_1002672333300018926MarineMEELSVGSGSDLIDNGWLEIEEDGSWDVLTSTSLGEEGVEGIVTTTDGFIGWHLTVRLDTVLEAEKLPAGVTDLDTGLTDVDGNDFSHLVGC
Ga0193006_1018185713300018975MarineMEELSVGSGSNLIDNGWLKIEEDGSWNMLSSTGLREEGVEGIITTANGFVGWHLSIGLDSVLKAEELPACVTGLDTGLSDVNGNDFSHDEVKLFFK
Ga0192981_1026764013300019048MarineVEQLSVGSGTDFIDNGGLEIEEDGTGDVFAGTSLGEEGVEGVVTTTDSLIGGHLTVRLNSVLEAEELPACVTDLDTGLTDVD
Ga0188838_10102413300019081Freshwater LakeMEELSVGSGSDLIDNGWLEIEEDSSWDVLTSTSLGEEGVEGIVTTTDGFIGWHLTVRLDSVLEAEKLPAGVTDLDTALSNMDGNDFSHDEVG
Ga0193102_101384713300019099MarineMEELSVSSGSDLINNGWLEIEEDGSWDVLSGTSLGEEGVESIITTSDGLVRWHLTVWLDSVLKAEEFPASITDLDTGLSNVNRNDFSHFEVRLIVLKRNKGFPM
Ga0193243_102007313300019116MarineMEELSVGSGSDLIDNGWLEIEEDSSWDVLTGTSLGEEGVESVVTTTDGFVGWHLTVWLDTVLEAEKLPAGVTNLDTGLTDVNGNDLSHLKCLCFVKSKKEFPM
Ga0188870_1004964923300019149Freshwater LakeMEELSVGSGSDLINNGWLKIEEDGSWDMLSSTSLGEEGVEGIVTTTNGFVGWHLTIWLNTVLEAEKLPAGVTDLDTGLTDVDGNNFSHYEECVF
Ga0182086_125107823300020013Salt MarshMEELSVGSSSYLINDGWLEIEENASWDVLSSSSLGEEGVESIITTTNGFVGWHLTIWLDTVLKAEELPTGVTDLDTSL
Ga0182044_134564823300020014Salt MarshMEELSVGSSSNLINDGWLKIEHDSSWDVLTGTSLGEEGVEGIVTTTDGFIRWHLTVWLNSVLEAEKLPACVTDLDTGLTDVDG
Ga0211695_1040748523300020441MarineMEELSVGSSSDLIDNGWLEIEEDSSWDVLTSTSLGEEGVESVITTTDGFIGWHLTIRLDTVLEAEKLPAGVTNLDTGLTDVDGNDFSHGVLEVVKVKV
Ga0206696_128066413300021334SeawaterMEELSVGSGSDLIDNGWLEIEENGSWDMLSSTSLGEEGVEGIITTTDGFVGWHLTIWLDSVLEAEERPTGVTNLETGLSDMN
Ga0206695_179926523300021348SeawaterMEELSVGSGSDFIDNGGFEIEEDGTGDVLSSTSLGEEGVESVVTTTDGLVRWHLTIGLDSVLEAEEFPAGVTNLDTGLSNVN
Ga0206693_150129333300021353SeawaterVEELSVGSGSDFIDDGGFEIEENGTGDVLSSTSLGEEGVEGVVTTSNGLIGGHLTVRLDSVLEAEEFPASVTDLDTGLTNVN
Ga0206690_1018217123300021355SeawaterVEELSVGSGSDFIDDGGFEIEEDGTGDVLSSTSLGEEGVEGVVTTTDSLIGGHLTVGLDSVLKAEELPASVTDLDTG
Ga0063115_100066013300021882MarineMSSGEVVGGILFTGDELLGVEELSVGTSSDLIDDGWLEIEEHTSWDVLSSTSLGEEGVEGIITTTDSLVGWHLSIRLDAVLEAEELPTGITNLDTSLTDVN
Ga0063104_100216513300021913MarineVEQLSVGSGTDFIDNGGFEIEEYGSGDVFAGTSLGEEGVEGVVTTTDGLIGGHLTVRLNSVLEAEELPACVTDLDTGLTDVDRNDFSHYD
Ga0063870_100858513300021921MarineVEQLSVGSGTDFIDNGGFEIEEDGSGDVFAGTSLGEEGVEGVVTTTDGLIGGHLTVRLNSVLEAEELPACVTDLDTGLTDVDRNDFSHYDDK
Ga0222715_1033659523300021960Estuarine WaterMEELSVGTSSNLIDNGWLKIEEDGSWDVFTSTSLGEEGVESIITTTDGFIGWHLTVWLDTVLEAEKLPAGVTNLDTGLTDVDRNDFSHCVCVFL
Ga0242667_100395213300022513SoilMEELSVGSSSDLINDGWFQVEENTSGNVFTSTSLREEGVEGIITTTDGLIGWHLTVRLDTVLETEEFPAGVTSLNTGLTNMNRQHFTHFSSKKVLKGFVLKNEQ
Ga0242669_104392713300022528SoilMEELSVGSSSDLINDSWFQVEENTSGNVFTSTSLREEGVEGIITTTDGLIGWHLTVWLDTVLEAEELPACVTNLDTGLTDVD
Ga0255777_1061041213300023175Salt MarshFTRDELLWMEELSVGSGSDLIDNGWLKIEEDGSWNVLTGTSLGEEGVESIITTTDRFIGWHLTVRLDSVLEAEKLPAGVTDLDTGLTDMDGNDFSHDG
Ga0228697_10792833300023674SeawaterMEELSVSSGSNFINNGWFKIKEDGSWDVLSGTSLREEGVESIITTTDRFVGWHLTIWLDSVLEAEKLPTGVTDLDTALTDVD
Ga0228704_11538713300023691FreshwaterVEELSVGTSSDFIDNGGFQIEEDGSGHVLAGTSLREEGVEGIITTTDGLVGGHLTIRLDSVLETEEFPAGVTDLDTTLTDVN
Ga0244777_1060258023300024343EstuarineMEELSVGTSSNLINDGWLKIEHDSSWDVLTGTSLGEEGVEGIVTTTDGFIRWHLTVWLNSVLKAEKLPAGVTNLDTGLSDVDGNDFSHCMKFEKFEKVK
Ga0244777_1093862913300024343EstuarineGGILLSGDELLWVEELAVGTSSDLIDDGGFQVKEDATGDVLASTSLGEEGVESIIATTDGLVRWHLTIWLNTVLEAEEFPAGVTNLDTGLTDVD
Ga0208643_117179523300025645AqueousEVVSGVFLSGDKLLGVEKLSVGSGSDLIDNGGFKIEEHASGDVLAGTSLGEEGVESIVATADSLIGGHLTVRLDSVLEAEEFPAGVTDLDTSLSDVDRNDFSHCDGEM
Ga0209771_111537813300025701MarineMEELSVGTSSNLINDGWLKIEHDSSWDVLTGTSLGEEGVEGIVTTTDGFIRWHLTVWLNSVLKAEKFPAGVTNLDTGLSDVDGNDFSHCMKFEKFEKVK
Ga0209602_122795013300025704Pelagic MarineNELLWMEKLSVGSGSNLIDDSWFEIKEDGSWDVLASTSLGEEGVESVITATDGLIGRHLTIWLNTVLEAEELPACVTDLDTSLTDVNGNDFSHCMMFE
Ga0209631_1048618823300025890Pelagic MarineIFFTGDELLWMEELSVGSGSDLIDNGWLEIEEDSSWDVLTSTSLGEEGVESVITTTDGFVGWHLTVWLDSVLEAEKLPAGVTNLDTGLTDVD
Ga0247593_108659113300026449SeawaterLSVGSGSDLIDNGWLEIEEDASWDVLSSTSLGEEGVEGIITTTDGLVRWHLSVWLDTVLEAEQFPTGVTDLDTGLTDVNGNR
Ga0209302_1008580813300027810MarineVEQLSIGTGSDFIDNGGFEIEEDGSGDVLTSTSLGEEGVEGVVTTTDSLIGGHLTVRLNSVLEAEKFPACVTDLDTGLTDVDRNDFSHCDVEIILGLKL
Ga0209092_1058323413300027833MarineVEQLSVGSGTDFIDNGGFEIEEDGSGDVFAGTSLGEEGVEGVVTTTDGLIGGHLTVRLNSVLEAEELPACVTDLDTGLTDVDRNDFSHYDDKMGLFKRL
Ga0228621_106270213300028124SeawaterGGIFFTGDELLWMEELSVGSGSDLIDNGWLEIEEDSSWDVLTSTGLGEEGVEGIVTTTDGFIGWHLTVRLDSVLEAEKLPAGVTNLDTGLTDVDGNDFSHDEVVGFCKK
Ga0304731_1136340813300028575MarineVEELSVGSGSDFIDDGGFEIEEDGTGDVLSSTSLGEEGVEGVVTTTDGLVRGHLTVRLDTVLEAEEFPAGVTDLDTGLSNVNRNDFSH
Ga0257128_106394813300028672MarineMEQLSVGSGSNLINDGWFEIEEDGSWDVFTSTSLGEEGVESIVTTTDRFIGWHLTVRLDSVLEAEEFPAGVTDLDTGLTDVNGNDFSHLKISVF
Ga0247626_126904313300030591SoilMEKLSVGTGSDLIDDSGFEIEENTSGDVLASSSLGEEGVESIITTTDGLVGGHLTVRLDSVLEAEEFPAGVSDLDTGLTDVD
Ga0308139_100886113300030720MarineVEQLSVGSGTDFIDNGGFEIEEDGSGDVFAGTSLGEEGVEGVVTTTDGLIGGHLTVRLNSVLEAEELPACVTDLDTGLTDVDRND
Ga0308133_100889113300030721MarineVEQLSVGSGTDFIDNGGFEIEEDGSGDVFAGTSLGEEGVEGVVTTTDGLIGGHLTVRLNSVLEAEELPACVTDLDTGLTDVDRNDFSHYDD
Ga0308137_105021823300030722MarineVEQLSVGSGTDFIDNGGFEIEEYGSGDVFAGTSLGEEGVEGVVTTTDGLIGGHLTVRLNSVLEAEELPACVTDLDTGLTDVDRNDF
Ga0308128_100558543300030725MarineVEQLSIGTGSDFIDNGGFEIEEDGSGDVLTSTSLGEEGVEGVVTTTDSLIGGHLTVRLNSVLEAEKFPACVTDLDTGLTDVDRNDFSHCDVE
Ga0308131_103093933300030729MarineMEELSVGSSSNFIDNGWLEIKEDSSWDVLTGTSLGEEGVESIITTTDGFVGWHLTIWLDSVLKAEELPA
Ga0138299_1025073413300030938SoilMTSGEVVGGIFLTGDELLRMEELSVGSGSDFVDNGGFEIEEDGSGNVLSGTSLGEEGVEGVVTTTDSLVGWHLSVGLDTVLKAEQLPTGVTDLDTSLTNVD
Ga0308181_106534213300031099SoilMEELSVGSSSDFIDDSGFQVKEDASGDVLSSTSLGEEGVECIITTTDCLIRWHLTVRLVTVLEAEELPASITDLDTGLSNMNRDNFTHVELKEESLKVNRRRVL
Ga0308149_101138413300031542MarineVEQLSIGTGSDFIDNGGFEIEEDGSGDVLTSTSLGEEGVEGVVTTTDSLIGGHLTVRLNSVLEAEKFPACVTDLDTGLTDVDRNDFSHCD
Ga0308148_100517733300031557MarineVEQLSVGSGTDFIDNGGFEIEEDGSGDVFAGTSLGEEGVEGVVTTTDGLIGGHLTVRLNSVLEAEELPACVTDLDTGLTDVDRNDFSHY
Ga0308147_100583433300031558MarineVEQLSVGSGTDFIDNGGFEIEEYGSGDVFAGTSLGEEGVEGVVTTTDGLIGGHLTVRLNSVLEAEELPACVTDLDTGLTDVDRNDFSHYDD
Ga0307489_1117605623300031569Sackhole BrineMEELSISTSSNLINDGWLEIEEDGSWYVLTSTSLGEECVESVVTTTDGFIRWHLTIWLNSVLEAEELPACVTNLDTGLTDVDGNNFSHD
Ga0308134_102106533300031579MarineVEQLSVGSGTDFIDNGGFEIEEDGSGDVFAGTSLGEEGVEGVVTTTDGLIGGHLTVRLNSVLEAEELPACVTDLDTGLTDVN
Ga0308132_101943613300031580MarineVEQLSIGTGSDFIDNGGFEIEEDGSGDVLTSTSLGEEGVEGVVTTTDSLIGGHLTVRLNSVLEAEKFPACVTDLDTGLTDVD
Ga0308132_101957433300031580MarineVEQLSVGSGTDFIDNGGFEIEEYGSGDVFAGTSLGEEGVEGVVTTTDGLIGGHLTVRLDSVLEAEEFPASVTDLDTGLTNVN
Ga0308125_101117213300031581MarineVEQLSIGTGSDFIDNGGFEIEEDGSGDVLTSTSLGEEGVEGVVTTTDSLIGGHLTVRLNSVLEAEKFPACVTDLDTGLTDVDRNDFSHCDV
Ga0307993_102876913300031602MarineLSGDQLFGVEELSVGSGSDLINNCGLQIEEHGTGDVLSSSSLAEEGVERVVSSSDGLVRGHLTVRLDTMLEAVQLPAGITDLDTSLTKMNRDTFTLKK
Ga0302121_1019059223300031626MarineVEQLSVGSGTDFIDNGGFEIEEDGSGDVFAGTSLGEEGVEGVVTTTDGLIGGHLTVRLNSVLEAEELPACVTDLDTGLTDVDRNDFSHYDDKIIV
Ga0308005_1020101213300031656MarineGCLTDDGGLQIDEDGSGHVLAGAGLAEEGVERIITTTDRLVTGHLAIGLDSVLKAVQLPAGVTDLDTGLSNVD
Ga0307381_1034461123300031725MarineMEELSVGSGSDFIDNGWLEIEEDGSWNVLTSTSLGEEGVESIITTTDGFVGWHLTIWLDSVLKAEELPTGVTDLD
Ga0315324_1033808913300032019SeawaterMEELSVGSSSNFIDNGWFEIEEDSSWDVLTGTSLGEEGVESIITTTDGFVGWHLTIWLNTVLEAEELPACVTDLDTGLSNMDRNNFSHCVCFVGFFKKVKSNYKNNLKNMLNSKIFE
Ga0314684_1066307923300032463SeawaterMEELSVGSGSDLIDNGWLKIEEDSSWDVLTSTSLGEEGVESVVTTTDRFIGWHLTVWLDSVLEAEKLPAGVTDLDTGLSTVNGDNVTHFC
Ga0314670_1025014013300032470SeawaterMEELSVGSGSDLIDNGWLKIEEDSSWDVLTSTSLGEEGVESVVTTTDRFIGWHLTVWLDSVLEAEKLPAGVTDLDTGLTDVDGNDFSHGGLK
Ga0314668_1020745023300032481SeawaterMEELSVGSSSDLIDNGWLKIEEDSSWDVLTSTSLGEEGVESVVTTTDGFIGWHLTIRLDTVLEAEKLPAGVTNLDTGLTDVDGNDFSHEVLK
Ga0314675_1043384013300032491SeawaterMEELSVGSGSDLIDNGWLKIEEDSSWDVLTSTSLGEEGVESVVTTTDRFIGWHLTVWLDSVLEAEKLPAGVTDLDTGLTDVDGNDFSHGGL
Ga0314671_1070625623300032616SeawaterMEELSVGSGSDLIDNGWLEIEEDSSWDVLTGTSLGEEGVESVITTTDGFVGWHLTVRLDSVLEAEKLPAGVTDLDTALTDVDRNDFSHNEKVWLCK
Ga0314683_1081510513300032617SeawaterMEELSVGSSSDLIDNGWLKIEEDSSWDVLTSTSLGEESVESVVTTTDRFIGWHLTVWLDSVLEAEKLPAGVTDLDTGLTDVDGNDFSHGGLKG
Ga0314683_1096667413300032617SeawaterMEELSVGSGSDLIDNGWLEIEEDSSWDVLTSTSLGEEGVEGIVTTTDGFIGWHLTVRLDSVLEAEKLPAGVTNLDTGLTDVDGNDFSHDEVVGF
Ga0314673_1063206213300032650SeawaterMEELSVGSSSDLIDNGWLKIEEDSSWDVLTSTSLGEESVESVVTTTDRFIGWHLTVWLDSVLEAEKLPAGVTDLDTGLTDVDGND
Ga0314681_1015332213300032711SeawaterMEELSVGSSSDLIDNGWLKIEEDSSWDVLTSTSLGEEGVESVITTTDGFIGWHLNVWLDSVLEAEELPDLVTDLATGLSEVDGDDFAESHID
Ga0314695_137834423300032724SeawaterMEELSVGSGSDLIDNGWLKIEEDSSWDVLTSTSLGEEGVESVVTTTDRFIGWHLTVWLDSVLEAEKLPAGVTDLDTGLTDVDGNDFSHGGLKGK
Ga0314698_1013603313300032726SeawaterMEELSVGSGSDLIDNGWLEIEEDSSWDVLTSSSFTEEGVESIITSTNSLVTWHLSIRLNTVLEAEELPACVTDLNTSLSD
Ga0314693_1009039043300032727SeawaterMEELSVGSGSDLIDNGWLKIEEDSSWDVLTSTSLGEEGVESVVTTTDRFIGWHLTVWLDSVLEAEKLPAGVTDLDTGLTDVDGNDFSHGGLKGKVK
Ga0314706_1049794513300032734SeawaterMEELSVGSSSDLIDNGWLKIEEDSSWDVLTSTSLGEESVESVVTTTDRFIGWHLTVWLDSVLEAEKLPAGVTDLDTGLTDVD
Ga0314704_1020887323300032745SeawaterLSVGSGSDLIDNGWLEIEEDSSWDVLTGTSLGEEGVESVVTTTDRFIGWHLTVWLDSVLEAEKLPAGVTDLDTGLTDVDGNDFSHGGLKLVFRSMIPMIPAI
Ga0314701_1015035423300032746SeawaterMRFWVEELSVCSSSDLINNSWLKINEDGSWHVLASSGLAEEGVERIITTSDGLVRGHLTIWLDTVLQAVQLPAGVTDLATGLSNVDRDTFSHDEFVSLDF
Ga0314713_1005004713300032748SeawaterMEELSVGSGSDLIDNGWLKIEEDSSWDVLTSTSLGEEGVESVVTTTDRFIGWHLTIWLDSVLEAEKLPAGVTDLDTGLTDVDGNDFSHGGLKGK
Ga0314692_1016242113300032754SeawaterMEELSVGSSSDLIDNGWLKIEEDSSWDVLTSTSLGEESVESVVTTTDRFIGWHLTVWLDSVLEAEKLPAGVTDLDTGLTDVDGNDFSHGGLKGKVK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.