| Basic Information | |
|---|---|
| Family ID | F073571 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGH |
| Number of Associated Samples | 43 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.67 % |
| % of genes near scaffold ends (potentially truncated) | 90.00 % |
| % of genes from short scaffolds (< 2000 bps) | 62.50 % |
| Associated GOLD sequencing projects | 41 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.167 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Sediment → Marine (17.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (25.833 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 34.88% Coil/Unstructured: 65.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF07228 | SpoIIE | 3.33 |
| PF02518 | HATPase_c | 2.50 |
| PF00342 | PGI | 1.67 |
| PF01243 | Putative_PNPOx | 1.67 |
| PF01734 | Patatin | 1.67 |
| PF00749 | tRNA-synt_1c | 1.67 |
| PF06750 | DiS_P_DiS | 1.67 |
| PF02572 | CobA_CobO_BtuR | 1.67 |
| PF09853 | DUF2080 | 1.67 |
| PF06974 | WS_DGAT_C | 1.67 |
| PF02423 | OCD_Mu_crystall | 1.67 |
| PF07702 | UTRA | 1.67 |
| PF00850 | Hist_deacetyl | 1.67 |
| PF00994 | MoCF_biosynth | 1.67 |
| PF12833 | HTH_18 | 0.83 |
| PF08264 | Anticodon_1 | 0.83 |
| PF07732 | Cu-oxidase_3 | 0.83 |
| PF13669 | Glyoxalase_4 | 0.83 |
| PF13511 | DUF4124 | 0.83 |
| PF13450 | NAD_binding_8 | 0.83 |
| PF13424 | TPR_12 | 0.83 |
| PF01022 | HTH_5 | 0.83 |
| PF07947 | YhhN | 0.83 |
| PF08735 | DUF1786 | 0.83 |
| PF12724 | Flavodoxin_5 | 0.83 |
| PF03992 | ABM | 0.83 |
| PF01963 | TraB_PrgY_gumN | 0.83 |
| PF01761 | DHQ_synthase | 0.83 |
| PF00440 | TetR_N | 0.83 |
| PF02737 | 3HCDH_N | 0.83 |
| PF00710 | Asparaginase | 0.83 |
| PF13414 | TPR_11 | 0.83 |
| PF13275 | S4_2 | 0.83 |
| PF01875 | Memo | 0.83 |
| PF05973 | Gp49 | 0.83 |
| PF02146 | SIR2 | 0.83 |
| PF00069 | Pkinase | 0.83 |
| PF05099 | TerB | 0.83 |
| PF01066 | CDP-OH_P_transf | 0.83 |
| PF00701 | DHDPS | 0.83 |
| PF03950 | tRNA-synt_1c_C | 0.83 |
| PF03692 | CxxCxxCC | 0.83 |
| PF13247 | Fer4_11 | 0.83 |
| PF02441 | Flavoprotein | 0.83 |
| PF04228 | Zn_peptidase | 0.83 |
| PF00534 | Glycos_transf_1 | 0.83 |
| PF00581 | Rhodanese | 0.83 |
| PF12832 | MFS_1_like | 0.83 |
| PF00970 | FAD_binding_6 | 0.83 |
| PF01891 | CbiM | 0.83 |
| PF00216 | Bac_DNA_binding | 0.83 |
| PF01266 | DAO | 0.83 |
| PF01553 | Acyltransferase | 0.83 |
| PF02310 | B12-binding | 0.83 |
| PF08359 | TetR_C_4 | 0.83 |
| PF03934 | T2SSK | 0.83 |
| PF01740 | STAS | 0.83 |
| PF14622 | Ribonucleas_3_3 | 0.83 |
| PF03054 | tRNA_Me_trans | 0.83 |
| PF02080 | TrkA_C | 0.83 |
| PF01636 | APH | 0.83 |
| PF07022 | Phage_CI_repr | 0.83 |
| PF01979 | Amidohydro_1 | 0.83 |
| PF13421 | Band_7_1 | 0.83 |
| PF01925 | TauE | 0.83 |
| PF01926 | MMR_HSR1 | 0.83 |
| PF09505 | Dimeth_Pyl | 0.83 |
| PF02769 | AIRS_C | 0.83 |
| PF01207 | Dus | 0.83 |
| PF00462 | Glutaredoxin | 0.83 |
| PF01255 | Prenyltransf | 0.83 |
| PF00210 | Ferritin | 0.83 |
| PF07973 | tRNA_SAD | 0.83 |
| PF02190 | LON_substr_bdg | 0.83 |
| PF14833 | NAD_binding_11 | 0.83 |
| PF02780 | Transketolase_C | 0.83 |
| PF00012 | HSP70 | 0.83 |
| PF08669 | GCV_T_C | 0.83 |
| PF02566 | OsmC | 0.83 |
| PF13549 | ATP-grasp_5 | 0.83 |
| PF04055 | Radical_SAM | 0.83 |
| PF13336 | AcetylCoA_hyd_C | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG1989 | Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase | Cell motility [N] | 5.00 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.33 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.33 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.50 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 1.67 |
| COG2109 | ATP:corrinoid adenosyltransferase | Coenzyme transport and metabolism [H] | 1.67 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 1.67 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 1.67 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.67 |
| COG0252 | L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D | Translation, ribosomal structure and biogenesis [J] | 1.67 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 1.67 |
| COG0166 | Glucose-6-phosphate isomerase | Carbohydrate transport and metabolism [G] | 1.67 |
| COG3793 | Tellurite resistance protein TerB | Inorganic ion transport and metabolism [P] | 0.83 |
| COG3714 | Uncharacterized membrane protein YhhN | Function unknown [S] | 0.83 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.83 |
| COG4012 | Uncharacterized protein, DUF1786 family, actin-like ATPase superfamily | General function prediction only [R] | 0.83 |
| COG3156 | Type II secretory pathway, component PulK | Intracellular trafficking, secretion, and vesicular transport [U] | 0.83 |
| COG2321 | Predicted metalloprotease | General function prediction only [R] | 0.83 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.83 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.83 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.83 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.83 |
| COG1916 | Pheromone shutdown protein TraB, contains GTxH motif (function unknown) | Function unknown [S] | 0.83 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.83 |
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.83 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 0.83 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.83 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.83 |
| COG0310 | ABC-type Co2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 0.83 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.83 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.83 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.83 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.83 |
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.83 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.83 |
| COG1355 | Predicted class III extradiol dioxygenase, MEMO1 family | General function prediction only [R] | 0.83 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.17 % |
| Unclassified | root | N/A | 20.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000242|TDF_OR_ARG05_123mDRAFT_1009013 | Not Available | 2640 | Open in IMG/M |
| 3300000242|TDF_OR_ARG05_123mDRAFT_1019309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1647 | Open in IMG/M |
| 3300000242|TDF_OR_ARG05_123mDRAFT_1027459 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300000242|TDF_OR_ARG05_123mDRAFT_1049341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 852 | Open in IMG/M |
| 3300000242|TDF_OR_ARG05_123mDRAFT_1071678 | Not Available | 672 | Open in IMG/M |
| 3300000242|TDF_OR_ARG05_123mDRAFT_1092604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 578 | Open in IMG/M |
| 3300001685|JGI24024J18818_10125712 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300001685|JGI24024J18818_10184175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300001685|JGI24024J18818_10204979 | Not Available | 554 | Open in IMG/M |
| 3300004097|Ga0055584_100016297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 7300 | Open in IMG/M |
| 3300004097|Ga0055584_101564630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 683 | Open in IMG/M |
| 3300005589|Ga0070729_10555834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 624 | Open in IMG/M |
| 3300006467|Ga0099972_10017816 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3166 | Open in IMG/M |
| 3300006467|Ga0099972_10105177 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300006467|Ga0099972_11097118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1653 | Open in IMG/M |
| 3300006467|Ga0099972_12014354 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300006467|Ga0099972_12338942 | Not Available | 722 | Open in IMG/M |
| 3300006467|Ga0099972_12849106 | Not Available | 1644 | Open in IMG/M |
| 3300006467|Ga0099972_12852744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Coxiellaceae → Coxiella → unclassified Coxiella (in: g-proteobacteria) → Coxiella sp. DG_40 | 1947 | Open in IMG/M |
| 3300006467|Ga0099972_12907091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2208 | Open in IMG/M |
| 3300006467|Ga0099972_12921877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1032 | Open in IMG/M |
| 3300006467|Ga0099972_13174753 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1971 | Open in IMG/M |
| 3300006467|Ga0099972_13463487 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1579 | Open in IMG/M |
| 3300007511|Ga0105000_1178787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1228 | Open in IMG/M |
| 3300009008|Ga0115649_1051797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfonema → Desulfonema limicola | 5499 | Open in IMG/M |
| 3300009008|Ga0115649_1432287 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300009035|Ga0102958_1112924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 857 | Open in IMG/M |
| 3300009128|Ga0118727_1032045 | All Organisms → cellular organisms → Bacteria | 6404 | Open in IMG/M |
| 3300009128|Ga0118727_1392444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 742 | Open in IMG/M |
| 3300009138|Ga0102959_1285932 | Not Available | 553 | Open in IMG/M |
| 3300009138|Ga0102959_1302612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300009374|Ga0118720_1017309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina | 5307 | Open in IMG/M |
| 3300010330|Ga0136651_10011539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis | 4847 | Open in IMG/M |
| 3300010330|Ga0136651_10050811 | All Organisms → cellular organisms → Bacteria | 2232 | Open in IMG/M |
| 3300010330|Ga0136651_10054646 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2145 | Open in IMG/M |
| 3300010330|Ga0136651_10092413 | Not Available | 1598 | Open in IMG/M |
| 3300010330|Ga0136651_10215462 | Not Available | 973 | Open in IMG/M |
| 3300010330|Ga0136651_10430061 | Not Available | 648 | Open in IMG/M |
| 3300010330|Ga0136651_10458260 | Not Available | 624 | Open in IMG/M |
| 3300010330|Ga0136651_10530838 | Not Available | 571 | Open in IMG/M |
| 3300010330|Ga0136651_10591084 | Not Available | 536 | Open in IMG/M |
| 3300010392|Ga0118731_100163913 | Not Available | 623 | Open in IMG/M |
| 3300010392|Ga0118731_103382792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6558 | Open in IMG/M |
| 3300010392|Ga0118731_103710708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1005 | Open in IMG/M |
| 3300010392|Ga0118731_104566165 | All Organisms → cellular organisms → Bacteria | 4000 | Open in IMG/M |
| 3300010392|Ga0118731_105247940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis | 4825 | Open in IMG/M |
| 3300010392|Ga0118731_112080119 | Not Available | 545 | Open in IMG/M |
| 3300010392|Ga0118731_112228566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 24674 | Open in IMG/M |
| 3300010392|Ga0118731_112372991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 4490 | Open in IMG/M |
| 3300010392|Ga0118731_112883733 | Not Available | 3339 | Open in IMG/M |
| 3300010392|Ga0118731_115208661 | Not Available | 502 | Open in IMG/M |
| 3300010430|Ga0118733_100011204 | All Organisms → cellular organisms → Bacteria | 22870 | Open in IMG/M |
| 3300010430|Ga0118733_100021160 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15143 | Open in IMG/M |
| 3300010430|Ga0118733_100046437 | All Organisms → cellular organisms → Bacteria | 9195 | Open in IMG/M |
| 3300010430|Ga0118733_100047260 | All Organisms → cellular organisms → Bacteria | 9093 | Open in IMG/M |
| 3300010430|Ga0118733_100054832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 8327 | Open in IMG/M |
| 3300010430|Ga0118733_100204671 | All Organisms → cellular organisms → Bacteria | 3915 | Open in IMG/M |
| 3300010430|Ga0118733_100360628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2878 | Open in IMG/M |
| 3300010430|Ga0118733_100378168 | All Organisms → cellular organisms → Bacteria | 2805 | Open in IMG/M |
| 3300010430|Ga0118733_100649724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2100 | Open in IMG/M |
| 3300013099|Ga0164315_10001995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 15530 | Open in IMG/M |
| 3300013099|Ga0164315_10017359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5679 | Open in IMG/M |
| 3300013099|Ga0164315_10027304 | All Organisms → cellular organisms → Bacteria | 4541 | Open in IMG/M |
| 3300013099|Ga0164315_10031148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4248 | Open in IMG/M |
| 3300013099|Ga0164315_10059604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3053 | Open in IMG/M |
| 3300013099|Ga0164315_10110625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2225 | Open in IMG/M |
| 3300013099|Ga0164315_11397354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300013101|Ga0164313_10005319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 11397 | Open in IMG/M |
| 3300013101|Ga0164313_10034520 | Not Available | 4281 | Open in IMG/M |
| 3300013101|Ga0164313_10054216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 3374 | Open in IMG/M |
| 3300013101|Ga0164313_10476089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1039 | Open in IMG/M |
| 3300013101|Ga0164313_10478765 | Not Available | 1036 | Open in IMG/M |
| 3300013101|Ga0164313_10743417 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300013119|Ga0171655_1004196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 18594 | Open in IMG/M |
| 3300014913|Ga0164310_10359834 | Not Available | 861 | Open in IMG/M |
| 3300014914|Ga0164311_10033310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3050 | Open in IMG/M |
| 3300014914|Ga0164311_10038506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2837 | Open in IMG/M |
| 3300014914|Ga0164311_10091839 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1814 | Open in IMG/M |
| 3300014914|Ga0164311_10208508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1157 | Open in IMG/M |
| 3300014914|Ga0164311_10368595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 835 | Open in IMG/M |
| 3300017990|Ga0180436_10258442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1264 | Open in IMG/M |
| 3300017992|Ga0180435_10412747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1121 | Open in IMG/M |
| 3300017992|Ga0180435_10627672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 903 | Open in IMG/M |
| 3300021337|Ga0210341_1546893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 511 | Open in IMG/M |
| 3300021346|Ga0210335_1638920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 822 | Open in IMG/M |
| 3300021496|Ga0190343_1020650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 926 | Open in IMG/M |
| 3300021496|Ga0190343_1022612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfamplus → Desulfamplus magnetovallimortis | 879 | Open in IMG/M |
| 3300021506|Ga0190358_1120892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300021514|Ga0190293_1000646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 12400 | Open in IMG/M |
| 3300021514|Ga0190293_1002564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6249 | Open in IMG/M |
| 3300021514|Ga0190293_1002922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5802 | Open in IMG/M |
| 3300021514|Ga0190293_1003546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5283 | Open in IMG/M |
| 3300021514|Ga0190293_1023418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium 4572_32.1 | 1953 | Open in IMG/M |
| 3300022391|Ga0210374_1070065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 673 | Open in IMG/M |
| (restricted) 3300022913|Ga0233404_10030928 | Not Available | 1215 | Open in IMG/M |
| (restricted) 3300022938|Ga0233409_10265258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 593 | Open in IMG/M |
| (restricted) 3300022938|Ga0233409_10362958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 511 | Open in IMG/M |
| (restricted) 3300023089|Ga0233408_10133057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 556 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10267619 | Not Available | 751 | Open in IMG/M |
| (restricted) 3300023276|Ga0233410_10088159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 955 | Open in IMG/M |
| 3300027834|Ga0209344_10090209 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1676 | Open in IMG/M |
| 3300027834|Ga0209344_10177516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1094 | Open in IMG/M |
| 3300027834|Ga0209344_10377370 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300027834|Ga0209344_10429555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300027852|Ga0209345_10543983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacterium | 659 | Open in IMG/M |
| 3300027852|Ga0209345_10807679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatibacillum | 502 | Open in IMG/M |
| 3300027858|Ga0209013_10018030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 5485 | Open in IMG/M |
| 3300027858|Ga0209013_10050706 | Not Available | 2911 | Open in IMG/M |
| 3300027858|Ga0209013_10059502 | All Organisms → cellular organisms → Bacteria | 2638 | Open in IMG/M |
| (restricted) 3300028045|Ga0233414_10608438 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta → unclassified Spirochaeta → Spirochaeta sp. | 518 | Open in IMG/M |
| 3300032136|Ga0316201_11623645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatitalea → unclassified Desulfatitalea → Desulfatitalea sp. | 534 | Open in IMG/M |
| 3300032258|Ga0316191_10447426 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300032260|Ga0316192_10214169 | Not Available | 1336 | Open in IMG/M |
| 3300032260|Ga0316192_10758713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 653 | Open in IMG/M |
| 3300032260|Ga0316192_10846617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 614 | Open in IMG/M |
| 3300032262|Ga0316194_10720466 | Not Available | 628 | Open in IMG/M |
| 3300032262|Ga0316194_10981035 | Not Available | 532 | Open in IMG/M |
| 3300032263|Ga0316195_10008670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5016 | Open in IMG/M |
| 3300032276|Ga0316188_10094333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1457 | Open in IMG/M |
| 3300033429|Ga0316193_10800735 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 17.50% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 15.83% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 10.00% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 8.33% |
| Marine Hydrothermal Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent | 7.50% |
| Hydrothermal Vent Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat | 6.67% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 5.83% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 5.83% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 5.00% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine | 5.00% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 3.33% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.50% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.50% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.67% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000242 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3m | Environmental | Open in IMG/M |
| 3300001685 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300007511 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
| 3300009008 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009035 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MG | Environmental | Open in IMG/M |
| 3300009128 | Combined Assembly of Gp0137084, Gp0137083 | Environmental | Open in IMG/M |
| 3300009138 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MG | Environmental | Open in IMG/M |
| 3300009374 | Combined Assembly of Gp0137041, Gp0137043 | Environmental | Open in IMG/M |
| 3300010330 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300013099 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cm | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300013119 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 314m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
| 3300014913 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay1, Core 4569-9, 0-3 cm | Environmental | Open in IMG/M |
| 3300014914 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay2, Core 4569-9, 9-12 cm | Environmental | Open in IMG/M |
| 3300017990 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaG | Environmental | Open in IMG/M |
| 3300017992 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_1 metaG | Environmental | Open in IMG/M |
| 3300021337 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.425 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021346 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.374 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021496 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-13-1-2_MG | Environmental | Open in IMG/M |
| 3300021506 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-18-1-2_MG | Environmental | Open in IMG/M |
| 3300021514 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-30-0-1_MG | Environmental | Open in IMG/M |
| 3300022391 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.765 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022913 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MG | Environmental | Open in IMG/M |
| 3300022938 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MG | Environmental | Open in IMG/M |
| 3300023089 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300027834 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Santa Barbara Oil Seep Sample 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027852 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 (SPAdes) | Environmental | Open in IMG/M |
| 3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
| 3300032260 | Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow | Environmental | Open in IMG/M |
| 3300032262 | Coastal sediment microbial communities from Maine, United States - Cross River sediment 1 | Environmental | Open in IMG/M |
| 3300032263 | Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1 | Environmental | Open in IMG/M |
| 3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TDF_OR_ARG05_123mDRAFT_10090133 | 3300000242 | Marine | MVFSRPAGVGRHDLTPQNSSLFLRVKSAARLGRTRQSLFLDGHXXG |
| TDF_OR_ARG05_123mDRAFT_10193092 | 3300000242 | Marine | MLNSAHPQMVFFRNIGVGRPDLTPQNSTLFLRVKSVVRLDLTQKSSFLNGH* |
| TDF_OR_ARG05_123mDRAFT_10274592 | 3300000242 | Marine | SDHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLT* |
| TDF_OR_ARG05_123mDRAFT_10493411 | 3300000242 | Marine | RDIGVGRHDLTPQNSTLLLRIKSVVRLDLTQKSSFLDGH* |
| TDF_OR_ARG05_123mDRAFT_10716781 | 3300000242 | Marine | MVFFRDIGVGRHDLTPQNSTLLLRVKSVIRLDLTQKSSFLDGH* |
| TDF_OR_ARG05_123mDRAFT_10926041 | 3300000242 | Marine | AHPQMVFFRDIGVGRHDLTPQNSSLLLRVKSVVRLDLTQKSSFLDGH* |
| JGI24024J18818_101257122 | 3300001685 | Marine | PQMVFFRDIGVGRHDLTPQNSTLLLRVKSIVRLDLT* |
| JGI24024J18818_101841752 | 3300001685 | Marine | MVFXRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGH* |
| JGI24024J18818_102049791 | 3300001685 | Marine | MLRGSLFCAHPQMVFFRDICVGRHDLTPQNSTLLLRVKSVVRLDLTKKSS |
| Ga0055584_1000162976 | 3300004097 | Pelagic Marine | RDIGVGRHDLTPQNSTLLLQVKSVARLDITQKSSFLDGH* |
| Ga0055584_1015646302 | 3300004097 | Pelagic Marine | QMVFFRDIGVGRHDLTPQNSSLLFRVKSVVRLDFTQKSSFLDGH* |
| Ga0070729_105558341 | 3300005589 | Marine Sediment | SAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDEH* |
| Ga0099972_100178161 | 3300006467 | Marine | SVHPQMVFIRDIGVGRQDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGH* |
| Ga0099972_101051771 | 3300006467 | Marine | MVFFRDIGVGRHDLTPQNSSLLLRVKSVVRLDLMQKSSFLDGH* |
| Ga0099972_110971181 | 3300006467 | Marine | QMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDEH* |
| Ga0099972_120143542 | 3300006467 | Marine | MVFFRDIGVGRHDLTPQNSSLLLRVKSVVRLDLMQKSS |
| Ga0099972_123389422 | 3300006467 | Marine | MVFFRDIGVGRHDLTPQNSSLLLRVKSVVRLDLTQKSSFLDG |
| Ga0099972_128491062 | 3300006467 | Marine | RDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGH* |
| Ga0099972_128527441 | 3300006467 | Marine | PQMVFFRDIGVGRHDLTPQNSTLLLRVKSVARLDLTQKSSFLDGH* |
| Ga0099972_129070911 | 3300006467 | Marine | QMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGH* |
| Ga0099972_129218772 | 3300006467 | Marine | FFRDIGVGRHDLTPQNSSLLLRVKSVVRLDLTQKSSFLDGH* |
| Ga0099972_131747533 | 3300006467 | Marine | LVSAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSAVRLDLTQKSSFLDGH* |
| Ga0099972_134634873 | 3300006467 | Marine | FRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGH* |
| Ga0105000_11787872 | 3300007511 | Marine | MVFFRDIGVGRHDLTPQNSTLFLRVKSDPLLDLTK |
| Ga0115649_10517971 | 3300009008 | Marine | MVFFRDIGVGRHDLTPQNSTLFLRVKSDVLLDLTQKSLFLDGH* |
| Ga0115649_14322871 | 3300009008 | Marine | MVFFRDIGVGRHDLNPQNSSLFLRVKSDTLLDLTKKSLFLDGHYLNEEIISSSAAL |
| Ga0102958_11129242 | 3300009035 | Soil | MLRGSLFCAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLGGH* |
| Ga0118727_10320455 | 3300009128 | Marine | MVFFRDIGVGRHDLTPQNSSLFLRVKSDTLLDLTKKSLFLDGHYLNEEIISSSAAL |
| Ga0118727_13924442 | 3300009128 | Marine | MRSILFSAHPEMIFSRPAGVGRHDLTPQNSTLFLRVKSDARLGRTRKFLFLDGHSFGSAAETACK |
| Ga0102959_12859321 | 3300009138 | Soil | AHPQMVFFRDIGVGRHDLTPQNSTLFLRVKSVVRLDLTEKSSFLDGH* |
| Ga0102959_13026122 | 3300009138 | Soil | FFGEVCLCMLRGSLFCAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVFRLDLTKKSSFLDGH* |
| Ga0118720_10173095 | 3300009374 | Marine | MTFLRDIGVGRHDLTPQNSTLFLRVKSAVRLDLTQKFLFLDGHQLKQLV* |
| Ga0136651_100115397 | 3300010330 | Marine Hydrothermal Vent | MVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKK |
| Ga0136651_100508111 | 3300010330 | Marine Hydrothermal Vent | MVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFL |
| Ga0136651_100546463 | 3300010330 | Marine Hydrothermal Vent | GVTSAQPQMVFFRDIGVGHHDLIPQNSTLLLRIKSVVRLDLTQKSSFLDGH* |
| Ga0136651_100924131 | 3300010330 | Marine Hydrothermal Vent | MVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKFSFLDGH* |
| Ga0136651_102154621 | 3300010330 | Marine Hydrothermal Vent | FFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGQ* |
| Ga0136651_104300611 | 3300010330 | Marine Hydrothermal Vent | MVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKS |
| Ga0136651_104582602 | 3300010330 | Marine Hydrothermal Vent | SSTSAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGH* |
| Ga0136651_105308382 | 3300010330 | Marine Hydrothermal Vent | FFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGH* |
| Ga0136651_105910841 | 3300010330 | Marine Hydrothermal Vent | MVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLNGH* |
| Ga0118731_1001639131 | 3300010392 | Marine | MDKTLTSAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSAVRLDLTQKS |
| Ga0118731_1033827924 | 3300010392 | Marine | MDTPFPLTSAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVARLDLTQKSSFLDGH* |
| Ga0118731_1037107081 | 3300010392 | Marine | MVFFRDIGVGRHDLTPQNSTLLLRVKSVARLDLTQKSSFL |
| Ga0118731_1045661656 | 3300010392 | Marine | RDIGVGRHDLTPQNSSLLLRVKSVVRLDLTQKSSFLDGH* |
| Ga0118731_1052479406 | 3300010392 | Marine | FRDIGVGRHDLTPQNSTLLLRVKSVARLDLTQKSSFLDGH* |
| Ga0118731_1120801191 | 3300010392 | Marine | FFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGH* |
| Ga0118731_1122285661 | 3300010392 | Marine | QMVFFRDIGVGRHDLTPQNSTLLLRVKSAVRLDLTQKSSFLDRH* |
| Ga0118731_1123729915 | 3300010392 | Marine | AHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKPSFLDGH* |
| Ga0118731_1128837332 | 3300010392 | Marine | QMVFFRDIGVGRHDLTPQNSTLLLRVKSAVRLDLTQKSSFLDGH* |
| Ga0118731_1152086611 | 3300010392 | Marine | PQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLT* |
| Ga0118733_1000112041 | 3300010430 | Marine Sediment | MVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLT* |
| Ga0118733_10002116010 | 3300010430 | Marine Sediment | MVFFRDIGVGRHDLTFQNSSLLLRVKSVVRLDLTQKSSFLDGH* |
| Ga0118733_1000464379 | 3300010430 | Marine Sediment | CPAVTLVSAHPQMVFFRDIGLGRQDLTPQNSTLLLRIKSAVRLDLTQKSSFLDGH* |
| Ga0118733_1000472601 | 3300010430 | Marine Sediment | MVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFL |
| Ga0118733_1000548321 | 3300010430 | Marine Sediment | DIGVGRHDLTPQNSSLLLRVKSVVRLDLTQKSSFLDGH* |
| Ga0118733_1002046711 | 3300010430 | Marine Sediment | VVFFRDIGVGRHDLTPQNSSLLLRVKSVVRLDLTQKSSFLD |
| Ga0118733_1003606283 | 3300010430 | Marine Sediment | VFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDEH* |
| Ga0118733_1003781684 | 3300010430 | Marine Sediment | MVFFRDIGVGRHDLTPQNSSLLLRVKSVVRLDLTQ |
| Ga0118733_1006497244 | 3300010430 | Marine Sediment | FRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKPSFLDGH* |
| Ga0164315_1000199512 | 3300013099 | Marine Sediment | FRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGHYL* |
| Ga0164315_100173591 | 3300013099 | Marine Sediment | MVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDIT* |
| Ga0164315_100273041 | 3300013099 | Marine Sediment | MVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKPSFLDGH* |
| Ga0164315_100311481 | 3300013099 | Marine Sediment | QMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLNGH* |
| Ga0164315_100596041 | 3300013099 | Marine Sediment | MLRSSLFCAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGH |
| Ga0164315_101106253 | 3300013099 | Marine Sediment | MVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKS |
| Ga0164315_113973541 | 3300013099 | Marine Sediment | VFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKTSFLDGHYLIA* |
| Ga0164313_100053194 | 3300013101 | Marine Sediment | MVFFRDIGVGHHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDRHYLA* |
| Ga0164313_100345204 | 3300013101 | Marine Sediment | FRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGH* |
| Ga0164313_100542161 | 3300013101 | Marine Sediment | MVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSF |
| Ga0164313_104760893 | 3300013101 | Marine Sediment | RDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGH* |
| Ga0164313_104787652 | 3300013101 | Marine Sediment | AHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLNGH* |
| Ga0164313_107434173 | 3300013101 | Marine Sediment | PQMVFFRDIGVGRHDLNPQNSTLFLRVKSGARLDLTQKSSFLDGH* |
| Ga0171655_10041961 | 3300013119 | Marine | MVFFRDIGVGRHDLTPQNRTLFLRVKSGLLLDLTKKSLFLE |
| Ga0164310_103598341 | 3300014913 | Marine Sediment | TSAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGH* |
| Ga0164311_100333101 | 3300014914 | Marine Sediment | RDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGHYL* |
| Ga0164311_100385063 | 3300014914 | Marine Sediment | MVFFRDIGVGHHDLIPQNSTLLLRIKSVVRLDLTQKSSFLDGH* |
| Ga0164311_100918391 | 3300014914 | Marine Sediment | DIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGH* |
| Ga0164311_102085081 | 3300014914 | Marine Sediment | PQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLELTKKSSFLEGH* |
| Ga0164311_103685953 | 3300014914 | Marine Sediment | FRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGQ* |
| Ga0180436_102584421 | 3300017990 | Hypersaline Lake Sediment | MVFLRDFGVGRHDLTPQNSPLFLRVKSVVRLELTQKS |
| Ga0180435_104127471 | 3300017992 | Hypersaline Lake Sediment | FRVGGVGCHDLNPRNSELFLRFKSGIRLAHTKKSSFLDGH |
| Ga0180435_106276721 | 3300017992 | Hypersaline Lake Sediment | MALLRDFGVGRHDLNPQNSPLFLRVKSAARLACSEPV |
| Ga0210341_15468931 | 3300021337 | Estuarine | MVFFRDIGVGRQDLTPQNSTLLLRVKSVVRLDLTQKPSFLGGHYLVNK |
| Ga0210335_16389202 | 3300021346 | Estuarine | MVFFRDIGVGRQDLTPQNSTLLLRVKSVVRLDLTQKSSFLGGHYLVN |
| Ga0190343_10206501 | 3300021496 | Hydrothermal Vent Microbial Mat | MVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQK |
| Ga0190343_10226121 | 3300021496 | Hydrothermal Vent Microbial Mat | MVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGH |
| Ga0190358_11208921 | 3300021506 | Hydrothermal Vent Microbial Mat | MVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLD |
| Ga0190293_100064612 | 3300021514 | Hydrothermal Vent Microbial Mat | HPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGH |
| Ga0190293_10025641 | 3300021514 | Hydrothermal Vent Microbial Mat | MVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGY |
| Ga0190293_10029222 | 3300021514 | Hydrothermal Vent Microbial Mat | MVFFRDIGVGHHDLTPQNSTLFLRVKSVVRLDLTQKSSFLDRHYLA |
| Ga0190293_10035463 | 3300021514 | Hydrothermal Vent Microbial Mat | MVFFRDIGVGHHDLIPQNSTLLLRIKSVVRLDLTQKSSFLDGH |
| Ga0190293_10234181 | 3300021514 | Hydrothermal Vent Microbial Mat | MVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSF |
| Ga0210374_10700651 | 3300022391 | Estuarine | MVFFRDIGVGRQDLTPQNSTLLLRVKSVVRLDLTQKSSFL |
| (restricted) Ga0233404_100309283 | 3300022913 | Seawater | NSAHPQIVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGH |
| (restricted) Ga0233409_102652581 | 3300022938 | Seawater | FFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGH |
| (restricted) Ga0233409_103629581 | 3300022938 | Seawater | DIGVGHHDLTPQNSTLLLRIKSVVRLDLSKKSSFLDGH |
| (restricted) Ga0233408_101330571 | 3300023089 | Seawater | QMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLT |
| (restricted) Ga0233412_102676191 | 3300023210 | Seawater | MVFFRDIGVGRHDLTPQNSSLLLRVKSVVRLDLTQK |
| (restricted) Ga0233410_100881591 | 3300023276 | Seawater | FFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGHYLTKRLTA |
| Ga0209344_100902091 | 3300027834 | Marine | VKMVVSAHPQMVFFRDIGVRRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGQ |
| Ga0209344_101775162 | 3300027834 | Marine | WLNSAHPQMVFFRDIGVGRQDLTPQNSTLLLRVKSVVRLDLT |
| Ga0209344_103773701 | 3300027834 | Marine | MVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQ |
| Ga0209344_104295551 | 3300027834 | Marine | MGSLDSAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFL |
| Ga0209345_105439831 | 3300027852 | Marine | MVFSRDIGVGRHDLTPQNSTLLLRVKSVARLDLTQKSSFLD |
| Ga0209345_108076791 | 3300027852 | Marine | VFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTEKSSFLDGHQLRFLVHDSAIDNG |
| Ga0209013_100180301 | 3300027858 | Marine | VFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGH |
| Ga0209013_100507061 | 3300027858 | Marine | MLRGSLFCAHPQMVFFRDICVGRHDLTPQNSTLLLRVKSVVRLDLT |
| Ga0209013_100595021 | 3300027858 | Marine | GSLFCAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKFVVRLDLTQKSSFLGGH |
| (restricted) Ga0233414_106084382 | 3300028045 | Seawater | MVFFRDIGVGRHDLTPQNSTLLLRVESVVRLDLTSKS |
| Ga0316201_116236452 | 3300032136 | Worm Burrow | MVFFRDIGVGRHDLTPQNSTLLLRVKSAVRLDLTQKSSF |
| Ga0316191_104474262 | 3300032258 | Worm Burrow | MLNSAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSAVRLDLTQKSSFLDGHYYGGNQ |
| Ga0316192_102141691 | 3300032260 | Worm Burrow | SAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSAVRLDLTQKSSFLDGHYYGGNQ |
| Ga0316192_107587132 | 3300032260 | Worm Burrow | SRPAGVGRHDLTPQNSALFLRVKSDARLVRTQKSLFLDGHELMKLDADS |
| Ga0316192_108466171 | 3300032260 | Worm Burrow | MVFFRDIGVGRQDLTPQNSTLLLRVKSVVRLDLTQKSS |
| Ga0316194_107204661 | 3300032262 | Sediment | MVFSRPAGVERHDLIPQNSTLFLRVKSTARLGRTQKSLFL |
| Ga0316194_109810352 | 3300032262 | Sediment | QAFPVEVLFSAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLT |
| Ga0316195_100086702 | 3300032263 | Sediment | MVFLLDSGVGCHDLTPQNSRLFLRVKSVTRLGLEQKSSFLDSFYLEV |
| Ga0316188_100943331 | 3300032276 | Worm Burrow | MVFLRDFCVGRHDLTPQNSLLFLRVKSDTRLELTQKSSFLDEHSIKPIHK |
| Ga0316193_108007351 | 3300033429 | Sediment | FFRDIGVGRHDLTPQNSSLLLRVKSVVRLDLTQKSSFLDGH |
| ⦗Top⦘ |