| Basic Information | |
|---|---|
| Family ID | F067652 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MNVGDPNGTVVVELLPRESDMPVVVMITEKVKAEGAKGHYYK |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 85.60 % |
| % of genes near scaffold ends (potentially truncated) | 22.40 % |
| % of genes from short scaffolds (< 2000 bps) | 85.60 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (63.200 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil (16.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (16.800 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (31.200 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.29% β-sheet: 0.00% Coil/Unstructured: 95.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 20.80 |
| PF08388 | GIIM | 17.60 |
| PF01925 | TauE | 0.80 |
| PF00072 | Response_reg | 0.80 |
| PF00696 | AA_kinase | 0.80 |
| PF05426 | Alginate_lyase | 0.80 |
| PF00361 | Proton_antipo_M | 0.80 |
| PF02954 | HTH_8 | 0.80 |
| PF01370 | Epimerase | 0.80 |
| PF01425 | Amidase | 0.80 |
| PF01741 | MscL | 0.80 |
| PF02518 | HATPase_c | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.80 |
| COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 63.20 % |
| All Organisms | root | All Organisms | 36.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090002|CNA_F6ESG4R02HBH5Q | Not Available | 507 | Open in IMG/M |
| 3300000126|BS_KBB_SWE26_205mDRAFT_c1073909 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae → Litoribacter → Litoribacter populi | 541 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10028929 | Not Available | 2310 | Open in IMG/M |
| 3300000230|TB_GS10_10DRAFT_10053731 | Not Available | 1820 | Open in IMG/M |
| 3300000230|TB_GS10_10DRAFT_10244088 | Not Available | 542 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_104129454 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Haliscomenobacteraceae → Haliscomenobacter → Haliscomenobacter hydrossis | 636 | Open in IMG/M |
| 3300001565|A35518A_1177504 | Not Available | 561 | Open in IMG/M |
| 3300002101|JGI24146J26653_1043305 | Not Available | 997 | Open in IMG/M |
| 3300002839|JGIcombinedJ43158_10021372 | Not Available | 2336 | Open in IMG/M |
| 3300002986|JGI24142J45722_1008326 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3330 | Open in IMG/M |
| 3300002986|JGI24142J45722_1075317 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 622 | Open in IMG/M |
| 3300003369|JGI24140J50213_10057800 | Not Available | 1359 | Open in IMG/M |
| 3300003369|JGI24140J50213_10108398 | Not Available | 914 | Open in IMG/M |
| 3300004282|Ga0066599_101437085 | Not Available | 527 | Open in IMG/M |
| 3300004774|Ga0007794_10271782 | Not Available | 502 | Open in IMG/M |
| 3300005077|Ga0071116_1058127 | Not Available | 2332 | Open in IMG/M |
| 3300005456|Ga0070678_100984567 | Not Available | 774 | Open in IMG/M |
| 3300005650|Ga0075038_11064497 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 610 | Open in IMG/M |
| 3300005831|Ga0074471_10083838 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 956 | Open in IMG/M |
| 3300005831|Ga0074471_10474463 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 580 | Open in IMG/M |
| 3300006642|Ga0075521_10680158 | Not Available | 508 | Open in IMG/M |
| 3300006950|Ga0075524_10108487 | Not Available | 1190 | Open in IMG/M |
| 3300007959|Ga0079306_1030545 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1720 | Open in IMG/M |
| 3300007959|Ga0079306_1035606 | Not Available | 1552 | Open in IMG/M |
| 3300009009|Ga0105105_10392097 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 772 | Open in IMG/M |
| 3300009009|Ga0105105_10815829 | Not Available | 565 | Open in IMG/M |
| 3300009037|Ga0105093_10250800 | Not Available | 927 | Open in IMG/M |
| 3300009039|Ga0105152_10037115 | Not Available | 1935 | Open in IMG/M |
| 3300009078|Ga0105106_11091834 | Not Available | 566 | Open in IMG/M |
| 3300009082|Ga0105099_10077984 | Not Available | 1789 | Open in IMG/M |
| 3300009500|Ga0116229_11349629 | Not Available | 566 | Open in IMG/M |
| 3300009502|Ga0114951_10077609 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → unclassified Balneolaceae → Balneolaceae bacterium | 1931 | Open in IMG/M |
| 3300009686|Ga0123338_10045132 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2651 | Open in IMG/M |
| 3300009695|Ga0123337_10011787 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 7526 | Open in IMG/M |
| 3300009695|Ga0123337_10044888 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3063 | Open in IMG/M |
| 3300009709|Ga0116227_11495901 | Not Available | 506 | Open in IMG/M |
| 3300009771|Ga0116155_10156544 | Not Available | 978 | Open in IMG/M |
| 3300009838|Ga0116153_10236940 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Haliscomenobacteraceae → Haliscomenobacter → Haliscomenobacter hydrossis | 749 | Open in IMG/M |
| 3300012411|Ga0153880_1106883 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Mariniphaga → unclassified Mariniphaga → Mariniphaga sp. | 1014 | Open in IMG/M |
| 3300013092|Ga0163199_1177303 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 845 | Open in IMG/M |
| 3300013092|Ga0163199_1178806 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 841 | Open in IMG/M |
| 3300013092|Ga0163199_1178807 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 841 | Open in IMG/M |
| 3300013092|Ga0163199_1293616 | Not Available | 616 | Open in IMG/M |
| 3300014054|Ga0120135_1021883 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae → Litoribacter → Litoribacter populi | 814 | Open in IMG/M |
| 3300014205|Ga0172380_10534904 | Not Available | 863 | Open in IMG/M |
| 3300014208|Ga0172379_10002082 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 36900 | Open in IMG/M |
| 3300014208|Ga0172379_10112263 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2078 | Open in IMG/M |
| 3300014208|Ga0172379_10214972 | All Organisms → cellular organisms → Bacteria → FCB group | 1340 | Open in IMG/M |
| 3300014208|Ga0172379_10478316 | Not Available | 791 | Open in IMG/M |
| 3300014490|Ga0182010_10457539 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 701 | Open in IMG/M |
| 3300014494|Ga0182017_10239964 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1148 | Open in IMG/M |
| 3300014494|Ga0182017_11005754 | Not Available | 500 | Open in IMG/M |
| 3300014496|Ga0182011_10869714 | Not Available | 562 | Open in IMG/M |
| 3300014498|Ga0182019_10625346 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 758 | Open in IMG/M |
| 3300014498|Ga0182019_10706080 | Not Available | 715 | Open in IMG/M |
| 3300014839|Ga0182027_11090514 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 811 | Open in IMG/M |
| 3300014839|Ga0182027_12110626 | Not Available | 537 | Open in IMG/M |
| 3300014968|Ga0157379_11166989 | Not Available | 740 | Open in IMG/M |
| 3300015200|Ga0173480_11005479 | Not Available | 549 | Open in IMG/M |
| 3300018429|Ga0190272_10129360 | Not Available | 1693 | Open in IMG/M |
| 3300018476|Ga0190274_10352242 | Not Available | 1401 | Open in IMG/M |
| 3300018476|Ga0190274_12483887 | Not Available | 615 | Open in IMG/M |
| 3300018481|Ga0190271_11510992 | Not Available | 788 | Open in IMG/M |
| 3300019767|Ga0190267_10427394 | Not Available | 751 | Open in IMG/M |
| 3300019785|Ga0182022_1209889 | Not Available | 869 | Open in IMG/M |
| 3300020012|Ga0193732_1041233 | Not Available | 794 | Open in IMG/M |
| 3300020048|Ga0207193_1026364 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales | 6942 | Open in IMG/M |
| 3300020814|Ga0214088_1029707 | Not Available | 1557 | Open in IMG/M |
| 3300020814|Ga0214088_1030341 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1669 | Open in IMG/M |
| 3300021181|Ga0210388_10789410 | Not Available | 823 | Open in IMG/M |
| 3300021520|Ga0194053_10037355 | Not Available | 2188 | Open in IMG/M |
| 3300022553|Ga0212124_10047137 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Draconibacterium → Draconibacterium sediminis | 2564 | Open in IMG/M |
| 3300022553|Ga0212124_10246548 | Not Available | 957 | Open in IMG/M |
| 3300022553|Ga0212124_10316799 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 826 | Open in IMG/M |
| 3300022553|Ga0212124_10470668 | Not Available | 656 | Open in IMG/M |
| 3300022555|Ga0212088_10153489 | Not Available | 1939 | Open in IMG/M |
| 3300022561|Ga0212090_10068214 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3627 | Open in IMG/M |
| (restricted) 3300023177|Ga0233423_10181151 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 900 | Open in IMG/M |
| 3300023274|Ga0247763_1078349 | Not Available | 919 | Open in IMG/M |
| (restricted) 3300024341|Ga0233421_10101568 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 990 | Open in IMG/M |
| 3300025153|Ga0209512_1029658 | All Organisms → cellular organisms → Bacteria | 3168 | Open in IMG/M |
| 3300025495|Ga0207932_1117295 | Not Available | 510 | Open in IMG/M |
| 3300025575|Ga0209430_1022776 | Not Available | 2218 | Open in IMG/M |
| 3300025600|Ga0209125_1048426 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Brocadia → unclassified Candidatus Brocadia → Candidatus Brocadia sp. | 1340 | Open in IMG/M |
| 3300025836|Ga0209748_1219106 | Not Available | 645 | Open in IMG/M |
| 3300025843|Ga0209182_10034685 | Not Available | 1484 | Open in IMG/M |
| 3300025846|Ga0209538_1039142 | Not Available | 2068 | Open in IMG/M |
| 3300025852|Ga0209124_10173536 | Not Available | 863 | Open in IMG/M |
| 3300025857|Ga0209014_10310899 | Not Available | 500 | Open in IMG/M |
| 3300025864|Ga0209429_10053387 | Not Available | 1875 | Open in IMG/M |
| 3300025864|Ga0209429_10152303 | Not Available | 972 | Open in IMG/M |
| 3300025888|Ga0209540_10121572 | Not Available | 1594 | Open in IMG/M |
| 3300025891|Ga0209585_10058928 | Not Available | 1423 | Open in IMG/M |
| 3300025891|Ga0209585_10380527 | Not Available | 574 | Open in IMG/M |
| 3300027713|Ga0209286_1139176 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 894 | Open in IMG/M |
| 3300027726|Ga0209285_10064870 | Not Available | 1092 | Open in IMG/M |
| 3300027762|Ga0209288_10324489 | Not Available | 514 | Open in IMG/M |
| 3300027902|Ga0209048_10432753 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Haliscomenobacteraceae → Haliscomenobacter → Haliscomenobacter hydrossis | 898 | Open in IMG/M |
| 3300028032|Ga0265296_1218736 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 654 | Open in IMG/M |
| (restricted) 3300028581|Ga0247840_10428527 | Not Available | 636 | Open in IMG/M |
| 3300028734|Ga0302206_1182154 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 519 | Open in IMG/M |
| 3300028738|Ga0302292_1112391 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 959 | Open in IMG/M |
| 3300028864|Ga0302215_10363679 | Not Available | 519 | Open in IMG/M |
| (restricted) 3300029268|Ga0247842_10087312 | Not Available | 1947 | Open in IMG/M |
| (restricted) 3300029286|Ga0247841_10531440 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 742 | Open in IMG/M |
| 3300029288|Ga0265297_10780623 | Not Available | 587 | Open in IMG/M |
| 3300029981|Ga0302293_10121919 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 839 | Open in IMG/M |
| 3300029995|Ga0302210_10159964 | Not Available | 631 | Open in IMG/M |
| 3300029998|Ga0302271_10309546 | Not Available | 689 | Open in IMG/M |
| 3300030019|Ga0311348_11456538 | Not Available | 509 | Open in IMG/M |
| 3300031231|Ga0170824_100725154 | Not Available | 520 | Open in IMG/M |
| 3300031834|Ga0315290_10098795 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2458 | Open in IMG/M |
| 3300031965|Ga0326597_11464979 | Not Available | 658 | Open in IMG/M |
| 3300031997|Ga0315278_12212980 | Not Available | 508 | Open in IMG/M |
| 3300032018|Ga0315272_10366648 | Not Available | 706 | Open in IMG/M |
| 3300032173|Ga0315268_10144336 | Not Available | 2259 | Open in IMG/M |
| 3300032177|Ga0315276_10245040 | Not Available | 1894 | Open in IMG/M |
| 3300032256|Ga0315271_10435330 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1103 | Open in IMG/M |
| 3300032516|Ga0315273_11543974 | Not Available | 814 | Open in IMG/M |
| 3300033233|Ga0334722_11229412 | Not Available | 524 | Open in IMG/M |
| 3300033413|Ga0316603_12021935 | Not Available | 545 | Open in IMG/M |
| 3300033419|Ga0316601_100225211 | Not Available | 1666 | Open in IMG/M |
| 3300034092|Ga0335010_0560526 | Not Available | 588 | Open in IMG/M |
| 3300034128|Ga0370490_0323607 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 513 | Open in IMG/M |
| 3300034158|Ga0370507_0050693 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1263 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 16.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.20% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 7.20% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 7.20% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.40% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 4.80% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 4.00% |
| Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 4.00% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 2.40% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 1.60% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.60% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.60% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.60% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.60% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 1.60% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 1.60% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 1.60% |
| Granular Sludge | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge | 1.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.80% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.80% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.80% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.80% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.80% |
| Sinkhole | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole | 0.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.80% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.80% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.80% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.80% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.80% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.80% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090002 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA | Host-Associated | Open in IMG/M |
| 3300000126 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 26_20.5m | Environmental | Open in IMG/M |
| 3300000228 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_66 | Environmental | Open in IMG/M |
| 3300000230 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- GS10_10 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001565 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-5cm-18A)- 1 week illumina new | Environmental | Open in IMG/M |
| 3300002101 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-31A | Environmental | Open in IMG/M |
| 3300002839 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-31A and 11-33A (Combined assembly, ASSEMBLY_DATE=20140611) | Environmental | Open in IMG/M |
| 3300002986 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-31A | Environmental | Open in IMG/M |
| 3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
| 3300005077 | Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_055 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005831 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300007959 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanotroph_Enrichment_5 | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300009686 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - groundupSSSS metaG | Environmental | Open in IMG/M |
| 3300009695 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - frozenSSSS metaG | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009771 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG | Engineered | Open in IMG/M |
| 3300009838 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG | Engineered | Open in IMG/M |
| 3300012411 | Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
| 3300014054 | Permafrost microbial communities from Nunavut, Canada - A34_5cm_12M | Environmental | Open in IMG/M |
| 3300014205 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG | Engineered | Open in IMG/M |
| 3300014208 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Groundwater well OW334 metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020814 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahit | Engineered | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021520 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-8m | Environmental | Open in IMG/M |
| 3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300022561 | Borup_combined assembly | Environmental | Open in IMG/M |
| 3300023177 (restricted) | Freshwater microbial communities from Lake Matano, South Sulawesi, Indonesia - Watercolumn_Matano_2014_112_MG | Environmental | Open in IMG/M |
| 3300023274 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L141-409B-4 | Environmental | Open in IMG/M |
| 3300024341 (restricted) | Freshwater microbial communities from Lake Matano, South Sulawesi, Indonesia - Watercolumn_Matano_2014_107_MG | Environmental | Open in IMG/M |
| 3300025153 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - frozenSSSS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025575 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-33A (SPAdes) | Environmental | Open in IMG/M |
| 3300025600 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-31A (SPAdes) | Environmental | Open in IMG/M |
| 3300025836 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025843 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes) | Environmental | Open in IMG/M |
| 3300025846 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025852 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes) | Environmental | Open in IMG/M |
| 3300025857 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025864 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027726 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300028032 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1 | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300028734 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_1 | Environmental | Open in IMG/M |
| 3300028738 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_1 | Environmental | Open in IMG/M |
| 3300028864 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_1 | Environmental | Open in IMG/M |
| 3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
| 3300029286 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m | Environmental | Open in IMG/M |
| 3300029288 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91 | Engineered | Open in IMG/M |
| 3300029981 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_2 | Environmental | Open in IMG/M |
| 3300029995 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_2 | Environmental | Open in IMG/M |
| 3300029998 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
| 3300034158 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| CNA_00726310 | 2088090002 | Quercus Rhizosphere | MNVGDPNRADGDHLLLRESDMPVVVKIPGKVKTGGAKGHYCKSNFS |
| BS_KBB_SWE26_205mDRAFT_10739092 | 3300000126 | Marine | RRLHMNVGGPNGTVQVRLLPRESEMPVVVKITGKVKTEGAKGHCYNKRFR* |
| TB_PC08_66DRAFT_100289292 | 3300000228 | Groundwater | MNVGDPNGTGQVHLLPRESDMLVVVMITGKVKPEGAKGS* |
| TB_GS10_10DRAFT_100537311 | 3300000230 | Groundwater | MNVGDPNGAVNVQLLPRESEMFVVVKITGKVKPEGAKGHY* |
| TB_GS10_10DRAFT_102440881 | 3300000230 | Groundwater | MNVGDPNGTVNVQLLPRESEMFVVVKITGKVKPEGAKGHCFKYVSELRT* |
| JGIcombinedJ13530_1041294541 | 3300001213 | Wetland | MNVGDPNGTVLDQLLPRESDMPVVVMITEKVKAEGVKGHYYK* |
| A35518A_11775041 | 3300001565 | Permafrost | MNVGDPNRTDIDHLLLRESDMPVVVKIPGKVKTGGAKGHYCKSNFSITNNSQN* |
| JGI24146J26653_10433052 | 3300002101 | Arctic Peat Soil | MNVGDPNGAGIVHLPPRESDMPVVVMIAEKVKAAGAK |
| JGIcombinedJ43158_100213723 | 3300002839 | Arctic Peat Soil | MNVGDPNGTGLGHLLPRESDMPVVVKITEKVKAVGAKGHYYKQSFKEC* |
| JGI24142J45722_10083262 | 3300002986 | Arctic Peat Soil | MNAGDPXKIGLVRLLSRESDMPIVVKITEKVKAVGAKGHYYKDVSKQGLAV* |
| JGI24142J45722_10753171 | 3300002986 | Arctic Peat Soil | MNVGDPNGMVQVKLLPRESDMLVVVMITEKVKAEGAKGHYYK* |
| JGI24140J50213_100578001 | 3300003369 | Arctic Peat Soil | MNVGDPNGAEKVQLLPRESEMLVVVKITEKVKAEGAKGHYYEQSFKEC* |
| JGI24140J50213_101083982 | 3300003369 | Arctic Peat Soil | MNVGDPNETGLVHLLSRESDMPIVVKITEKVKAVGAKGHYYKDVLKL* |
| Ga0066599_1014370852 | 3300004282 | Freshwater | MNVGDPNGTGKVQLLPRESDMLVVVMITGKLKPEGAKGRNYK* |
| Ga0007794_102717821 | 3300004774 | Freshwater | MNVGDPNRTVVQLLLRESDMLVIVLIIGKVKPEVAKGHYYKQVLKNVN* |
| Ga0071116_10581272 | 3300005077 | Sinkhole | MNVGDPNDVGPSNQQARESDMPVVVMTPGKVKAGIAKGHYCKGVSK* |
| Ga0070678_1009845671 | 3300005456 | Miscanthus Rhizosphere | MNVGDPNEIGVTTENEESDMLVVVKIAEYNKTAGAKGHYYKQIFQ* |
| Ga0075038_110644971 | 3300005650 | Permafrost Soil | MNVGSPNGTCEVSMLPRESDMPVVVLIPEKVKAGVAKGHYYK* |
| Ga0074471_100838382 | 3300005831 | Sediment (Intertidal) | MNVGDPNDAISPSQARESDMPVVMMIPEKVKAGGVKGHYYK* |
| Ga0074471_104744632 | 3300005831 | Sediment (Intertidal) | MNVGDPNRAAEEQLPLRESEMPVVVMITEKVKAEGAKGHYCSDVSKRG* |
| Ga0075521_106801581 | 3300006642 | Arctic Peat Soil | MNVGDPNGTVPVQLLPRESDMPVVVMITEKVKSEGAKGHYYK* |
| Ga0075524_101084872 | 3300006950 | Arctic Peat Soil | MNVGDPNGTGLVHLLPRESDMPVVVKITEKVKAVGAKGHYYKQSFKEC* |
| Ga0079306_10305452 | 3300007959 | Deep Subsurface | MNVGDPNMRGGVHLLIRESDMPVVVKIAEKVKAEGAKGHYYKRSFKAC* |
| Ga0079306_10356062 | 3300007959 | Deep Subsurface | MNVGDPNGTVVVELLPRESDMPVVVMITEKVKAEGAKGHYYK* |
| Ga0105105_103920972 | 3300009009 | Freshwater Sediment | MNVGDPNAAVSRSQARESDMPVVVRIPEKVKAGGAKGHCYK* |
| Ga0105105_108158292 | 3300009009 | Freshwater Sediment | MNVGGPNAAESRPQARESDMPVVVRIPEKVKAGGAKGHCYK |
| Ga0105093_102508002 | 3300009037 | Freshwater Sediment | GDPNAAVSRSQARESDMPVVVRIPEKVKAGGAKGHCYK* |
| Ga0105152_100371152 | 3300009039 | Lake Sediment | MNVGDPNGTGEVRQLPRESDMPVVVLITGKVKPEGAKGHYYK* |
| Ga0105106_110918341 | 3300009078 | Freshwater Sediment | MNVGGPNAAVSRLQARESDMPVVVRIPEKVKAGGAKGHCYK* |
| Ga0105099_100779842 | 3300009082 | Freshwater Sediment | MNVGGPNDAISPSQARESDMPVVVMIPEKVKAGGVKGHYYK* |
| Ga0116229_113496291 | 3300009500 | Host-Associated | MNVGGPNGAGGDNPQTRESDMPVVVQITEKVKAEVAKGH |
| Ga0114951_100776093 | 3300009502 | Freshwater | MNVGDPNGTGGVHLSLRESDMPVVVKITGKVKPEGAKGHYYKWSFKEC* |
| Ga0123338_100451323 | 3300009686 | Glacier Valley | MNVGDPNGTVVVELLPRESDMPVVVIITEKVKAEGAKGHYYK* |
| Ga0123337_100117876 | 3300009695 | Glacier Valley | PNGTVVVELLPRESDMPAVVMITEKVKTEVAKGHYCK* |
| Ga0123337_100448884 | 3300009695 | Glacier Valley | MNVGDPNGTAVVELLPRESDMPVVVIITEKVKAEGAKGHYYK* |
| Ga0116227_114959012 | 3300009709 | Host-Associated | MNVGGPNGAGGDNPQTRESDMPVVVQITEKVKAEVAKGHYCKQTF* |
| Ga0116155_101565441 | 3300009771 | Anaerobic Digestor Sludge | MNVGDPNGTGKVPLLPRESDMLVVVMITGKVKPEGAKGS* |
| Ga0116153_102369402 | 3300009838 | Anaerobic Digestor Sludge | MNVGGPNAVVSRPQARESDMPVLVRTPEKVKSGGAKGHYYK* |
| Ga0153880_11068832 | 3300012411 | Freshwater Sediment | MNVGDPNGTVLVQLLPRESDMPVVVMMTEKVKAVGAKGHYCKDVSNHGLAI* |
| Ga0163199_11773031 | 3300013092 | Freshwater | MNVGDPNMTGGVHLMMRESDMPVVVKIAEKVKAEGAKGHCYK* |
| Ga0163199_11788061 | 3300013092 | Freshwater | NVGDPNMTGSVHLLMRESDMPVVVMIAEKVKAEGAKGHYYKGSFKEC* |
| Ga0163199_11788071 | 3300013092 | Freshwater | NVGDPNMTGSVHLLMRESDMPVVVMIAEKVKAEGAKGHYYKRSFKEC* |
| Ga0163199_12936161 | 3300013092 | Freshwater | MNVGDPNMTGDVHLLMRESDMPVVVKIAEKVKAAGAKGHYYKRSFKEC* |
| Ga0120135_10218832 | 3300014054 | Permafrost | MNVGDPNRADIDHLLLRESDMPVVVKIPGKVKTGGAKGHYCKSNFSITNNSQN* |
| Ga0172380_105349042 | 3300014205 | Landfill Leachate | MNVGDPNMTGDVHLLMRESDMPVVVKIAEKVKAAGAKGHYYKDVSKQGLAV* |
| Ga0172379_1000208224 | 3300014208 | Groundwater | MNVGDPNMTGGVHLLMRESDMPVVVKITEKVKAEGAKGHYYKQSFKEC* |
| Ga0172379_101122631 | 3300014208 | Groundwater | NVGDPNMTGDVHLLMRESDMPVVVKIAEKVKAAGAKGHYYKRSFKAC* |
| Ga0172379_102149722 | 3300014208 | Groundwater | MNVGDPNMTGDVHLLMRESDMPVVVKIAEKVKAAGAKGHYYK |
| Ga0172379_104783161 | 3300014208 | Groundwater | NVGDPNMTGDVHLLMRESDMPVVVKIAEKVKAAGAKGHYYKDVSKQGLAV* |
| Ga0182010_104575392 | 3300014490 | Fen | MNVGDPNGTVVQLLPRESDMPIVVKITGKVKPEGAKGALL* |
| Ga0182017_102399642 | 3300014494 | Fen | MNVGDPNGADKVQLLPRESDMPVVVKIPEKVKAGGAKGHYCKGVLKKFNKQN* |
| Ga0182017_110057541 | 3300014494 | Fen | MNVGDPNEDGKSDRQSRESDMPVVVKITGKVKPEGAKGHCYRE |
| Ga0182011_108697143 | 3300014496 | Fen | MNVGDPNGADKVQLLPRESDMPVVVKIPEKVKAGGAKGHYCKESFKGV* |
| Ga0182019_106253462 | 3300014498 | Fen | MNVGDPNRTEVQLLLRESDMLVLVKITGKVKPEGAKGHYYK* |
| Ga0182019_107060801 | 3300014498 | Fen | MNVGDPNGADKVQLLPRESDMPVVVKIPEKVKAGGAKGHYCKGVLKK |
| Ga0182027_110905142 | 3300014839 | Fen | MNVGDPNRTEVQLLLRESDMLVSVKITGKVKPEGAKGHYYK* |
| Ga0182027_121106261 | 3300014839 | Fen | MNVGDPNGTGKVQLLLRESDMLVVVKIPEKVKAGGAKGHYCKGVLKKF |
| Ga0157379_111669892 | 3300014968 | Switchgrass Rhizosphere | MNVGDPNRTERDHLLLRESDMLVVVKIPGKVKTGGAKGHYCKSNFSITNNSQN* |
| Ga0173480_110054792 | 3300015200 | Soil | MNVGDPNRAEVDHLLLRESDMPIVVKIPGKVKTGGAKGHYCKSNFSITNNSQN* |
| Ga0190272_101293601 | 3300018429 | Soil | MNAGDPNKADQAHLLLRESDMPVVVKIPGKVKTGGAKGHYCKSNFSLTNNSQN |
| Ga0190274_103522422 | 3300018476 | Soil | MNVGDPTRADTDHLLLRESDMPVVVMIPGKVKTGGAKGHYCKSNFSITNNSQN |
| Ga0190274_124838872 | 3300018476 | Soil | MNVGDPSRADIDHLLLRKSDMLVVVQIPGKVKTGVAKGHYCKSNFS |
| Ga0190271_115109921 | 3300018481 | Soil | MNGGDPNGIDKDHLSLRESDMPVVVKIPGKVKTGGAKGHYCKSNFSLTNNSQN |
| Ga0190267_104273941 | 3300019767 | Soil | MNVGDPNSRRIPVWLWESDMPVVVMIAEKVKAAGAKGHYCK |
| Ga0182022_12098891 | 3300019785 | Fen | MNVGYPNGTVVVELLPRESDMLVVVMITGKVKTEVAKGHYCK |
| Ga0193732_10412332 | 3300020012 | Soil | TLTGQTDQLLLRESDMPILAKIPGKVKAGGAKGHYCKSNFSITNNSQN |
| Ga0207193_10263642 | 3300020048 | Freshwater Lake Sediment | MNVGDPNGTVDVQLLPRESEMFVVVKITGKVKPEGAKGHCFKYVSELRT |
| Ga0214088_10297072 | 3300020814 | Granular Sludge | MNVGGPNAVVSRPQARESDMPVLVRTPEKVKSGGAKGHYYK |
| Ga0214088_10303412 | 3300020814 | Granular Sludge | MNEGGPNAAVSRAQARESDMPVVVMIPEKVKAGGAKGHCYK |
| Ga0210388_107894102 | 3300021181 | Soil | MNVGDPTEHGMQTRESDMPVVVKKPEKVKAGGVKGHYCKQTFNNNQQQN |
| Ga0194053_100373552 | 3300021520 | Anoxic Zone Freshwater | MNVGDPNRTVVQLLLRESDMLVIVLIIGKVKPEVAKGHYYKQVLKNVN |
| Ga0212124_100471373 | 3300022553 | Freshwater | MNVGDPNMTGSVHLLMRESDMPVVVMIAEKVKAEGAKGHYYK |
| Ga0212124_102465481 | 3300022553 | Freshwater | MNVGDPNMTGSVHLLMRESDMPVVVMIAEKVKAEGAKGHYYKRSFKEC |
| Ga0212124_103167991 | 3300022553 | Freshwater | MNVGDPNMTGSVHLLMRESDMPVVVMIAEKVKAEGAKGHYYKGSFKEC |
| Ga0212124_104706681 | 3300022553 | Freshwater | MNVGDPNMTGGVHLMMRESDMPVVVKIAEKVKAEGAKGHCYK |
| Ga0212088_101534891 | 3300022555 | Freshwater Lake Hypolimnion | MNVGDPNGTVVVELLPRESDMPVVVMITEKVKAEGAKGHYYK |
| Ga0212090_100682142 | 3300022561 | Glacier Valley | MNVGDPNGTVVVELLPRESDMPVVVIITEKVKAEGAKGHYYK |
| (restricted) Ga0233423_101811511 | 3300023177 | Freshwater | MNVGDPNGTDKVQLLPRESDMLVVVKITGKVKPEGAKGHNYK |
| Ga0247763_10783491 | 3300023274 | Plant Litter | MNVGDPNRAEVDHLLLRESDMPIVVKIPGKVKTGGAKGHYCKSNFS |
| (restricted) Ga0233421_101015681 | 3300024341 | Freshwater | MNVGDPNEGGKSNRQARESDMPVVVKIIGKVKPEGAKGHYYR |
| Ga0209512_10296581 | 3300025153 | Glacier Valley | PNGTVVVELLPRESDMPAVVMITEKVKTEVAKGHYCK |
| Ga0207932_11172952 | 3300025495 | Arctic Peat Soil | MNVGDPNGTVLVQLLPRESDMPVVVLITEKVKAVGAKGHYYKDVSKQGLAV |
| Ga0209430_10227764 | 3300025575 | Arctic Peat Soil | MNVGDPNGTGLGHLLPRESDMPVVVKITEKVKAVGAKGHYYKQSFKEC |
| Ga0209125_10484262 | 3300025600 | Arctic Peat Soil | MNVGDPNGAGIVHLPPRESDMPVVVMIAEKVKAAGAKGHYCK |
| Ga0209748_12191061 | 3300025836 | Arctic Peat Soil | MNVGDPNGMVKVEPLPRESDMPVVVLITEKVKAVGAKGHYYKDVSKQGLAV |
| Ga0209182_100346851 | 3300025843 | Lake Sediment | GDPNGTGEVRQLPRESDMPVVVLITGKVKPEGAKGHYYK |
| Ga0209538_10391421 | 3300025846 | Arctic Peat Soil | MNVGDPNGMVKVEPLPRESDMPVVVMIAEKVKAEGAKGHCYKRSFKEC |
| Ga0209124_101735362 | 3300025852 | Arctic Peat Soil | MNVGDPNGTVLVQLLPRESDMPVVVLITEKVKAVGAKGHYYKDVSKQGLAL |
| Ga0209014_103108991 | 3300025857 | Arctic Peat Soil | MNVGDPNGTGLVHLLPRESDMPVVVKITEKVKAVGAKGHYYKQSFKEC |
| Ga0209429_100533872 | 3300025864 | Arctic Peat Soil | MNVGDPNGMVKVEPLPRESDMPVVVMIAEKVKAEGAKGHCYK |
| Ga0209429_101523031 | 3300025864 | Arctic Peat Soil | MNVGDPNGTVPVQLLPRESDMPVVVMITGKVKTEVAKGHYYKDVSKQGLAV |
| Ga0209540_101215722 | 3300025888 | Arctic Peat Soil | MNVGDPNMTGRVHLLMRESDMPVVVKIAEKVKAEGAKGHYYKQSFKEC |
| Ga0209585_100589282 | 3300025891 | Arctic Peat Soil | MNVGDPNMTGDVHLLMRESDMPVVVKIAEKVKAAGAKGHYYKRSFKEC |
| Ga0209585_103805272 | 3300025891 | Arctic Peat Soil | MNVGDPNGTVLVQLLPRESDMPVVVKITEKVKAVGAKGHYYKDVSKQGLAV |
| Ga0209286_11391762 | 3300027713 | Freshwater Sediment | MNVGGPNAAVSRLQARESDMPVVVRIPEKVKAGGAKGHCYK |
| Ga0209285_100648701 | 3300027726 | Freshwater Sediment | GDPNAAVSRSQARESDMPVVVRIPEKVKAGGAKGHCYK |
| Ga0209288_103244891 | 3300027762 | Freshwater Sediment | MNVGDPNGTGTVHLLPRESDMPVVVWIPGKVKPGGAKGHYYKQGFSRC |
| Ga0209048_104327532 | 3300027902 | Freshwater Lake Sediment | MNVGDPNDAVCPPQARESDMPVVVKIAGKVKPEGAKGHYYKQSF |
| Ga0265296_12187361 | 3300028032 | Groundwater | MNVGDPNMTGDVHLLMRESDMPVVVKITEKVKAEGAKGHYYKRSFKEC |
| (restricted) Ga0247840_104285271 | 3300028581 | Freshwater | MNVGDPNGTGEVRQLPRESDMPVVVKITGKVKPEGAKGHYYK |
| Ga0302206_11821542 | 3300028734 | Fen | MNVGDPNGTVVVELLPRESDMPVIVMITEKVKAEGAKGHYYK |
| Ga0302292_11123911 | 3300028738 | Fen | MNVGDPNGTVVVELLLRESDMPVVVMITEKVKAEGAKGHYYK |
| Ga0302215_103636792 | 3300028864 | Fen | MNVGDPNGAEKVHLLSRESEMLVVVKISEKVKAEGAKGHHYEQSFKEC |
| (restricted) Ga0247842_100873121 | 3300029268 | Freshwater | MNVGGPNGTVLVQLLPRESDMPVVVMITGKVKTVVAKGSLL |
| (restricted) Ga0247841_105314401 | 3300029286 | Freshwater | MNVGDPNGTVNVQLLPRESEMFVVVKITGKVKPEGAKGHCFKYVSELRT |
| Ga0265297_107806231 | 3300029288 | Landfill Leachate | MNVGDPNMTGDVHLLMRESDMPVVVKIAEKVKAAGAKGHYYKDVSKQGLAV |
| Ga0302293_101219192 | 3300029981 | Fen | MNVGDPNGAEKVHLLPRESEMLVVVKISEKVKAEGAKGHYYEQSFKEC |
| Ga0302210_101599641 | 3300029995 | Fen | MNVGDPNGTVAVELLPRESDMPVVVMIAEKVKAEGAKGHYY |
| Ga0302271_103095461 | 3300029998 | Bog | MNVGDPNGAEKVHLLPRESEMLVVVKISEKVKAEGAKG |
| Ga0311348_114565382 | 3300030019 | Fen | MNVGDPNGAEKVHLLPRESEMLVVVKISEKVKAEGA |
| Ga0170824_1007251541 | 3300031231 | Forest Soil | MNVGDPNRADGDHLLLRESDMPIVVKIPGKVKTGGAKGHYCKSNFSITNNSQN |
| Ga0315290_100987951 | 3300031834 | Sediment | MNVGDPNDATSPPQARESDMPVVVRIPEKVKAGGAKGHCYKKSFTEYRPD |
| Ga0326597_114649791 | 3300031965 | Soil | MNVGDPNGCCLAGSMPRESDMPIVVKKPGKVKTGGAKGHYYKNVSERREGWQQ |
| Ga0315278_122129801 | 3300031997 | Sediment | MNVGGPNGTVLVQSLPRESDMPVVVMITEKVKAEGAKGHYYKYVSKQGLTV |
| Ga0315272_103666482 | 3300032018 | Sediment | MNVGDPNRAGEVRLLLRESDMPVVVKTSEKVKAERAKGHYYK |
| Ga0315268_101443363 | 3300032173 | Sediment | MNVGDPNGTVLVQLLPRESDMPVVVTIAGKVKAEVAKGHYYK |
| Ga0315276_102450401 | 3300032177 | Sediment | MNVGDPNGTETVQLLPRESDMPVVVKIPEKVKAGGAKGHYYKRSFKEC |
| Ga0315271_104353302 | 3300032256 | Sediment | MNVGDPNMTGSVHLLMRESDMPVVVMIAEKVKAAGAKGHYYKRGFKEC |
| Ga0315273_115439742 | 3300032516 | Sediment | MNVGDPNGTVLVQSLPRESDMPVVVMITEKVKAEGAKGHYYKYVSKQGLTV |
| Ga0334722_112294121 | 3300033233 | Sediment | MNVGDPNRAGEVRLLLRESDMPVVVKTSEKVKAERAKG |
| Ga0316603_120219351 | 3300033413 | Soil | MNVGGPNDAASRPQARESDMPVVVKIPEKVKAGGAKGHCYK |
| Ga0316601_1002252112 | 3300033419 | Soil | MNVGGPNDAASRPQARESDMPVVVRIPEKVKAGGAKGHYYK |
| Ga0335010_0560526_1_105 | 3300034092 | Freshwater | MNVGDPNGAVNVQLLPRESEMFVVVKITGKVKPEG |
| Ga0370490_0323607_24_170 | 3300034128 | Untreated Peat Soil | MNVGDPNGTVVVELLPRESDMPVVVMITEKVKAEVTKGHYYKQSFKEC |
| Ga0370507_0050693_383_511 | 3300034158 | Untreated Peat Soil | MNVGDPNGTVVVELLPRESDMPVVVMITEKVKAEVTKGHYYK |
| ⦗Top⦘ |