| Basic Information | |
|---|---|
| Family ID | F064047 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MTLKKSSRAGLLALAFGILLGLFLSVATYDASYAQAQAPAA |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 87.60 % |
| % of genes from short scaffolds (< 2000 bps) | 79.07 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.915 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil (8.527 % of family members) |
| Environment Ontology (ENVO) | Unclassified (16.279 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.713 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 44.93% β-sheet: 0.00% Coil/Unstructured: 55.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF00543 | P-II | 82.95 |
| PF00909 | Ammonium_transp | 12.40 |
| PF01494 | FAD_binding_3 | 1.55 |
| PF13622 | 4HBT_3 | 0.78 |
| PF04073 | tRNA_edit | 0.78 |
| PF13410 | GST_C_2 | 0.78 |
| PF03969 | AFG1_ATPase | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG0347 | Nitrogen regulatory protein PII | Signal transduction mechanisms [T] | 82.95 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 12.40 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 3.10 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.55 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.55 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.55 |
| COG1485 | Cell division protein ZapE (Z ring-associated ATPase), AFG1 superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.91 % |
| All Organisms | root | All Organisms | 41.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908029|A2_v1_NODE_19396_len_3897_cov_12_346420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3947 | Open in IMG/M |
| 2124908036|A5_v_NODE_2361_len_924_cov_14_082252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 974 | Open in IMG/M |
| 2124908037|B3_GZBA_v_NODE_14236_len_858_cov_12_911422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 908 | Open in IMG/M |
| 2124908039|B3_v_NODE_456_len_1964_cov_39_250000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 2014 | Open in IMG/M |
| 2124908043|A2_c1_ConsensusfromContig64760 | Not Available | 776 | Open in IMG/M |
| 3300000156|NODE_c0685464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella silvestris | 3221 | Open in IMG/M |
| 3300000313|WSSedB1CaDRAFT_10080723 | Not Available | 614 | Open in IMG/M |
| 3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1025586 | Not Available | 645 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10052856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1052 | Open in IMG/M |
| 3300000701|JGI12340J11893_101646 | Not Available | 687 | Open in IMG/M |
| 3300000729|JGI12371J11900_1013890 | Not Available | 538 | Open in IMG/M |
| 3300000905|JGI12406J12870_105721 | Not Available | 525 | Open in IMG/M |
| 3300000909|JGI12488J12863_103829 | Not Available | 804 | Open in IMG/M |
| 3300000935|JGI12407J12866_104688 | Not Available | 689 | Open in IMG/M |
| 3300000953|JGI11615J12901_10018931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 514 | Open in IMG/M |
| 3300000956|JGI10216J12902_113356538 | Not Available | 616 | Open in IMG/M |
| 3300001398|JGI20207J14881_1007851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3122 | Open in IMG/M |
| 3300001406|JGI20187J14854_1005918 | Not Available | 671 | Open in IMG/M |
| 3300001593|JGI12635J15846_10315708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 971 | Open in IMG/M |
| 3300001870|JGI24129J20441_1016888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2077 | Open in IMG/M |
| 3300001915|JGI24741J21665_1034368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 754 | Open in IMG/M |
| 3300001978|JGI24747J21853_1003949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1305 | Open in IMG/M |
| 3300002073|JGI24745J21846_1017253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 839 | Open in IMG/M |
| 3300002183|JGI24145J26757_10075375 | Not Available | 757 | Open in IMG/M |
| 3300003990|Ga0055455_10037996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1276 | Open in IMG/M |
| 3300004798|Ga0058859_11434999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300005164|Ga0066815_10022665 | Not Available | 889 | Open in IMG/M |
| 3300005169|Ga0066810_10016042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1187 | Open in IMG/M |
| 3300005205|Ga0068999_10112277 | Not Available | 552 | Open in IMG/M |
| 3300005288|Ga0065714_10284149 | Not Available | 718 | Open in IMG/M |
| 3300005337|Ga0070682_101874618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300005439|Ga0070711_100968526 | Not Available | 729 | Open in IMG/M |
| 3300005548|Ga0070665_101020193 | Not Available | 839 | Open in IMG/M |
| 3300005836|Ga0074470_11297541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9876 | Open in IMG/M |
| 3300005880|Ga0075298_1039324 | Not Available | 503 | Open in IMG/M |
| 3300005947|Ga0066794_10137254 | Not Available | 735 | Open in IMG/M |
| 3300006057|Ga0075026_100475142 | Not Available | 716 | Open in IMG/M |
| 3300006102|Ga0075015_100907504 | Not Available | 535 | Open in IMG/M |
| 3300006172|Ga0075018_10400820 | Not Available | 698 | Open in IMG/M |
| 3300006173|Ga0070716_101826764 | Not Available | 504 | Open in IMG/M |
| 3300006175|Ga0070712_100128709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1916 | Open in IMG/M |
| 3300006426|Ga0075037_1884876 | Not Available | 569 | Open in IMG/M |
| 3300006806|Ga0079220_11761684 | Not Available | 544 | Open in IMG/M |
| 3300006972|Ga0075518_1053545 | Not Available | 807 | Open in IMG/M |
| 3300009551|Ga0105238_10068044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3562 | Open in IMG/M |
| 3300009661|Ga0105858_1204511 | Not Available | 582 | Open in IMG/M |
| 3300009684|Ga0114958_10331672 | Not Available | 741 | Open in IMG/M |
| 3300009792|Ga0126374_11678470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 527 | Open in IMG/M |
| 3300010396|Ga0134126_10015040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 9787 | Open in IMG/M |
| 3300012096|Ga0137389_11114403 | Not Available | 676 | Open in IMG/M |
| 3300012899|Ga0157299_10237241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 571 | Open in IMG/M |
| 3300012944|Ga0137410_11879806 | Not Available | 530 | Open in IMG/M |
| 3300012960|Ga0164301_10026100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2709 | Open in IMG/M |
| 3300012989|Ga0164305_11869824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 544 | Open in IMG/M |
| 3300013073|Ga0164283_1073706 | Not Available | 751 | Open in IMG/M |
| 3300013104|Ga0157370_10717010 | Not Available | 912 | Open in IMG/M |
| 3300013764|Ga0120111_1138694 | Not Available | 560 | Open in IMG/M |
| 3300014266|Ga0075359_1053304 | Not Available | 719 | Open in IMG/M |
| 3300014321|Ga0075353_1051058 | Not Available | 860 | Open in IMG/M |
| 3300015373|Ga0132257_102811243 | Not Available | 634 | Open in IMG/M |
| 3300017947|Ga0187785_10095419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1183 | Open in IMG/M |
| 3300018028|Ga0184608_10093802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1246 | Open in IMG/M |
| 3300018067|Ga0184611_1159125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 801 | Open in IMG/M |
| 3300020583|Ga0210401_11247288 | Not Available | 602 | Open in IMG/M |
| 3300020714|Ga0214182_1022170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 941 | Open in IMG/M |
| 3300021403|Ga0210397_11159611 | Not Available | 601 | Open in IMG/M |
| 3300021476|Ga0187846_10100183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1247 | Open in IMG/M |
| 3300021478|Ga0210402_11623642 | Not Available | 573 | Open in IMG/M |
| 3300021479|Ga0210410_11336011 | Not Available | 609 | Open in IMG/M |
| 3300024222|Ga0247691_1035855 | Not Available | 756 | Open in IMG/M |
| 3300024279|Ga0247692_1029208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 847 | Open in IMG/M |
| 3300025509|Ga0208848_1097779 | Not Available | 593 | Open in IMG/M |
| 3300025588|Ga0208586_1024775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1433 | Open in IMG/M |
| 3300025725|Ga0209638_1169186 | Not Available | 686 | Open in IMG/M |
| 3300025780|Ga0210100_1001677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2224 | Open in IMG/M |
| 3300025878|Ga0209584_10094929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1096 | Open in IMG/M |
| 3300025891|Ga0209585_10125797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 981 | Open in IMG/M |
| 3300025903|Ga0207680_10316566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1090 | Open in IMG/M |
| 3300025905|Ga0207685_10090776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1286 | Open in IMG/M |
| 3300025911|Ga0207654_10421386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 932 | Open in IMG/M |
| 3300025916|Ga0207663_10435235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1009 | Open in IMG/M |
| 3300025936|Ga0207670_11225938 | Not Available | 635 | Open in IMG/M |
| 3300025972|Ga0207668_11281438 | Not Available | 659 | Open in IMG/M |
| 3300026066|Ga0208290_1017924 | Not Available | 739 | Open in IMG/M |
| 3300026748|Ga0207575_101881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 658 | Open in IMG/M |
| 3300026757|Ga0207605_100898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 718 | Open in IMG/M |
| 3300026782|Ga0207595_102069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 695 | Open in IMG/M |
| 3300026828|Ga0207502_100213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1790 | Open in IMG/M |
| 3300026849|Ga0207804_123180 | Not Available | 543 | Open in IMG/M |
| 3300026870|Ga0208762_1001418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 838 | Open in IMG/M |
| 3300027000|Ga0207803_1044991 | Not Available | 503 | Open in IMG/M |
| 3300027552|Ga0209982_1020307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1020 | Open in IMG/M |
| 3300027725|Ga0209178_1006916 | Not Available | 3577 | Open in IMG/M |
| 3300028787|Ga0307323_10003465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 5108 | Open in IMG/M |
| 3300028800|Ga0265338_11103723 | Not Available | 534 | Open in IMG/M |
| 3300028819|Ga0307296_10709117 | Not Available | 549 | Open in IMG/M |
| 3300028828|Ga0307312_11104760 | Not Available | 524 | Open in IMG/M |
| 3300031562|Ga0310886_10432423 | Not Available | 782 | Open in IMG/M |
| 3300031724|Ga0318500_10529376 | Not Available | 594 | Open in IMG/M |
| 3300031726|Ga0302321_103585048 | Not Available | 505 | Open in IMG/M |
| 3300031740|Ga0307468_100826461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 793 | Open in IMG/M |
| 3300031765|Ga0318554_10698497 | Not Available | 569 | Open in IMG/M |
| 3300031847|Ga0310907_10382215 | Not Available | 729 | Open in IMG/M |
| 3300031879|Ga0306919_11491082 | Not Available | 509 | Open in IMG/M |
| 3300031910|Ga0306923_10060948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4187 | Open in IMG/M |
| 3300031949|Ga0214473_11787720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 608 | Open in IMG/M |
| 3300031962|Ga0307479_10412054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1336 | Open in IMG/M |
| 3300032063|Ga0318504_10414952 | Not Available | 642 | Open in IMG/M |
| 3300032177|Ga0315276_11498990 | Not Available | 702 | Open in IMG/M |
| 3300032770|Ga0335085_11016085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 895 | Open in IMG/M |
| 3300032828|Ga0335080_11924301 | Not Available | 574 | Open in IMG/M |
| 3300032892|Ga0335081_12114697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 596 | Open in IMG/M |
| 3300033289|Ga0310914_11822630 | Not Available | 513 | Open in IMG/M |
| 3300033475|Ga0310811_11101938 | Not Available | 673 | Open in IMG/M |
| 3300034676|Ga0314801_129729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 592 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 8.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 5.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 3.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.88% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.33% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.33% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.33% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.33% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.55% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.55% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.55% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.78% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.78% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.78% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.78% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.78% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.78% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.78% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.78% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.78% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.78% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.78% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.78% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.78% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908029 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 2124908036 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 2124908037 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 2124908039 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4 | Environmental | Open in IMG/M |
| 2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 2140918006 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000313 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 Cattail | Environmental | Open in IMG/M |
| 3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000676 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 27 | Environmental | Open in IMG/M |
| 3300000701 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 | Environmental | Open in IMG/M |
| 3300000710 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 67 | Environmental | Open in IMG/M |
| 3300000729 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 | Environmental | Open in IMG/M |
| 3300000905 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 | Environmental | Open in IMG/M |
| 3300000909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 | Environmental | Open in IMG/M |
| 3300000935 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001398 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 | Environmental | Open in IMG/M |
| 3300001406 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001870 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 | Environmental | Open in IMG/M |
| 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Host-Associated | Open in IMG/M |
| 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
| 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Host-Associated | Open in IMG/M |
| 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Host-Associated | Open in IMG/M |
| 3300002183 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A | Environmental | Open in IMG/M |
| 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005880 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006972 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB136-A | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013073 | Enriched Organic Plus compost microbial communities from Emeryville, California, USA - RNA 5th pass 37_C Kraft OP (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300014266 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300020714 | Freshwater microbial communities from Trout Bog Lake, WI - 14NOV2007 epilimnion | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300023270 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5 | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025725 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025780 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026066 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026748 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05K1-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026757 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K5-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026782 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A2-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026818 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A2-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300026828 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A5-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026849 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 46 (SPAdes) | Environmental | Open in IMG/M |
| 3300026870 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027000 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes) | Environmental | Open in IMG/M |
| 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A2_v1_00114240 | 2124908029 | Soil | MTLKKPSRAGLLAIASGLLLGLFLSVATYNTSYAQTXXXXXXXX |
| A5_v_00260260 | 2124908036 | Soil | MTLKKSSRAGLTTLALGVLLGLFLSVAAYTTSYAQPAPGAA |
| B3_GZBA_v_00234960 | 2124908037 | Soil | MTLKKPSRAGLVALALGVLLGLFLSVAAYNTSYAQPAPGAAP |
| B3_v_00063820 | 2124908039 | Soil | MTLKKSSRAGLTTLALGVLLGLFLSVAAYTTSYAQPAPGAAPA |
| A2_c1_00979710 | 2124908043 | Soil | MTLKKSSRAGLTTLALGVLLGLFLSVAAYNTSYAQPAPGAAPAAPA |
| A5_c1_00801860 | 2124908044 | Soil | MTLKKSSRAGLTTLALGVLLGLFLSVAAYNTSYAQPAPGAAPAAPAAAAP |
| P1_C_00993910 | 2140918006 | Soil | MTLKKPSRAGLVALALGVLLGLFLSVAAYNTSYAQPAPGAAPAAPAAA |
| NODE_06854643 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MTLKKSSRAGLFALAFGILMCLFLSVAHDVAYAQAQAPAAAP |
| WSSedB1CaDRAFT_100807231 | 3300000313 | Wetland | MTLKKSSRAGLLALAFGILLGLFLSVATYNASYAQ |
| KanNP_Total_noBrdU_T14TCDRAFT_10255862 | 3300000596 | Soil | MTLMKSSRAGLLALAFGILLGLFLSVASYEASYAQAQAPAA |
| AF_2010_repII_A1DRAFT_100528563 | 3300000597 | Forest Soil | MTLKKSSRAGLMALAFGILLGLFLSVATYDATYAQ |
| JGI12333J11928_1008851 | 3300000676 | Tropical Forest Soil | MTLMKSPRAGRLALAFGVVLSVFLSVAAFDASYAQPAPGAAPAAPAA |
| JGI12340J11893_1016462 | 3300000701 | Tropical Forest Soil | MTLMKSPRAGRLALAFGVVLSVFLSVAAFDASYAQPAPGAAP |
| JGI12294J11894_1023772 | 3300000710 | Tropical Forest Soil | MTLMKSPRAGRLALAFGVVLSVFLSVAAFDASYAQPAPGAAPAAP |
| JGI12371J11900_10138901 | 3300000729 | Tropical Forest Soil | MTLMKSPRAGLLALAFGVVLSLFLSVAAFDASYAQAP |
| JGI12406J12870_1057212 | 3300000905 | Tropical Forest Soil | MTLKKSSRAGLLALAFGVLLGLFLSVASFDASYAQTPAAPAAAPA |
| JGI12488J12863_1038291 | 3300000909 | Tropical Forest Soil | MTLKKSSRAGLLALAFGVLLGLFLSVASFDASYAQTPA |
| JGI12407J12866_1046882 | 3300000935 | Tropical Forest Soil | MTLMKSPGAGLLALAFGVVLSLFLSVGAFDASYAQPAPGAAP |
| JGI11615J12901_100189311 | 3300000953 | Soil | MTLIKSSRAGLFALAFGILLGLFLSVSPYDISYAQTQAPAAAPAAAPAP |
| JGI10216J12902_1133565381 | 3300000956 | Soil | MTLMKSSRAGLFALAFGILMCLFLSVAHDVAYAQA |
| JGI20207J14881_10078514 | 3300001398 | Arctic Peat Soil | MTLMKSSRAGLLTLALGIMLGFFLSVATINSSHAQTPAAPAAAP |
| JGI20187J14854_10059182 | 3300001406 | Arctic Peat Soil | MTLKKPSRAGLVALALGVLLGLFLSVAAYNTSYAQPAPGAAPAAPA |
| JGI12635J15846_103157083 | 3300001593 | Forest Soil | MTLKKSSRAGLTTLALGVLLGLFLSVAAYTTSYAQPAPGAAPAAPAAA |
| JGI24129J20441_10168881 | 3300001870 | Arctic Peat Soil | MTLKKPSRAGLVALALGVLLGLFLSVAAYNTSYAQPAPGAAPAAPAA |
| JGI24741J21665_10343681 | 3300001915 | Corn Rhizosphere | MTLMKSSRAGLFALAFGILLSLFLSVPSYDVSYAQTQAPAAAPAAPA |
| JGI24752J21851_10179113 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLMKSSRAGLFALAFGXLLSLFLSVPSYDVSYAQTQAPAAAPAAPAAPPPAC |
| JGI24747J21853_10039491 | 3300001978 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLMKSSRAGLFALAFGXLLSLFLSVPSYDVSYAQTQAPAAAPAAP |
| JGI24745J21846_10172531 | 3300002073 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLMKSSRAGLFALAFGILLSLFLSVPSYDVSYAQTQAPAAAPAAPAAP |
| JGI24145J26757_100753752 | 3300002183 | Arctic Peat Soil | MTLKKPSRAGLVALALGVLLGLFLSVAAYNTSYAQPAP |
| JGI24034J26672_100137183 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLMKSSRAGLFALAFGXLLSLFLSVPSYDVSYAQTQAPAAAPAAPAAPPPACANDPD |
| Ga0055455_100379961 | 3300003990 | Natural And Restored Wetlands | MTLKKPSRAGLLSLAFGILLGLFLSVAVYDASYAQTPAPAAAAPAA |
| Ga0058859_114349992 | 3300004798 | Host-Associated | MTLMKSSRAGLFALAFGILMCLFLSVAHDVAYAQAQAPAAAPAAAPATP |
| Ga0066815_100226653 | 3300005164 | Soil | MTLMKSSRAGLLALAFGILLGLFLSVASYDVSYAQAQAPAAAPA |
| Ga0066810_100160423 | 3300005169 | Soil | MTLMKSSRAGLLALAFGILLGIFLSVSTYDASYAQTPAPAAAAAPPAPA |
| Ga0068999_101122771 | 3300005205 | Natural And Restored Wetlands | MTLKKSSRAGLLALAFGILLGLFLSVATYDATYAQAQAPAAAAPAA |
| Ga0065714_102841493 | 3300005288 | Miscanthus Rhizosphere | MTLMKSSRAGLLALAFGILLGLFLSVASYDVSYAQAQAPAA |
| Ga0065712_102518453 | 3300005290 | Miscanthus Rhizosphere | MTLMKSSRAGLFALAFGILLSLFLSVPSYDVSYAQTQAPAAAPAAPAAPPPACANDPD |
| Ga0070682_1018746181 | 3300005337 | Corn Rhizosphere | MTLKKFSRAGLLALAFGVLLGLCLSTTAFDTASAQPAPAAAPA |
| Ga0070711_1009685261 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLKKSSRAGLTALAFGILLGIILSVGVYSTSYAQAPAPG |
| Ga0070665_1010201931 | 3300005548 | Switchgrass Rhizosphere | MTLMKSSRAGLFALAFGILMCLFLSVAHDVAYAQAQAPAAAPAAAPA |
| Ga0074470_1129754115 | 3300005836 | Sediment (Intertidal) | MTLKKPSRAGLLSLAFGILLGLFLSVAVYDASYAQTPAPAAAA |
| Ga0075298_10393242 | 3300005880 | Rice Paddy Soil | MTLKKSSRAGLIALAFGVLLGLSLSVATYDTSYAQAQA |
| Ga0066794_101372541 | 3300005947 | Soil | MTLKKSSRAGLLALAFGVLLGLFLSVAAYDASYAQAPATPP |
| Ga0075026_1004751421 | 3300006057 | Watersheds | MTLKKSSRAGLKALAFGALLGFILSVGVHSASYAQAP |
| Ga0075015_1009075042 | 3300006102 | Watersheds | MTLKKPSRAGLVALALGVLLSLFLSVAAYNTSYAQPAPGAAPA |
| Ga0075018_104008203 | 3300006172 | Watersheds | MTLKKPSRAGLLALALGVLLGLFLSVASFDASYAQAP |
| Ga0070716_1018267641 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTFKKFSRAGLMALAFGVVLGLFLSVSLVDHSFAQDTAAAAS |
| Ga0070712_1001287091 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLKKSSRAGLLALAFGILLGLFLSVATYDASYAQAQAPAA |
| Ga0075037_18848761 | 3300006426 | Permafrost Soil | MTLKKTSRAGLLALALGVLLGLFLSVASFDASYAQAPA |
| Ga0079220_117616842 | 3300006806 | Agricultural Soil | MTFKTLSRAGLLALAFGVLLTLCLSVASRDYGYAQTPAAPAAS |
| Ga0075518_10535453 | 3300006972 | Arctic Peat Soil | MTLKKPSRAGLAALALGVLLGLFLSVAAYNTSYAQP |
| Ga0105238_100680445 | 3300009551 | Corn Rhizosphere | MTLNKFSRAGLLALAHGVLLGLCLSTTAFDTASAQPAPAAGPAAAAP |
| Ga0105858_12045111 | 3300009661 | Permafrost Soil | MTLKKPSRAGLAALALGVLLGLFLSVAAYTTSYAQPAPGAAP |
| Ga0114958_103316721 | 3300009684 | Freshwater Lake | MTLKKPSRAGLLSLCFGILLGVFLSVAVYDASYAQTPPPAAAP |
| Ga0126374_116784702 | 3300009792 | Tropical Forest Soil | MTLKKSSRAGLLALAFGILLGLFLSVATYDASYAQAQAPAAAPAA |
| Ga0134126_100150401 | 3300010396 | Terrestrial Soil | MTLKKSSRAGLLALAFGILLGIFLSVATYSTSYAQTPAPG |
| Ga0137389_111144032 | 3300012096 | Vadose Zone Soil | MTFKKSSRAGLLALAFGVLLGLFLSTASFDVSYAQTPAAAPAAAAAPPA |
| Ga0157299_102372412 | 3300012899 | Soil | MTLMKSSRAGLFALAFGILIGLFLSVSSYDISYAQTQAP |
| Ga0137410_118798062 | 3300012944 | Vadose Zone Soil | MTFKTLSRAGLVALAAGILLGLFLSLPTFDVSYAQA |
| Ga0164301_100261004 | 3300012960 | Soil | MTLKKSSRAGLLALAFGIVLGLFLSVATYDASYAQT |
| Ga0164305_118698242 | 3300012989 | Soil | MTLKKSSRAGLLALAFGIVLGLFLSVATYDASYAQTQAP |
| Ga0164283_10737061 | 3300013073 | Soil | MTLKKVSRAGLLALALGVLLGLFLSVASFDAASAQTP |
| Ga0157370_107170101 | 3300013104 | Corn Rhizosphere | MTLKKSSRAGLLALAFGILLGLFLSVASYDVSFAQAQAPAATA |
| Ga0120111_11386941 | 3300013764 | Permafrost | MTLKKPSRAGLAALALGVLLGLFLSVAAYNTSYAQPAPAAAPAAPA |
| Ga0075359_10533041 | 3300014266 | Natural And Restored Wetlands | MTLKKFTRAGLMGIALTVLLGLFLSVASFDASHAQAPA |
| Ga0075353_10510581 | 3300014321 | Natural And Restored Wetlands | MTLKKSSRAGVVALAFGILLSLFLSVATYDTTYAQAQAPAAA |
| Ga0132257_1028112431 | 3300015373 | Arabidopsis Rhizosphere | MTLKKSSRAGLFALAFGILMCLFLSVAHDVAYAQAQAPAAA |
| Ga0187785_100954191 | 3300017947 | Tropical Peatland | MTLKKSSRAGLMGLVLGAILAIILSVGVVSHSYAQAPAPGAAP |
| Ga0184608_100938021 | 3300018028 | Groundwater Sediment | MTLMKSSRAGLFALAFGILIGLFLSVATYEASYAQAQAPAA |
| Ga0184611_11591251 | 3300018067 | Groundwater Sediment | MTLKKSSRAGLLALAFGILLGLFLSVAAYDASYAQAQAPAGAPAA |
| Ga0187774_105169171 | 3300018089 | Tropical Peatland | MTLKKSSRAGLIALAFGVMFGIVLCLGLNTASAQAPAPGAAPAAA |
| Ga0210401_112472881 | 3300020583 | Soil | MTSKKTTRAGLFALALGVLLGLFLSVASINSSYAQAPAAPPAA |
| Ga0214182_10221703 | 3300020714 | Freshwater | MTLKKFSRAGLVAGALGILLGLFLSVASFDASYAQA |
| Ga0210397_111596112 | 3300021403 | Soil | MTSKKTTRAGLFALALGVLLGLFLSVASINSSYAQAPAAP |
| Ga0213878_105370832 | 3300021444 | Bulk Soil | MTSKNTARAGWFALALGVLFGLFLSVASVNSAFAQAPAAAPAAA |
| Ga0187846_101001831 | 3300021476 | Biofilm | MKSKKISRGGLWVLALGALFGLFLSVANINSSYAQSPAAQPAQAAATS |
| Ga0210402_116236422 | 3300021478 | Soil | MTSKKTARAGLFALALGVLLGLFLSVASINSSYAQAP |
| Ga0210410_113360111 | 3300021479 | Soil | MTSKKTARAGLFALALGVLLGLFLSVASINSSYAQAPAAPPAAEPAA |
| Ga0247786_10005761 | 3300022883 | Soil | MTLMKSSRAGLFALAFGILLSLFLSVPSYDVSYAQTQAPAAAPAAPAAPPPACAND |
| Ga0247784_10431303 | 3300023270 | Plant Litter | MTLMKSSRAGLFALAFGILLSLFLSVPSYDVSYAQTQAPAAAPAAPAAPPP |
| Ga0247691_10358552 | 3300024222 | Soil | MTLMKSSRAGLFALAFGILMCLFLSVAHDVAYAQAQAPAAAPA |
| Ga0247692_10292083 | 3300024279 | Soil | MTLMKSSRAGLFALAFGILMCLFLSVAHDVAYAQAQAP |
| Ga0208848_10977792 | 3300025509 | Arctic Peat Soil | MTLKKPSRAGLAALALGVLLGLFLSVAAYNTSYAQPAP |
| Ga0208586_10247751 | 3300025588 | Arctic Peat Soil | MTLIKSSRAGLLTLALGIMLGLFLSVATINSSHAQTPMAPAAAPA |
| Ga0208220_10087336 | 3300025627 | Arctic Peat Soil | MTLKTPSRAGLLALAFGLLLALILSVSLYSTSYAQTPAPGATPAATAAPTPP |
| Ga0209638_11691861 | 3300025725 | Arctic Peat Soil | MTLKKSSRAGLLALAFGVLLGLFLSVAAYDASYAQAPATPPAA |
| Ga0210100_10016773 | 3300025780 | Natural And Restored Wetlands | MTLKKLSGAGLLALVFGVMLALFLSVATYDTSYAQT |
| Ga0209584_100949293 | 3300025878 | Arctic Peat Soil | MTLKKTSRAGLLALALGVLLGLFLSVASFDASYAQAPAP |
| Ga0209585_101257973 | 3300025891 | Arctic Peat Soil | MTLKKPSRAGLLSLCFGILLGLFLSVAVYDASFAQT |
| Ga0207680_103165663 | 3300025903 | Switchgrass Rhizosphere | MTLMKSSRAGLFALAFGILMCLFLSVAHDVAYAQAQA |
| Ga0207685_100907761 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLKKSSRAGLLALAFGILLGLFLSVATYDASYAQAQAPAATAAPPAP |
| Ga0207654_104213863 | 3300025911 | Corn Rhizosphere | MTLKKSSRAGLLALAFGILLGLFLSVATYDASYAQAQAPAAAAAPPAP |
| Ga0207663_104352351 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLMKSSRAGLFALAFGILMCLFLSVAHDVAYAQAQAPAA |
| Ga0207670_112259381 | 3300025936 | Switchgrass Rhizosphere | MTLKKSSRAGLLALAFGILLGLFLSVATYDASYAQAQAP |
| Ga0207668_112814381 | 3300025972 | Switchgrass Rhizosphere | MTLKKSSRAGLLALAFGILLGLFLSVATYDASYAQAQAPAAAAAPP |
| Ga0208290_10179243 | 3300026066 | Natural And Restored Wetlands | MTLKKLSGAGLLALVFGVMLALCLSVATYDTSYAQ |
| Ga0207575_1018812 | 3300026748 | Soil | MTLMKSSRAGLFALAFGILMCLFLSVAHDVAYAQAQ |
| Ga0207605_1008981 | 3300026757 | Soil | MTLMKSSRAGLFALAFGILLSLFLSVPSYDVSYAQTQAPAAAPA |
| Ga0207595_1020691 | 3300026782 | Soil | MTLMKSSRAGLLALAFGILLGLFLSVASYDVSYAQAQAPAAAPAA |
| Ga0207634_1011973 | 3300026818 | Soil | MTLMKSSRAGLFALAFGILLSLFLSVPSYDVSYAQTQAPAAAPAAPAAPPPA |
| Ga0207502_1002133 | 3300026828 | Soil | MTLMKSSRAGLFALAFGILLSLFLSVPSYDVSYAQTQA |
| Ga0207804_1231801 | 3300026849 | Tropical Forest Soil | MTLKKSSRAGLLALAFGILLGLFLSVASFDASYAQ |
| Ga0208762_10014181 | 3300026870 | Soil | MTLKKSSRAGLVALALGIMLGLFLSVASFDASYAQAPAPERTKRR |
| Ga0207803_10449911 | 3300027000 | Tropical Forest Soil | MTLKKSSRAGLLALAFGILLGLFLSVASFDASYAQAPAP |
| Ga0209982_10203073 | 3300027552 | Arabidopsis Thaliana Rhizosphere | MTLMKSSRAGLFALAFGILLSLFLSVPSYDVSYAQTQAP |
| Ga0209178_10069161 | 3300027725 | Agricultural Soil | MTLKKSSRAGLLALAFGIVLGLFLSVASYDVSYAQA |
| Ga0209177_100848973 | 3300027775 | Agricultural Soil | MTLMKSSRAGLFALAFGIVLGLFLSVSSYDISYAQTQAPAAAPAAPAAPPPA |
| Ga0307323_100034651 | 3300028787 | Soil | MTLKKSSRAGLFALAFGILIGLFLSVATYEASYAQAQAPAAAPAAA |
| Ga0265338_111037231 | 3300028800 | Rhizosphere | MTLKKPSRAGLTALVFGILLALVLSVSLQSSSYAQAPAPGAAPAP |
| Ga0307296_107091171 | 3300028819 | Soil | MTFKKSSRAGLFALAFGILIGLFLSVATYEASYAQAQAPAAAPAAA |
| Ga0307312_111047601 | 3300028828 | Soil | MTFKKSSRAGLFALAFGILIGLFLSVATYEASYAQAQAPAAAAPPAP |
| Ga0310886_104324232 | 3300031562 | Soil | MTLKKLTRAGLAALAFGAALGIFLNFASINSSYAQAPAA |
| Ga0318500_105293762 | 3300031724 | Soil | MTLMKSPRAGLLALAFGVVLSLFLSVAAFDASYAQPAPGAA |
| Ga0302321_1035850481 | 3300031726 | Fen | MTLKKFSRAGLVGIALTVLLGLFLSVASFDASHAQAP |
| Ga0307468_1008264612 | 3300031740 | Hardwood Forest Soil | MTLMKSSRAGLFALAFGILLGLFLSVPSYDVSYAQTQAPAAAPAA |
| Ga0318554_106984972 | 3300031765 | Soil | MTLKKSSRAGLFALAFGILMCLFLSVAHDVAYAQAPAAAPAAAPAT |
| Ga0310907_103822151 | 3300031847 | Soil | MTLKKLTRAGLAALAFGAALGIFLNFASINSSYAQAPAAPAA |
| Ga0306919_114910822 | 3300031879 | Soil | MTLKKSSRAGLVALAFGILLGLFLSVATYDASFAQA |
| Ga0306923_100609486 | 3300031910 | Soil | MTLMKFPRAGLLALALGVVLSVFLSVAAFDASYAQPAPGAAPAA |
| Ga0214473_117877202 | 3300031949 | Soil | MTLKKSSRAGLLALAFGVLLGLFLSVAAYDTSYAQAP |
| Ga0307479_104120543 | 3300031962 | Hardwood Forest Soil | MTSKKTARAGLFALALGVLLGLFLSVASINSSYAQAPAAPP |
| Ga0318504_104149522 | 3300032063 | Soil | MTLMKSPRAGLLALAFGVVLSLFLSVAAFDASYAQPAPGAAPAAPA |
| Ga0315276_114989902 | 3300032177 | Sediment | MTLKKISRAGLLALVLGTVLGLFLSVASFDASYAQTLAPA |
| Ga0335085_110160851 | 3300032770 | Soil | MTLKKSSRAGLTALAFGILLGIILSVGLYSTSYAQAPAPG |
| Ga0335080_119243012 | 3300032828 | Soil | MTLKKSSRAGLLALAFGILLGLFLSVGTINSSYAQTPPAPAAAPAPAPA |
| Ga0335081_121146971 | 3300032892 | Soil | MTFKRSSRAGLKALAFGALLGFILSVGVHSASYAQAPAAPAAAPA |
| Ga0310914_118226302 | 3300033289 | Soil | MTLKKSSRAGLVALAFGILLGLFLSVATYDASFAQ |
| Ga0310811_111019381 | 3300033475 | Soil | MTLNKFSRAGLLALAFGVLLGLCLSMTTFDTSSAQPAPAAAPA |
| Ga0314801_129729_457_591 | 3300034676 | Soil | MTLMKSSRAGLLALAFGILLGLFLSVASYDVSYAQAQAPAAAPAT |
| ⦗Top⦘ |