| Basic Information | |
|---|---|
| Family ID | F062490 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 130 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MAKQFFGGFFATLAFVAVVLAALFGIFTLVSYIAGPVGG |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 84.62 % |
| % of genes near scaffold ends (potentially truncated) | 21.54 % |
| % of genes from short scaffolds (< 2000 bps) | 72.31 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.308 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (16.923 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.462 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (28.462 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.25% β-sheet: 0.00% Coil/Unstructured: 50.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF01987 | AIM24 | 36.92 |
| PF13307 | Helicase_C_2 | 12.31 |
| PF00202 | Aminotran_3 | 3.85 |
| PF03358 | FMN_red | 3.85 |
| PF00005 | ABC_tran | 3.08 |
| PF12840 | HTH_20 | 3.08 |
| PF01022 | HTH_5 | 2.31 |
| PF11074 | DUF2779 | 1.54 |
| PF01061 | ABC2_membrane | 0.77 |
| PF12320 | SbcD_C | 0.77 |
| PF06089 | Asparaginase_II | 0.77 |
| PF03747 | ADP_ribosyl_GH | 0.77 |
| PF02579 | Nitro_FeMo-Co | 0.77 |
| PF12698 | ABC2_membrane_3 | 0.77 |
| PF03167 | UDG | 0.77 |
| PF13476 | AAA_23 | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG2013 | AIM24 protein, required for mitochondrial respiration | Energy production and conversion [C] | 36.92 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.77 |
| COG1397 | ADP-ribosylglycohydrolase | Posttranslational modification, protein turnover, chaperones [O] | 0.77 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.77 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.77 |
| COG4448 | L-asparaginase II | Amino acid transport and metabolism [E] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.31 % |
| Unclassified | root | N/A | 7.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000506|Soeholt_1000679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1853 | Open in IMG/M |
| 3300000553|TBL_comb47_HYPODRAFT_10046883 | All Organisms → cellular organisms → Bacteria | 2689 | Open in IMG/M |
| 3300000553|TBL_comb47_HYPODRAFT_10112357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1297 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_103673159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 698 | Open in IMG/M |
| 3300002069|JGIcombinedJ21912_10075479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1373 | Open in IMG/M |
| 3300002069|JGIcombinedJ21912_10153722 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300002069|JGIcombinedJ21912_10275829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 536 | Open in IMG/M |
| 3300002549|JGI24130J36418_10009258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3200 | Open in IMG/M |
| 3300002565|JGI24137J36423_1004449 | All Organisms → cellular organisms → Bacteria | 4302 | Open in IMG/M |
| 3300004028|Ga0055447_10091123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 866 | Open in IMG/M |
| 3300004072|Ga0055512_10075085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 649 | Open in IMG/M |
| 3300004146|Ga0055495_10143360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 598 | Open in IMG/M |
| 3300004481|Ga0069718_15772469 | All Organisms → cellular organisms → Bacteria | 3510 | Open in IMG/M |
| 3300004776|Ga0007800_10067118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 863 | Open in IMG/M |
| 3300004779|Ga0062380_10449687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 566 | Open in IMG/M |
| 3300005144|Ga0068711_1012256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 2799 | Open in IMG/M |
| 3300005217|Ga0069005_10058789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 861 | Open in IMG/M |
| 3300005217|Ga0069005_10070373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 811 | Open in IMG/M |
| 3300005938|Ga0066795_10006474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3078 | Open in IMG/M |
| 3300006102|Ga0075015_100752426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 582 | Open in IMG/M |
| 3300006950|Ga0075524_10244181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 784 | Open in IMG/M |
| 3300006972|Ga0075518_1008163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 2250 | Open in IMG/M |
| 3300009078|Ga0105106_10098853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 2148 | Open in IMG/M |
| 3300009078|Ga0105106_10580220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 804 | Open in IMG/M |
| 3300009085|Ga0105103_10961623 | Not Available | 503 | Open in IMG/M |
| 3300009087|Ga0105107_10123397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1824 | Open in IMG/M |
| 3300009087|Ga0105107_10607020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 762 | Open in IMG/M |
| 3300009087|Ga0105107_10750125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 679 | Open in IMG/M |
| 3300009091|Ga0102851_12241882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 622 | Open in IMG/M |
| 3300009120|Ga0117941_1040333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1241 | Open in IMG/M |
| 3300009120|Ga0117941_1102544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 780 | Open in IMG/M |
| 3300009131|Ga0115027_11283496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 590 | Open in IMG/M |
| 3300009167|Ga0113563_10994185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 965 | Open in IMG/M |
| 3300009167|Ga0113563_11427646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 813 | Open in IMG/M |
| 3300009175|Ga0073936_10009428 | All Organisms → cellular organisms → Bacteria | 12136 | Open in IMG/M |
| 3300009179|Ga0115028_11168097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 631 | Open in IMG/M |
| 3300009503|Ga0123519_10685392 | Not Available | 531 | Open in IMG/M |
| 3300009607|Ga0123327_1067531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1389 | Open in IMG/M |
| 3300009670|Ga0116183_1440691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 536 | Open in IMG/M |
| 3300009689|Ga0116186_1004077 | All Organisms → cellular organisms → Bacteria | 12031 | Open in IMG/M |
| 3300009868|Ga0130016_10031722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6405 | Open in IMG/M |
| 3300009868|Ga0130016_10371578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 962 | Open in IMG/M |
| 3300010347|Ga0116238_10554892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 723 | Open in IMG/M |
| 3300012005|Ga0120161_1117832 | Not Available | 615 | Open in IMG/M |
| (restricted) 3300013122|Ga0172374_1089151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1192 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10387629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 633 | Open in IMG/M |
| 3300014257|Ga0075319_1004482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1862 | Open in IMG/M |
| 3300014258|Ga0075315_1003252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1833 | Open in IMG/M |
| 3300014261|Ga0075360_1100793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 570 | Open in IMG/M |
| 3300014298|Ga0075341_1130739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 520 | Open in IMG/M |
| 3300014316|Ga0075339_1022448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1500 | Open in IMG/M |
| 3300014322|Ga0075355_1024821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1228 | Open in IMG/M |
| 3300014322|Ga0075355_1220962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 535 | Open in IMG/M |
| 3300014502|Ga0182021_11939322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 709 | Open in IMG/M |
| 3300016687|Ga0180047_1079075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 533 | Open in IMG/M |
| 3300017944|Ga0187786_10202324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 756 | Open in IMG/M |
| 3300017947|Ga0187785_10245967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 799 | Open in IMG/M |
| 3300020163|Ga0194039_1033151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1986 | Open in IMG/M |
| 3300020163|Ga0194039_1163786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 763 | Open in IMG/M |
| 3300020228|Ga0194040_1206781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 581 | Open in IMG/M |
| 3300021070|Ga0194056_10088578 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300021520|Ga0194053_10065482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1568 | Open in IMG/M |
| 3300025461|Ga0208851_1002660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 5108 | Open in IMG/M |
| 3300025499|Ga0207931_1001744 | All Organisms → cellular organisms → Bacteria | 6560 | Open in IMG/M |
| 3300025533|Ga0208584_1108781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 657 | Open in IMG/M |
| 3300025548|Ga0208716_1086909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 628 | Open in IMG/M |
| 3300025564|Ga0210084_1038012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 917 | Open in IMG/M |
| 3300025724|Ga0208196_1011147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5169 | Open in IMG/M |
| 3300025829|Ga0209484_10046581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 937 | Open in IMG/M |
| 3300025846|Ga0209538_1268349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 611 | Open in IMG/M |
| 3300025852|Ga0209124_10265513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 658 | Open in IMG/M |
| 3300025857|Ga0209014_10028070 | All Organisms → cellular organisms → Bacteria | 2625 | Open in IMG/M |
| 3300025888|Ga0209540_10062997 | All Organisms → cellular organisms → Bacteria | 2285 | Open in IMG/M |
| 3300025888|Ga0209540_10383407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 772 | Open in IMG/M |
| 3300025891|Ga0209585_10096057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1120 | Open in IMG/M |
| 3300027051|Ga0209269_1000019 | All Organisms → cellular organisms → Bacteria | 434838 | Open in IMG/M |
| 3300027818|Ga0209706_10057423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1958 | Open in IMG/M |
| 3300027818|Ga0209706_10564026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 515 | Open in IMG/M |
| 3300027863|Ga0207433_10571736 | Not Available | 643 | Open in IMG/M |
| 3300027885|Ga0209450_10039454 | All Organisms → cellular organisms → Bacteria | 2843 | Open in IMG/M |
| 3300027897|Ga0209254_10538741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 836 | Open in IMG/M |
| 3300027899|Ga0209668_10375354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 927 | Open in IMG/M |
| 3300027900|Ga0209253_10653822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 764 | Open in IMG/M |
| 3300027902|Ga0209048_10008361 | All Organisms → cellular organisms → Bacteria | 9457 | Open in IMG/M |
| 3300028032|Ga0265296_1008165 | All Organisms → cellular organisms → Bacteria | 7628 | Open in IMG/M |
| 3300028176|Ga0268284_1011318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2862 | Open in IMG/M |
| 3300028665|Ga0302160_10117814 | Not Available | 597 | Open in IMG/M |
| 3300028679|Ga0302169_10074371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 805 | Open in IMG/M |
| 3300028732|Ga0302264_1003250 | All Organisms → cellular organisms → Bacteria | 3951 | Open in IMG/M |
| 3300028733|Ga0302261_1171224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 518 | Open in IMG/M |
| 3300028764|Ga0302260_1076917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 689 | Open in IMG/M |
| (restricted) 3300029286|Ga0247841_10092656 | All Organisms → cellular organisms → Bacteria | 2529 | Open in IMG/M |
| 3300029288|Ga0265297_10127903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1966 | Open in IMG/M |
| 3300029987|Ga0311334_10581829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 907 | Open in IMG/M |
| 3300030010|Ga0302299_10083377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1771 | Open in IMG/M |
| 3300030294|Ga0311349_10658263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 989 | Open in IMG/M |
| 3300031746|Ga0315293_10002692 | All Organisms → cellular organisms → Bacteria | 17071 | Open in IMG/M |
| 3300031834|Ga0315290_10074796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2807 | Open in IMG/M |
| 3300031834|Ga0315290_10081884 | All Organisms → cellular organisms → Bacteria | 2689 | Open in IMG/M |
| 3300031834|Ga0315290_10204797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1715 | Open in IMG/M |
| 3300031834|Ga0315290_10224559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1636 | Open in IMG/M |
| 3300031834|Ga0315290_10238006 | Not Available | 1587 | Open in IMG/M |
| 3300031918|Ga0311367_10464576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1300 | Open in IMG/M |
| 3300031997|Ga0315278_10025971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5597 | Open in IMG/M |
| 3300031997|Ga0315278_10026257 | All Organisms → cellular organisms → Bacteria | 5568 | Open in IMG/M |
| 3300031997|Ga0315278_10110027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 2785 | Open in IMG/M |
| 3300031997|Ga0315278_10247693 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300032018|Ga0315272_10036231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 2231 | Open in IMG/M |
| 3300032143|Ga0315292_11652951 | Not Available | 515 | Open in IMG/M |
| 3300032156|Ga0315295_10139242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 2404 | Open in IMG/M |
| 3300032173|Ga0315268_10125857 | All Organisms → cellular organisms → Bacteria | 2423 | Open in IMG/M |
| 3300032173|Ga0315268_12165192 | Not Available | 570 | Open in IMG/M |
| 3300032173|Ga0315268_12533845 | Not Available | 526 | Open in IMG/M |
| 3300032256|Ga0315271_10000966 | All Organisms → cellular organisms → Bacteria | 16940 | Open in IMG/M |
| 3300032256|Ga0315271_10735609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 848 | Open in IMG/M |
| 3300032263|Ga0316195_10352729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 777 | Open in IMG/M |
| 3300032275|Ga0315270_10084980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1830 | Open in IMG/M |
| 3300032276|Ga0316188_10364311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 755 | Open in IMG/M |
| 3300032342|Ga0315286_10326452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1621 | Open in IMG/M |
| 3300032397|Ga0315287_11331234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 820 | Open in IMG/M |
| 3300032401|Ga0315275_10403990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1531 | Open in IMG/M |
| 3300032562|Ga0316226_1000978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 33694 | Open in IMG/M |
| 3300032605|Ga0316232_1345374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 544 | Open in IMG/M |
| 3300032782|Ga0335082_10091969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 3023 | Open in IMG/M |
| 3300032897|Ga0335071_10110341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 2697 | Open in IMG/M |
| 3300032897|Ga0335071_12110669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 506 | Open in IMG/M |
| 3300033418|Ga0316625_100580728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 909 | Open in IMG/M |
| 3300033521|Ga0316616_100642273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1257 | Open in IMG/M |
| 3300033810|Ga0314872_035165 | Not Available | 502 | Open in IMG/M |
| 3300034123|Ga0370479_0021665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1500 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 16.92% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 13.85% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 6.92% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 6.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 6.15% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 3.85% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 3.08% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.08% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.08% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 3.08% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.31% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.54% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 1.54% |
| Lake Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment | 1.54% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.54% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 1.54% |
| Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture | 1.54% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.77% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.77% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.77% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.77% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 0.77% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.77% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.77% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.77% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.77% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.77% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.77% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.77% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.77% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 0.77% |
| Anaerobic Digester | Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Anaerobic Digester | 0.77% |
| Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000506 | Anaerobic digester microbial communities from Northern Denmark, sample from Soeholt sludge | Engineered | Open in IMG/M |
| 3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002069 | Barrow Graham LP Ref core NGADG0002-212 (Barrow Graham LP Ref core NGADG0002-212,NGADG0004-211, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
| 3300002549 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 | Environmental | Open in IMG/M |
| 3300002565 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-311 | Environmental | Open in IMG/M |
| 3300004028 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordC_D2 | Environmental | Open in IMG/M |
| 3300004072 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004146 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004776 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA14M | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300005144 | Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaG | Engineered | Open in IMG/M |
| 3300005217 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailC_D2 | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300006972 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB136-A | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009120 | Lake sediment microbial communities from Tanners Lake, St. Paul, MN | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009503 | Hot spring microbial communities from Yellowstone National Park - Yellowstone National Park OP-RAMG-02 | Environmental | Open in IMG/M |
| 3300009607 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009670 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG | Engineered | Open in IMG/M |
| 3300009689 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG | Engineered | Open in IMG/M |
| 3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
| 3300010347 | AD_JPHGca | Engineered | Open in IMG/M |
| 3300012005 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_0M | Environmental | Open in IMG/M |
| 3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
| 3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
| 3300014257 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014258 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014261 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014298 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300014316 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 | Environmental | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016687 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES104 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300020163 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-8m | Environmental | Open in IMG/M |
| 3300020228 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-10m | Environmental | Open in IMG/M |
| 3300021070 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-13m | Environmental | Open in IMG/M |
| 3300021520 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-8m | Environmental | Open in IMG/M |
| 3300025461 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025499 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025533 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025548 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025564 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025724 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025829 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B (SPAdes) | Environmental | Open in IMG/M |
| 3300025846 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025852 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes) | Environmental | Open in IMG/M |
| 3300025857 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300027051 | Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027863 | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300028032 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1 | Environmental | Open in IMG/M |
| 3300028176 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_40m | Environmental | Open in IMG/M |
| 3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028679 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028732 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300028733 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_4 | Environmental | Open in IMG/M |
| 3300028764 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300029286 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m | Environmental | Open in IMG/M |
| 3300029288 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91 | Engineered | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032263 | Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
| 3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033810 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_E | Environmental | Open in IMG/M |
| 3300034123 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Soeholt_10006792 | 3300000506 | Anaerobic Digester | MKVRGWFVGFFSTLAFVVVVLAALFGIFTLISYWAGPAGG* |
| TBL_comb47_HYPODRAFT_100468833 | 3300000553 | Freshwater | MARQFFWGMFITLAFVAVVTVGLLGIFTLVSLITGPVGG* |
| TBL_comb47_HYPODRAFT_101123571 | 3300000553 | Freshwater | MAKQFFWGMLITLAFVAVVTVGLLGIFTLVSYLTGPVGG* |
| JGIcombinedJ13530_1036731592 | 3300001213 | Wetland | VGGVFKGFFQTLAFMAVVIVVLFGIFTLVSYLAGPVGG* |
| JGIcombinedJ21912_100754795 | 3300002069 | Arctic Peat Soil | QFFGGFFATLTFVAVILAALFCIFTLVSFIAGPVGG* |
| JGIcombinedJ21912_101537221 | 3300002069 | Arctic Peat Soil | ERERIMAKQFFGGFFATLTFVAVILAALFCIFTLVSYIAGPVGG* |
| JGIcombinedJ21912_102758291 | 3300002069 | Arctic Peat Soil | ERERIMAKQFFGGFFATLTFVAVILAALFCIFTLVSYLAGPVGG* |
| JGI24130J36418_100092582 | 3300002549 | Arctic Peat Soil | MAKQFFGGFFATLAFAAGILVALLGIFTLVSYIAGPVGG* |
| JGI24137J36423_10044498 | 3300002565 | Arctic Peat Soil | ERIMAKQFFGGFFATLTFVAVILAALFCIFTLVSYLAGPVGG* |
| Ga0055447_100911232 | 3300004028 | Natural And Restored Wetlands | MTRGLFAGFFITLAFVAVVLVVLFGIFTLVSYLAGPVGG* |
| Ga0055512_100750852 | 3300004072 | Natural And Restored Wetlands | MGRQFIVGFFLTIVFGVVVLAGLFGIFTLVSYLAGPVGG* |
| Ga0055495_101433602 | 3300004146 | Natural And Restored Wetlands | MSRGLFGGFFQTLGFLVLVAVVLFGIFTLVSYLAGPVGG* |
| Ga0069718_157724693 | 3300004481 | Sediment | MSRGLFAGFFQTLGFIVIVLVALFGIFTLVSYLAGPVGG* |
| Ga0007800_100671181 | 3300004776 | Freshwater | MAKQFFGGFFATLTFVVVVLAALFGIFTLVSYLDGPGEVADQGE |
| Ga0062380_104496871 | 3300004779 | Wetland Sediment | MRTRELFAGFFQTLFFIAAAAALLFVIFTLVSYLAGPVGG* |
| Ga0068711_10122563 | 3300005144 | Enrichment Culture | MKTRGWFAGFISTLAFVVIVLAALFGIFTLVSYWAGPVGG* |
| Ga0069005_100587891 | 3300005217 | Natural And Restored Wetlands | MGRQFFVGFFLTALFGVVVLAGLFGIFTLVSYIAGPVGGG* |
| Ga0069005_100703732 | 3300005217 | Natural And Restored Wetlands | MGRQFIVGFFLTVVFGVVVLAGLFGIFTLVSYLAGPVGG* |
| Ga0066795_100064749 | 3300005938 | Soil | MAKQFFGGFFATLTFVAVILAALFCIFTLVSYIAGPVGG* |
| Ga0075015_1007524262 | 3300006102 | Watersheds | MARQFFWGMFITLAFVAVVTVGLLGIFTLVSYITGPVGG* |
| Ga0075524_102441812 | 3300006950 | Arctic Peat Soil | MAKQFFGGFFATLTFVAVVLAALFCIFTLVSYIAGPVGG* |
| Ga0075518_10081634 | 3300006972 | Arctic Peat Soil | MAKQFLGGFFATLAFAAGILAALLGIFTLVSYIAGPVGG* |
| Ga0105106_100988532 | 3300009078 | Freshwater Sediment | VGAFFKGLFQTLAFMVVVIAVLFGIFTLVSYLAGPVGG* |
| Ga0105106_105802202 | 3300009078 | Freshwater Sediment | MSRGLFAGFFQTLGFVVIVLVVLFGIFTLVSYLAGPVGG* |
| Ga0105103_109616232 | 3300009085 | Freshwater Sediment | MSRGLFAGFFQTLGFIVIVLVVLFGIFTLVSYLAGPVGA* |
| Ga0105107_101233971 | 3300009087 | Freshwater Sediment | GSVHMSRGLFAGFFQTLGFVVIVLVVLFGIFTLVSYLAGPVGA* |
| Ga0105107_106070202 | 3300009087 | Freshwater Sediment | MSRELFAGFFITLAFGAVVLIALFGIFTLVSYLAGPAGG* |
| Ga0105107_107501251 | 3300009087 | Freshwater Sediment | MKTRGWLAGFFSTLAFVVVVLAALFGIFTLVSYWAGPVGG* |
| Ga0102851_122418822 | 3300009091 | Freshwater Wetlands | MKTRELFAGFFSTLAFFIVAAALLFGIFTLVSYLAGPVGG* |
| Ga0117941_10403331 | 3300009120 | Lake Sediment | MTRGFFVGFFSILAFVAVVLVGLFGIFTLVSYLAG* |
| Ga0117941_11025441 | 3300009120 | Lake Sediment | GVQMSRGLFAGFFQTLGFIVIVLVALFGIFTLVSYLAGPVGG* |
| Ga0115027_112834962 | 3300009131 | Wetland | PMKTRELFAGFFSTLAFFVVAAALLFGIFTLVSYLAGPVGG* |
| Ga0113563_109941852 | 3300009167 | Freshwater Wetlands | MKTRELFAGFFSTLAFFVVAAALLFGIFTLVSYLAGPVGG* |
| Ga0113563_114276462 | 3300009167 | Freshwater Wetlands | MARQFLVALFMTLAFAVVVLGALFGIFTLVSYLAG |
| Ga0073936_1000942810 | 3300009175 | Freshwater Lake Hypolimnion | MARQFFWGMFITLAFVAVVTAGLLGIFTLVSYITGPVGG* |
| Ga0115028_111680971 | 3300009179 | Wetland | VGAFFKGLFQTLAFMVVVIAVLFGIFTLVSYLAGPV |
| Ga0123519_106853922 | 3300009503 | Hot Spring | MADFLKGFVSTLAFAAAVLAALFGIFTLVSWLAGPVGG* |
| Ga0123327_10675312 | 3300009607 | Anaerobic Biogas Reactor | MKTKGWFAGFFSTLAFVVVVLAALFGIFTLISYWAGPVGG* |
| Ga0116183_14406911 | 3300009670 | Anaerobic Digestor Sludge | MKVRGWFVGFFSTLAFVVVVLAALFGIFTLISYWA |
| Ga0116186_10040773 | 3300009689 | Anaerobic Digestor Sludge | MKVRGWFVGFFSTFAFVVVVLAALFGIFTLISYWAGPAGG* |
| Ga0130016_100317225 | 3300009868 | Wastewater | MARGMFAGFLSTLAFAVVVAAVLFGIFTLVSYLAGPVGG* |
| Ga0130016_103715781 | 3300009868 | Wastewater | VSAFFKGLFQTLAFMVVVIAVLFGIFTLVSYLAGPVGG* |
| Ga0116238_105548923 | 3300010347 | Anaerobic Digestor Sludge | TGAQMKVRGWFVGFFSTLAFVVVVLAALFGIFTLISYWAGPAGG* |
| Ga0120161_11178322 | 3300012005 | Permafrost | MAKQFFGGLFVTLAFAILVLAALFGIFTLVSYMAGPVGG* |
| (restricted) Ga0172374_10891512 | 3300013122 | Freshwater | MGRQFFVGLLVTLGFAAVVLAALFGIFTLVSYLAGPVGG* |
| (restricted) Ga0172368_103876292 | 3300013123 | Freshwater | VGAFFKGLFQTLAFMVVVIAVLFGIFTLVSYLAGPIGG* |
| Ga0075319_10044823 | 3300014257 | Natural And Restored Wetlands | VGAFLKGLFQTLAFMVVVITVLFGIFTLVSYLAGPVGG* |
| Ga0075315_10032522 | 3300014258 | Natural And Restored Wetlands | VGAFLKGLFQTLAFMVVVIAVLLGIFTLVSYLAGPVGG* |
| Ga0075360_11007931 | 3300014261 | Natural And Restored Wetlands | MSGVFKGFFQTLLFMVVVAAVLFGIFTLVSYFAGPVGG |
| Ga0075341_11307391 | 3300014298 | Natural And Restored Wetlands | MSRGLFAGFFQTLGFVVLVLVVLFGIFTLVSYLAGPVGG* |
| Ga0075339_10224483 | 3300014316 | Natural And Restored Wetlands | VSAFFKGLFQTLAFMVVVVVVLFGIFTLVSYLAGPVGG* |
| Ga0075355_10248213 | 3300014322 | Natural And Restored Wetlands | VGAFFKGLFQTLAFMVVVIAVLFGIFTLVSYMAGPVGG* |
| Ga0075355_12209621 | 3300014322 | Natural And Restored Wetlands | MGRQFIVGFFLTVVFWVVVLAGLFGIFTLVSYLAGPVGG* |
| Ga0182021_119393221 | 3300014502 | Fen | MRGFSGGFFQTLGFFAVAIVLLFGIFTLVSYLAGPVGG* |
| Ga0180047_10790751 | 3300016687 | Freshwater | SLREQERSMAKQFFWGMLITLAFVAVVTVGLLGIFTLVSYLTGPVGG |
| Ga0187786_102023241 | 3300017944 | Tropical Peatland | KQFFAGFFTTLVFVVVVLAGLFGIFVLIDLIAGPVGG |
| Ga0187785_102459672 | 3300017947 | Tropical Peatland | MVLKGFFQALAFMVVVIAILFGIFTLVSYLAGPVGG |
| Ga0194039_10331511 | 3300020163 | Anoxic Zone Freshwater | MARQFFWGMFITLAFVAVVTVGLLGIFTLVSLITGPVGG |
| Ga0194039_11637861 | 3300020163 | Anoxic Zone Freshwater | ERECIMAKQFFGGFFATLTFAAVILAALFGIFTLVSYIAGPVGG |
| Ga0194040_12067812 | 3300020228 | Anoxic Zone Freshwater | MARQFFWGMFITLAFVAVVTAGLLGIFTLVSYITGPVGG |
| Ga0194056_100885782 | 3300021070 | Anoxic Zone Freshwater | MARQFFSAFFLTLVFAAVVLGGLFGIFTLVSYLAGPVGG |
| Ga0194053_100654822 | 3300021520 | Anoxic Zone Freshwater | MAKQFFGGFFATLTFAAVILAALFGIFTLVSYIAGPVGG |
| Ga0208851_10026604 | 3300025461 | Arctic Peat Soil | MKARGSFAGFFQTLGFFLVAAALLFGIFTLVSYLAGPVGG |
| Ga0207931_10017445 | 3300025499 | Arctic Peat Soil | MAKQFFGGFFITLAFVVVVLAALFGIFILISYMAGPVGG |
| Ga0208584_11087812 | 3300025533 | Arctic Peat Soil | MAKQFFGGFFATLTFVAVILAALFCIFTLVSYIAGPVGG |
| Ga0208716_10869091 | 3300025548 | Arctic Peat Soil | ARGSFAGFFQTLGFFLVAAALLFGIFTLVSYLAGPVGG |
| Ga0210084_10380123 | 3300025564 | Natural And Restored Wetlands | MTRGLFAGFFITLAFVAVVLVVLFGIFTLVSYLAGPVGG |
| Ga0208196_10111477 | 3300025724 | Anaerobic Digestor Sludge | MKVRGWFVGFFSTLAFVVVVLAALFGIFTLISYWAGPAGG |
| Ga0209484_100465814 | 3300025829 | Arctic Peat Soil | RERIMAKQFFGGFFATLAFAAGILVALLGIFTLVSYIAGPVGG |
| Ga0209538_12683492 | 3300025846 | Arctic Peat Soil | MAKQFFGGFFATLAFAAGILAALFGIFTLVSYIAGPVGG |
| Ga0209124_102655131 | 3300025852 | Arctic Peat Soil | TSLREREHSMAKQFFWGMFITLAFVAVVTAGLLGIFTLVSYLAGPVGG |
| Ga0209014_100280705 | 3300025857 | Arctic Peat Soil | MAKQFFGGFFATLTFVAVILAALFCIFTLVSYLAGPVGG |
| Ga0209540_100629972 | 3300025888 | Arctic Peat Soil | MAKQFFGGFFATLTFVVIVLAALFGIFTLVSYIAGPVGG |
| Ga0209540_103834074 | 3300025888 | Arctic Peat Soil | IMAKQFFGGFFATLTFVAVILAALFCIFTLVSYIAGPVGG |
| Ga0209585_100960572 | 3300025891 | Arctic Peat Soil | MTRGLFAGFFITLAFVAIVLIALFGIFTLVSYLAGPVGG |
| Ga0209269_100001922 | 3300027051 | Enrichment Culture | MKTRGWFAGFISTLAFVVIVLAALFGIFTLVSYWAGPVGG |
| Ga0209706_100574233 | 3300027818 | Freshwater Sediment | MSRGLFAGFFQTLGFIVIVLVVLFGIFTLVSYLAGPVGA |
| Ga0209706_105640262 | 3300027818 | Freshwater Sediment | VGAFFKGLFQTLAFMVVVIAVLFGIFTLVSYLAGPVGG |
| Ga0207433_105717362 | 3300027863 | Hot Spring | MADFLKGFVSTLAFAAAVLAALFGIFTLVSWLAGPVGG |
| Ga0209450_100394543 | 3300027885 | Freshwater Lake Sediment | MTRGFFVGFFSILAFVAVVLVGLFGIFTLVSYLAG |
| Ga0209254_105387412 | 3300027897 | Freshwater Lake Sediment | MKTRELFAGFFSTLAFFVIAAALLFGIFTLVSFLAGPVGG |
| Ga0209668_103753542 | 3300027899 | Freshwater Lake Sediment | MTRGFFAGFVWTLAFVVIVLAALFGIFTLVSYVAGPVGG |
| Ga0209253_106538222 | 3300027900 | Freshwater Lake Sediment | MKTRELFGGFFQTLAFFAVAALLLFGIFTLVSFLAGP |
| Ga0209048_100083617 | 3300027902 | Freshwater Lake Sediment | MAKQFFGGFFATLTFVAVVLAALFGIFTLVSYIAGPVGG |
| Ga0265296_10081657 | 3300028032 | Groundwater | MAKQFFSGFLMTLVFAAVVIAGLFGIFTLVSYLTGPVGG |
| Ga0268284_10113181 | 3300028176 | Saline Water | MTRGFFAGFLTTLAFVVVVLAGLFGIFTLVSYVAGPGGG |
| Ga0302160_101178141 | 3300028665 | Fen | MRGFSGGFFQTLGFFAVAIVLLFGIFTLVSYLAGPVGG |
| Ga0302169_100743712 | 3300028679 | Fen | MKTRGLLGGFFQTLGFFAVALVLLFGIFTLVSYLAGPVGG |
| Ga0302264_10032506 | 3300028732 | Fen | MRGLLGGFFQTLGFFAVALVLLFGIFTLVSYLAGPVGG |
| Ga0302261_11712242 | 3300028733 | Fen | VHPERECIMAKQFFGGFFITLAFVAVVLVALFGIFTLVSLLAGPVGG |
| Ga0302260_10769171 | 3300028764 | Fen | MRGFSGGFFQTLVFFAVAIVLLFGIFTLVSYLAGPVGG |
| (restricted) Ga0247841_100926562 | 3300029286 | Freshwater | MAKQFFGGFFATLTFAVVVLAALFGIFTLVSYIAGPVGG |
| Ga0265297_101279034 | 3300029288 | Landfill Leachate | MAKQFFGGFFATLVFVAIVLAGLFGIFTLVSYLVGPVGG |
| Ga0311334_105818292 | 3300029987 | Fen | MGKGFWGGFVLTLVFMAVVIVALFGIFTLVSYVAGPVGG |
| Ga0302299_100833772 | 3300030010 | Fen | MTRQFFWGMFITLAFVAVVAAGLLGIFTLVSYIAGPVGG |
| Ga0311349_106582632 | 3300030294 | Fen | MTRQFFWGMFITLAFVAVVTAGLLGIFTLVSYIAGPVGG |
| Ga0315293_100026923 | 3300031746 | Sediment | MAKQFFGGLFVTLAFAAGVLVALFGIFTLVSYLAGPVGG |
| Ga0315290_100747962 | 3300031834 | Sediment | MAKPFFGGFFVTLAFVAVVLAALFGIFTLVSYIAGPVGG |
| Ga0315290_100818844 | 3300031834 | Sediment | MAKQFFGGFFATLIFTGVVAVALFLIFTLVSYMAGPVGG |
| Ga0315290_102047972 | 3300031834 | Sediment | MAKQFFGGFFVTLAFVAVVLAALFGIFTLVSYIAGPVGG |
| Ga0315290_102245592 | 3300031834 | Sediment | MAKLFFGGFFATLTFVAVVLAALFCIFTLVSYVAGSVGG |
| Ga0315290_102380062 | 3300031834 | Sediment | MARQFFGGFFATLIFAVVVMVALFAIFTLVSYMAGPVGG |
| Ga0311367_104645762 | 3300031918 | Fen | MNSRGLFAGFFQTLGFFVIAAALLFGIFTLVSYLAGPVGG |
| Ga0315278_100259713 | 3300031997 | Sediment | MAKLFFGGFFATLTFVAVVLAALFCIFTLVSYVAGPVGG |
| Ga0315278_100262574 | 3300031997 | Sediment | MAKQFFSGFFATLTFVVVVLAALFGIFTLVSYVAGTVGG |
| Ga0315278_101100273 | 3300031997 | Sediment | MAKQFFGGFFATLAFVAVVLAALFGIFTLVSYIAGPVGG |
| Ga0315278_102476933 | 3300031997 | Sediment | MAKQFFGGFFATLTFVVLVLAALFGIFTLVSYIAGPVGG |
| Ga0315272_100362312 | 3300032018 | Sediment | MSGVFKGFFQTLLFMAVVAAVLFGIFTLVSYLAGPVGG |
| Ga0315292_116529512 | 3300032143 | Sediment | MAKQFFSGFFATLTFVVFVLAALFGIFTLVSYIAGPVGG |
| Ga0315295_101392423 | 3300032156 | Sediment | MAKLFFGGFFATLAFVIGVLAALFGIFTLVSYIAGPVGG |
| Ga0315268_101258573 | 3300032173 | Sediment | MAKQFFGGFFATLAFVAVILAALFGIFTLVSYIAGPVGG |
| Ga0315268_121651922 | 3300032173 | Sediment | MARQFFSAFFLTLAFAAVVLGALFGIFTLVSYLAGPVGG |
| Ga0315268_125338452 | 3300032173 | Sediment | MARQFFGGLFATLTFAVIVMVALFAIFTLISYMAGPVGG |
| Ga0315271_1000096613 | 3300032256 | Sediment | MKARGLFAGFFQTLVFFLAAAVLLFGIFTLVSFLAGPVGG |
| Ga0315271_107356091 | 3300032256 | Sediment | LMKARGLFAGFFQTLGFFLVAAALLFGIFTLVSYLAGPVGG |
| Ga0316195_103527292 | 3300032263 | Sediment | MTRELFAGFFITLAFVAVVLVVLFGIFTLVSYLAGPVGG |
| Ga0315270_100849804 | 3300032275 | Sediment | MKARGLFAGFFQTLVFFLAAAVLLFGIFTLVGFLAGPVGG |
| Ga0316188_103643114 | 3300032276 | Worm Burrow | AHMTRELFAGFFITLAFVAVVLVVLFGIFTLVSYLAGPVGG |
| Ga0315286_103264522 | 3300032342 | Sediment | MAKQFFGGLFVTLAFAAGVLAALFGIFTLVSYLAGPVGG |
| Ga0315287_113312341 | 3300032397 | Sediment | MAKQFLGGFFATLGFVAVILAALFGIFTLVSYIAGPVGG |
| Ga0315275_104039901 | 3300032401 | Sediment | MAKQFFGGLFITLAFAAGVLVALFGIFTLVSYLAGPVGG |
| Ga0316226_100097812 | 3300032562 | Freshwater | MAKQFFWGMLITLAFVAVVTVGLLGIFTLVSYLTGPVGG |
| Ga0316232_13453742 | 3300032605 | Freshwater | TSLREREHSMARQFFWGMFITLAFVAVVTVGLLGIFTLVSYLTGPVGG |
| Ga0335082_100919693 | 3300032782 | Soil | MGGVAKGFFQTLLFMIVVAAVLFGIFTLVSYLAGPVGG |
| Ga0335071_101103413 | 3300032897 | Soil | MVLKGFFQTLIFMIVVLVVLFGIFTLVSYLAGPVGG |
| Ga0335071_121106691 | 3300032897 | Soil | MGAVARGFLQTLFFMIVVAVVLFGIFTLVSYLAGPVGG |
| Ga0316625_1005807283 | 3300033418 | Soil | MKTREMFAGFFSTLAFFVVAAALLFGIFTLVSYLAGPVGG |
| Ga0316616_1006422733 | 3300033521 | Soil | MARQFFVALFMTLAFAVVVLGALFGIFTLVSYLAGPVGG |
| Ga0314872_035165_387_500 | 3300033810 | Peatland | MKTRGLFAGFFSTLAFVVIVLAVLFGIFTLVSYWAGPV |
| Ga0370479_0021665_428_550 | 3300034123 | Untreated Peat Soil | MMTRGLFAGFFSTLAFVVIVLAVLFVIFTLVSYWAGPVGG |
| ⦗Top⦘ |