NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F060565

Metagenome Family F060565

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060565
Family Type Metagenome
Number of Sequences 132
Average Sequence Length 77 residues
Representative Sequence MVIIKADLLPEKEEILNEMSLLLERVTPSSKVLIDNLKFHTKSRSRFGLLSTTYLIAQRFSLLELQISYLRCPYDIQK
Number of Associated Samples 7
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 61.90 %
% of genes near scaffold ends (potentially truncated) 43.94 %
% of genes from short scaffolds (< 2000 bps) 94.70 %
Associated GOLD sequencing projects 4
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (71.970 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave
(78.030 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(100.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 59.43%    β-sheet: 0.00%    Coil/Unstructured: 40.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF00078RVT_1 1.52
PF00075RNase_H 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.00 %
UnclassifiedrootN/A25.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003850|Ga0058695_1014091All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha635Open in IMG/M
3300006020|Ga0058704_10083909All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1670Open in IMG/M
3300006020|Ga0058704_10098316All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1553Open in IMG/M
3300006020|Ga0058704_10142745All Organisms → Viruses → Riboviria → Pararnavirae → Artverviricota → Revtraviricetes → Ortervirales → Caulimoviridae → Caulimovirus1307Open in IMG/M
3300006020|Ga0058704_10157224All Organisms → Viruses → Riboviria → Pararnavirae → Artverviricota → Revtraviricetes → Ortervirales → Caulimoviridae1248Open in IMG/M
3300006020|Ga0058704_10173258All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1193Open in IMG/M
3300006020|Ga0058704_10181260All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1168Open in IMG/M
3300006020|Ga0058704_10212323All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1084Open in IMG/M
3300006020|Ga0058704_10213737All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1080Open in IMG/M
3300006020|Ga0058704_10238542All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1025Open in IMG/M
3300006020|Ga0058704_10250305Not Available1001Open in IMG/M
3300006020|Ga0058704_10257922All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha987Open in IMG/M
3300006020|Ga0058704_10268156All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha969Open in IMG/M
3300006020|Ga0058704_10300100All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha917Open in IMG/M
3300006020|Ga0058704_10311261All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha901Open in IMG/M
3300006020|Ga0058704_10321343All Organisms → Viruses → Riboviria → Pararnavirae → Artverviricota → Revtraviricetes → Ortervirales → Caulimoviridae887Open in IMG/M
3300006020|Ga0058704_10326434All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha880Open in IMG/M
3300006020|Ga0058704_10336084All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha867Open in IMG/M
3300006020|Ga0058704_10337322All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha865Open in IMG/M
3300006020|Ga0058704_10392840All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha803Open in IMG/M
3300006020|Ga0058704_10414398All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter indicus781Open in IMG/M
3300006020|Ga0058704_10417369All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha779Open in IMG/M
3300006020|Ga0058704_10425188Not Available772Open in IMG/M
3300006020|Ga0058704_10442683All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha756Open in IMG/M
3300006020|Ga0058704_10465996Not Available737Open in IMG/M
3300006020|Ga0058704_10485183All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha722Open in IMG/M
3300006020|Ga0058704_10492206All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha717Open in IMG/M
3300006020|Ga0058704_10494690All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha715Open in IMG/M
3300006020|Ga0058704_10509041All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha705Open in IMG/M
3300006020|Ga0058704_10517648All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha699Open in IMG/M
3300006020|Ga0058704_10519452All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha697Open in IMG/M
3300006020|Ga0058704_10529295All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha691Open in IMG/M
3300006020|Ga0058704_10543238All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha682Open in IMG/M
3300006020|Ga0058704_10546550All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha679Open in IMG/M
3300006020|Ga0058704_10555801All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha674Open in IMG/M
3300006020|Ga0058704_10582481All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha658Open in IMG/M
3300006020|Ga0058704_10625917Not Available634Open in IMG/M
3300006020|Ga0058704_10657650All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha618Open in IMG/M
3300006020|Ga0058704_10672695All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha610Open in IMG/M
3300006020|Ga0058704_10674500Not Available610Open in IMG/M
3300006020|Ga0058704_10680470All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha607Open in IMG/M
3300006020|Ga0058704_10715719All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha591Open in IMG/M
3300006020|Ga0058704_10716850All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha590Open in IMG/M
3300006020|Ga0058704_10760403Not Available572Open in IMG/M
3300006020|Ga0058704_10786115All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha563Open in IMG/M
3300006020|Ga0058704_10804718All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha556Open in IMG/M
3300006020|Ga0058704_10813197All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha553Open in IMG/M
3300006020|Ga0058704_10821329Not Available550Open in IMG/M
3300006020|Ga0058704_10841748All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha543Open in IMG/M
3300006020|Ga0058704_10842107All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha542Open in IMG/M
3300006020|Ga0058704_10844891All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha542Open in IMG/M
3300006020|Ga0058704_10847390Not Available541Open in IMG/M
3300006020|Ga0058704_10899578Not Available524Open in IMG/M
3300006020|Ga0058704_10959004Not Available506Open in IMG/M
3300006020|Ga0058704_10966168All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha504Open in IMG/M
3300006020|Ga0058704_10983925All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha500Open in IMG/M
3300009040|Ga0058703_1325893Not Available561Open in IMG/M
3300027809|Ga0209574_10077020Not Available906Open in IMG/M
3300027809|Ga0209574_10086495All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha868Open in IMG/M
3300027809|Ga0209574_10087706All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha864Open in IMG/M
3300027809|Ga0209574_10102225All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha817Open in IMG/M
3300027809|Ga0209574_10148996All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha712Open in IMG/M
3300027809|Ga0209574_10168592All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha680Open in IMG/M
3300027809|Ga0209574_10197690All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha641Open in IMG/M
3300027809|Ga0209574_10220077All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha616Open in IMG/M
3300027809|Ga0209574_10327972All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha529Open in IMG/M
3300027809|Ga0209574_10331172All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha527Open in IMG/M
3300027809|Ga0209574_10357810All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha511Open in IMG/M
3300027809|Ga0209574_10367717Not Available506Open in IMG/M
3300027809|Ga0209574_10374162Not Available503Open in IMG/M
3300030497|Ga0268252_1132549All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha649Open in IMG/M
3300030501|Ga0268244_10028935All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha2160Open in IMG/M
3300030501|Ga0268244_10111245All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1250Open in IMG/M
3300030501|Ga0268244_10149493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1106Open in IMG/M
3300030501|Ga0268244_10198456All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha981Open in IMG/M
3300030501|Ga0268244_10212739All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha952Open in IMG/M
3300030501|Ga0268244_10226844All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha926Open in IMG/M
3300030501|Ga0268244_10227004All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha926Open in IMG/M
3300030501|Ga0268244_10230397All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha920Open in IMG/M
3300030501|Ga0268244_10232055All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha917Open in IMG/M
3300030501|Ga0268244_10237764Not Available907Open in IMG/M
3300030501|Ga0268244_10258962All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha874Open in IMG/M
3300030501|Ga0268244_10270383Not Available858Open in IMG/M
3300030501|Ga0268244_10273173All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha854Open in IMG/M
3300030501|Ga0268244_10276629All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha850Open in IMG/M
3300030501|Ga0268244_10281304Not Available843Open in IMG/M
3300030501|Ga0268244_10283165All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha841Open in IMG/M
3300030501|Ga0268244_10284827All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha839Open in IMG/M
3300030501|Ga0268244_10288446All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha834Open in IMG/M
3300030501|Ga0268244_10288556All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha834Open in IMG/M
3300030501|Ga0268244_10316756All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha800Open in IMG/M
3300030501|Ga0268244_10344796All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha771Open in IMG/M
3300030501|Ga0268244_10354155All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha762Open in IMG/M
3300030501|Ga0268244_10362828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha753Open in IMG/M
3300030501|Ga0268244_10386220All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha733Open in IMG/M
3300030501|Ga0268244_10405276Not Available717Open in IMG/M
3300030501|Ga0268244_10430994All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha697Open in IMG/M
3300030501|Ga0268244_10440599Not Available690Open in IMG/M
3300030501|Ga0268244_10442651All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha689Open in IMG/M
3300030501|Ga0268244_10465055All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha674Open in IMG/M
3300030501|Ga0268244_10481358Not Available663Open in IMG/M
3300030501|Ga0268244_10510815All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha645Open in IMG/M
3300030501|Ga0268244_10585262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha606Open in IMG/M
3300030501|Ga0268244_10608801All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha595Open in IMG/M
3300030501|Ga0268244_10616667All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha592Open in IMG/M
3300030501|Ga0268244_10622258Not Available589Open in IMG/M
3300030501|Ga0268244_10638191All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha582Open in IMG/M
3300030501|Ga0268244_10642689All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha580Open in IMG/M
3300030501|Ga0268244_10667247All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha570Open in IMG/M
3300030501|Ga0268244_10672524All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha568Open in IMG/M
3300030501|Ga0268244_10676676Not Available566Open in IMG/M
3300030501|Ga0268244_10689747All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha561Open in IMG/M
3300030501|Ga0268244_10705726All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha555Open in IMG/M
3300030501|Ga0268244_10714907Not Available552Open in IMG/M
3300030501|Ga0268244_10734860All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha545Open in IMG/M
3300030501|Ga0268244_10753749All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha538Open in IMG/M
3300030514|Ga0268253_10053681Not Available1066Open in IMG/M
3300030514|Ga0268253_10068112Not Available974Open in IMG/M
3300030514|Ga0268253_10068780Not Available970Open in IMG/M
3300030514|Ga0268253_10094195All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha860Open in IMG/M
3300030514|Ga0268253_10095153All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha857Open in IMG/M
3300030514|Ga0268253_10206556Not Available641Open in IMG/M
3300030514|Ga0268253_10281964All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha569Open in IMG/M
3300030514|Ga0268253_10306188All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha552Open in IMG/M
3300030514|Ga0268253_10333217All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha534Open in IMG/M
3300030514|Ga0268253_10344999All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha527Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave78.03%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave21.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003850Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rzHost-AssociatedOpen in IMG/M
3300006020Agave microbial communities from Guanajuato, Mexico - Mg.Sf.eHost-AssociatedOpen in IMG/M
3300009040Agave microbial communities from Guanajuato, Mexico - Mg.Ma.eHost-AssociatedOpen in IMG/M
3300027809Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300030497Agave microbial communities from Guanajuato, Mexico - Mg.Sf.rz (v2)Host-AssociatedOpen in IMG/M
3300030501Agave microbial communities from Guanajuato, Mexico - Mg.Sf.e (v2)Host-AssociatedOpen in IMG/M
3300030514Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0058695_101409113300003850AgaveMVIIKADLLPEKEEILNEMPILLERVTPSSKVLIDNLEFHTKSRSRFGLLSTTYLIAQRFSLLELQISYLRCPYDIQEKISSHIQE
Ga0058704_1008390953300006020AgaveMGIIEIDLLAKKEEILNEMPLLLERVTPSRKVLIDNLKFHTKSKSRFGLLPTAYLIAQRFSLIKLQISYFQCPYDIKEKISSHV*
Ga0058704_1009831623300006020AgaveMVIIKADLLPEKEEILNEMSFLLERVTPSSKVLIDNLEFHTKSKSHFGLLSTACLVTQRFSLLQLQISYLQCPYDIQEKNKFSCSRK*
Ga0058704_1014274533300006020AgaveMMIIRAKLLPEKEETQNEMSLVLEWVSPSNKILIDNLEFHAKSRLHFGMLSSACLIAQNFSLLELQINY
Ga0058704_1015722433300006020AgaveMVIINTNLLSEKEEILNEMSILLERVTPSSKVLIDNLEFHTKSRSRFGLLSTTYLIAQRFFLLELQISYLRCPYDIQEKIRSHIQEKWFKEWYA
Ga0058704_1017325813300006020AgaveMVIIKAYLLPEKEKILNEMPLLLERVTPSSKVLIDNLEFHTKSVLCLGLLFTAYLIAQRFSLLELQVNYLQCPYEIQEKNKFSCPRKMVQ*
Ga0058704_1018126023300006020AgaveVIIKADLLSEKEEILNEMPILLERVTPSSKVLIDNLEFHTKTRSCFGLLSTAYLIAQRFSLMELQISYLQCPYDIQEKISSHV*
Ga0058704_1021232323300006020AgaveMVIIRVELLSDKDEVHNEMSLLLERVFSSSKVLIDNLEFHTKGISCFDLLSFAYLIAQRFSLLELQVNYLTYPYDI*
Ga0058704_1021373713300006020AgaveKEEILNEMPTLLEWVTPSSKILIDNPEFHTNTRSCFGLLSIAYLTAQRFSILELQISYLQCPYDIQEKISS*
Ga0058704_1023854243300006020AgaveIIKADLLLEKEEIYNEMSFTERVSPFSKILIDNLEFHTKNISHFGLLSLAYLITQRFFLLELQVNYLRCPYVIKEKINSHIQEK*
Ga0058704_1025030523300006020AgaveVIIKADLLPEKEEILNEMPLLLEQITPSGKILIDNLEFHTKSISQFGLLSTTYLITQRFFLLELQISYLRCPY
Ga0058704_1025792223300006020AgaveLLLEKEEIQNKMPLLLEQVSFSSKVLIDNLKFHTKSKSRSGLLFSAYLIAQRFFLLELQINYRKCPHNIQEKWFNE*
Ga0058704_1026815613300006020AgaveMVIIKADLLPEKEEIVNEMSFLLERVTPSSKVLIDNLEFHTKSRSRFGLLSTAYLIVQRFSLLELQLSYLQCPYEIQEKISSHIQEK*
Ga0058704_1026929213300006020AgaveDSLTRKLANGDHQNDLLPETEEILNELPLLLELVTPSSKILIDNLKFHTKSRSRFGILSTAYLIAQRFSLLEL*
Ga0058704_1029890633300006020AgaveVIIQADILAEKEEILNEMSILLERVTPSSKVLIDNLEFHTKSRSRFGLLSTAYLIA*
Ga0058704_1030010023300006020AgaveMVIIKVELLQEKKEIHNEMSLLLERVTPSSKVFIEKGRSRFGLLSSTYLIAQRFFLLKLQVNYLRRPYDIQEK*
Ga0058704_1031126133300006020AgaveMVIIKSSLLLEKEEILNEMSFMLERIMHSSKVLIEKPEFYTKNISCFGRISTACLITQRFFLLELQVSYLQCLYDIQEKISSYIREKWFNE*
Ga0058704_1032134313300006020AgaveMVIIKADLLSENEEILNEMSVLLQRVTHSSKVLIDNLEFHTKSRSHFCLLSTAYLIVQRFSLLELQISYL
Ga0058704_1032643423300006020AgaveMVIIKADLLPEKKETLNEMPSLLERVTPSSKVLIDNLEFHTKSRSRFDLLSTAYLIAQRFSLLDLQISYLQCPYDI*
Ga0058704_1033608413300006020AgaveMSVLIVIIIAELLPKKEEIQNEMLLLLLRVSPSNRIFVDILEFHTKSRLRFGLLSSGYVIVQRFSLLVLQMNYPRCP*
Ga0058704_1033732213300006020AgaveMVIIKADLLPEKEEILNEMPLLLERVTPSSKILIDNLEFNTKSRSRFGLLSTTYLIAQRFFLLELQISYIRCLYDIQEKISSHI*
Ga0058704_1039284013300006020AgaveMVIIKADLLLIKKEIHNEMPFILEWVSPSSKVLIDNLEFHIKGRSRFGLLSSTYLIAQRFSLLELQVNYLRGHYDIQEKISSHVQEKWFNE*
Ga0058704_1041439813300006020AgaveMVIIKVDLLPKKEEIFNEMPLLLERVTPSNKVLIDNLKFHTKSGSRFGLLSITYLIAQRFFLLELQISYLRCPYDIQEKISSH
Ga0058704_1041736943300006020AgaveMVIIKAKLLSKKEKIQNEIPPLLEQVSPFGGIYVDVLEFHTKRISCFGLLSSAYLIAQSFSLLELQMNYLRCP*
Ga0058704_1042518823300006020AgaveVIIKADFLPKNEKVLNEMSLLLERVSPYSKVVIDNLEFHTKSRSHFGLLSTVYLIAQRFPLLELLINYQQCSYDI*
Ga0058704_1044268323300006020AgaveVIIRAELLPEKEKIHNEMSLLLEQVIPPSKVLIDTLEFHTKSRSCFGLLSSAYLIAQRFSLLKLQGNYLRCPCDIQEKNKLLCPREMVQ*
Ga0058704_1046599623300006020AgaveMVIIKANLLPEKEEILNEMPFLLERVTPSSKVLIENLEFYIKSRSHFDLLSVAYLIMQRFFLLELQANYFKCPYD
Ga0058704_1048518323300006020AgaveMVISKADLLPEKEEILNDKPFLLERVMPSSKVLIDNLQFHTKSRSRFDLLSTTDLIAQRLSLLELQVSYL*
Ga0058704_1049220613300006020AgaveMVIIKVDLVSEKEEIHNEMPLLLEWVLPYSKVLIDNLEFHTKSRSHVGLLSSAYLIAQRFFLLELQVNYLRCPYDIQEKIS
Ga0058704_1049469023300006020AgaveMIIKANLLPEKKEILNEMSFLLEQITPSSKVLIDNLEFYTKSRSHFGLLSIAYLIAQRFSFLELQVSYLQCSYDIQEK*
Ga0058704_1050904123300006020AgaveMIINADLLPENEEIHNEMTFLLEQISPSSKVLTDNLEFHAKRRLRFGLLSSAYLIVQRFFLLKL*
Ga0058704_1051764823300006020AgaveMVITRAELLVEKEGIHNKMPLLQELVTPSGKVLIDNLEFHLKSRLCFGLLSSAYLIAQRFSLLELQVNYL*
Ga0058704_1051945223300006020AgaveMVIIKADLLPENEKILNEMPILLERATPSNKVLIDNLEFHTKSRSRFGLLSTTYLIAQRFSLLELQISYLRCPYDIQEK*
Ga0058704_1052929523300006020AgaveMVIIKADLLSEKKKIHNEMPFLLERVSPSNKVLTDNLEFHIKGRSRFGQLSSAYLISQRFALLELQVNCLRCPYDIQEKISSHV*
Ga0058704_1054323823300006020AgaveMVIIKSDLLPEKEEILNEMPVILERVTLSCKVLIDNLEFHTKSRSRFGLLSTAYLIAQ
Ga0058704_1054655013300006020AgaveNSPMVIIKADLLPEKEEILNEMPILLERVTPSSKVLIDNLEFHTKSRSRFGLLSTTYLIAQRFSLLELQISYLRCPYDIQEKIRSHIQEKWFKE*
Ga0058704_1055580113300006020AgaveVVIIKADLLPEKEEIHNEMTFILEWVSPFSKVLIDNLEFHIKDRSRFGLLSSTKLIAQRFSVLELQVNYLRCPSDIQEKKKLSYSRKMVQ*
Ga0058704_1058248123300006020AgaveMVIIKADLLPENEEILNEIPFLLERGTPSSNVLIDNLEFHNESRSHFGLLSTAYLIAQRFFLLELHLSYLQCPHDIQEKKSSHVQEKWFNE*
Ga0058704_1062591713300006020AgaveMVIIKADLLLEKEEILSEMLLLLERVSPSSKVLIENLEFYTKSRSHFGLLSTVYLISQRFSLLELQVNYLKCPYD
Ga0058704_1065765013300006020AgaveMVIIKADLLLEKEEILNEMSFLLERVSPSSKVLIDILEFHIKSRSRFGLLSTAYLIAQRFSLLGLQVS
Ga0058704_1067269513300006020AgaveMVIIKADLLPEKEEILNEMSILLERVTPSSKVVIDNLEFHVKSRSRFGLLSTAYLIAQRFSLLELQVSYLQCPCDIQEKVSSHVRENGSKSGM*
Ga0058704_1067450013300006020AgaveMVIIKDDLLPEKDEILNEMLILLERVAPSSKVLINNLEFHTKTRSCFGLLSTAYLIAQRFFLLELQISYLLCSYNI*
Ga0058704_1068047023300006020AgavePEKEKILNEMRFLLERAMPSSEVLIDNLGFHTKSRSCFGLLSTAYLIAQIFFLLELQINYLQYPYDIQEKISSHVRKIVQ*
Ga0058704_1071571923300006020AgaveMMIIQAEFLSKKEEIHNEMPLLLERVSPSSRVLIDNLEFHTKSRSRFGLLSSAYLITQRFSLLQLQVNCLRCPCDIQEKISFHVKEK*
Ga0058704_1071685013300006020AgaveLNEMSFLLERVSPSSRILIDNLEFYTKSRSRFGLLSTAYLIAQRFFLLELQVNYLRCLYDIQEKISSHIQEKWLNE*
Ga0058704_1076040313300006020AgaveMVIIKADLLPEKEEILNEMSFLPEWVTHSGKVLIDNPESHTKSRSRFGLLSPAYLITQRFSLLELQISYL
Ga0058704_1078611513300006020AgaveMVIIKADLLSKKEEIRNEMPLLLERVTTSSKVLIDNLKFHTKSRSRFGLLSTTYLIAQRFSLLELQ
Ga0058704_1080471823300006020AgaveMVIIKADLLSEKEEILNEMSLLLEWVMPSNKVLIDNLEFHTKSRSRFGLLSTTYLMAQRFPLLKLQISYLQCPYDIQEKINSHIQEKWFKE*
Ga0058704_1081319713300006020AgaveNSPMVIIKADLLPENEEILNEMPLLLERVIPSSKVLIDNLEFHTKSRSHFGLLSTTYLIAQRFFLLELQISYLRCPYDIQEK*
Ga0058704_1082132923300006020AgaveMVIIKSDFLPKKQEIFNEMSFLLERVAPSSKVLINNLEFHKKSCSHFRLLSTIYLIARRFSLLELQISYLQCPY
Ga0058704_1084174823300006020AgaveMVIIKADLLPENEEIFNEMPILLERVTPSSKVLINNLEFHTKTRSRFGLLSTAYLIAQRFSLLELQIGYL*
Ga0058704_1084210713300006020AgaveMVIIKADLLPEKEEILNEMPLLLERVTPSSKVLIDNLEFHAKSRSRFGLLSTTYLTTQRFSLLELQIN
Ga0058704_1084489113300006020AgaveMVIIKADLLPEKEEILNEMPLLLERVTPSSKVVIDNLEFHTKSRSRFGLLSTTYLIAQRFSLLELQISYLRCPYDIQEKISS
Ga0058704_1084739013300006020AgaveMVIIKADLLPEKDEIHSEIPLLLEQVTPSSKVLIDSLEFHTKSSSRFGLLSSAYLIAQRFSLLKLQVNYLRYPYDVQ*
Ga0058704_1089957813300006020AgaveMNSSTVIIRAELLAEKEEIQYEMSLLLAWVFPSTKVLIDNLEFHIKSRPRLGLLSSTYLKIQGFSLLVLQVNYLRYSY
Ga0058704_1093445123300006020AgaveMVIIKADLLSEKEEILNEMSLLLERIIPSSKVLIDNLEFHTKSRSRFGLLSITYLIAQ
Ga0058704_1095900413300006020AgaveMVIIKADLLPEKEEILNEMSILLERVTPSSKVLIDNLEFHTKRISRFGLLSTTYLIAQRFSLLELQISYLRCPYD
Ga0058704_1096616813300006020AgaveMVIIKAELLPEKEEILNEMSLLLERVTPSSKVLIDNLEFHRKSRSRFGLLSTTYLIAQRFSLLELQI
Ga0058704_1098392513300006020AgaveMMIIKADLLPKKEEILNEMSILLEPVMPSSKVLIDYLEFHTKSRSRFGLLSTTYLIAQRFFL
Ga0058703_132589313300009040AgaveNLLMVIIKVELLPENEEIQYEMTLPLERVTPSSKVLIDNLKFHIKSISCFGLLSSAYLIAQRFFPSRVTS*
Ga0209574_1007702013300027809AgaveMMIIKADLLLEKEEILNEMSFLLKRVMPFNKALIDNMEFRTKSELRFGLLSTAYLIAQRLGLQFNYLQCPYDIQEKISSHVRKK
Ga0209574_1008649523300027809AgaveMVIIKADLLPEKEEILNEMSLLLERVTPSSKVLIDNLKFHTKSRSRFGLLSTTYLIAQRFSLLELQISYLRCPYDIQK
Ga0209574_1008770623300027809AgaveMMIIKVGLLPEKEKILNEMPVLLERVTPTPSSKVLIDNLEFHTKSRSRFGVLSTAYLISQRFSLLELRVNYLQCP
Ga0209574_1010222513300027809AgaveMVIIQAVLLPEKEEINNEMPLLLEWDTPSSRGLIENLEFHIKSRSRFSLLSITYLITQRFFLLELQVNYLRCPYDIQE
Ga0209574_1014899613300027809AgaveMVIIKADLLPKKDEIHNEMSFLLERISPSSKVLTDNLKFHAKSRSRFGLLSSVYLIPQRFFPFIVTS
Ga0209574_1016859223300027809AgaveMMIIKADLLPQKEEILNEMPTLLEWVTPSSKILIDNPEFHTKTRSCFGLLSTAYLTAQRFSILELQISYLQCPYDIQEKISS
Ga0209574_1019769023300027809AgaveMVIIRAELLSEKEKIHEEMPILLERVSPSSKVLIDNLEFYTKSRSRFGLLSSAYLIAQRFSLLELQVNYLRCPYDI
Ga0209574_1022007723300027809AgaveMVIIKADLLAEKEEILNEMPLLLERFTPSSKVLIDNLEFHTKSRSRFGLLSTTYLIAQRFSLLELQI
Ga0209574_1032797213300027809AgaveMVIIKADLVPEKEEILNEMPFLLERVTPSSKVVIDNLEFHTKSRLRFDLLSTAYLIAQKISLLELQVSYLQCPY
Ga0209574_1033117213300027809AgaveMVIIKSDLLPEKEEILNEMSFLLEQITPSGKVLINNLEFHAKNRLHFGLLSTHYLIAQRFSLLELQVSYLQCPYDVQEKISSHI
Ga0209574_1035781013300027809AgaveMVIIKADLLPEKKEILNEMPVILEWVTPSSKVLIDNLKFHTKSRSHFGLLSTTYLIAQRFSLLQLQISYLQCPYNIQEKKS
Ga0209574_1036771713300027809AgaveVINKVELLLEQEEIHNEMPLLVERVTLSTKVLIDNLKFHTKIRSLFGLLSSAYLIAQRFSLVELQVNYLRYPYDIQEKISSHF
Ga0209574_1037416213300027809AgaveMAIIKADLLPEKEEILNEMPLLLERVIPSSKVVIDNLKCHTKSRSRFGLLSTTYLIAQRFSLLELKIS
Ga0268252_113254913300030497AgaveMVIIKAYLLPEKEEILNEMSFLLERVTPSIKVLIDNLEFHTKSRSRFGLLSTAYLIAQRFSLL
Ga0268244_1002893533300030501AgaveMVIIKADLLPEKEEILNEMSFLLERVTPSSKVLIDNLEFHTKSKSHFGLLSTACLVTQRFSLLQLQISYLQCPYDIQEKNKFSCSRK
Ga0268244_1011124533300030501AgaveMVIIKADLLPENEKILNEMPILLERATPSNKVLIDNLEFHTKSRSRFGLLSTTYLIAQRFSLLELQISYLRCPYDIQEK
Ga0268244_1014949313300030501AgaveVVIIKADLLPEKEEIHNEMTFILEWVSPFSKVLIDNLEFHIKDRSRFGLLSSTKLIAQRFSVLELQVNYLRCPSDIQEKKKLSYSRKMVQ
Ga0268244_1019845623300030501AgaveMVIIKTDLLPEKEKILNEMLFLLELLTPSSKVLIDNLEFHTKSRSRFGLLSTAYLIVQKFSLLELQISYLQCPYDI
Ga0268244_1021273913300030501AgaveMVIIKADLLLEKEEILNEMSFLLERVSPSSKVLIDILEFHIKSRSRFGLLSTAYLIAQRFSLLGLQVSYLQCPYD
Ga0268244_1022684423300030501AgaveMGIIEIDLLAKKEEILNEMPLLLERVTPSRKVLIDNLKFHTKSKSRFGLLPTAYLIAQRFSLIKLQISYFQCPYDIKEKISSHV
Ga0268244_1022700413300030501AgaveMVIIKVELLQEKKEIHNEMSLLLERVTPSSKVFIEKGRSRFGLLSSTYLIAQRFFLLKLQVNYLRRPYDIQEK
Ga0268244_1023039733300030501AgaveMVIIRVELLLEKKEIHIEIPLLLQRVSPSSKVLIDTKSRSCFGLLSSAYLIAQRFSLLELQVNYLRCPYDVQEKKSSHVQEKWFNEW
Ga0268244_1023205513300030501AgaveMVIIKADLLSEKEEIFNEIPVILEWVTPYSKILIDNLEFYTKSRSRFGLLSTAYLIAQRFFLLEL
Ga0268244_1023776413300030501AgaveMMIIKADLQPEKEEILNEIPFLIKRVTPSSKFLIDTIEFHTKSRSRFDLISTAYLIVQKFSLLELQVS
Ga0268244_1025896223300030501AgaveMVIIKADLLPEKEEILNEMPLLLERVTPSSKILIDNLEFNTKSRSRFGLLSTTYLIAQRFFLLELQISYIRCLYDIQEKISSHI
Ga0268244_1027038323300030501AgaveMVIIKDDLLPEKDEILNEMLILLERVAPSSKVLINNLEFHTKTRSCFGLLSTAYLIAQRFFLLELQISYLLCSYNI
Ga0268244_1027317313300030501AgaveLPEKEEILNEMSFLLEQITPSGKVLINNLEFHAKNRSHFGLLSTHYLIAQRFSLLELQVSYLQCPYDVQEKISSHI
Ga0268244_1027662913300030501AgaveMVIIRAELLQENEETHNEMPLPPEQVSLSSKILNDNLEFHTKSRSHFGMLSFAYLIAQRFFLLELQVNYLRCPYDR
Ga0268244_1028130413300030501AgaveVIIEADLLPEKEKVLNEMPFLLERVTPSSKVLIDNIELHTKSRSRFGILSTTYLIAQRFSLLELQISY
Ga0268244_1028316523300030501AgaveMVIIKAELLLEKEKIHNEMLLLLERATLPSKVLIVNLEFHIKSRSCFGALSSAYLIVQIFFLLELQVNYLRCPHDIQENISSHVQEKRFNE
Ga0268244_1028482713300030501AgaveMIIRAELLPEKEEIQNEITLLLERASPSNRIIMNILEFHTKSRSYFGLMSSAYLIIQRFIILELQMNYLKCPYDI
Ga0268244_1028844623300030501AgaveMVIIKVDLLPEKEEILNEMPLLLERVTPSSKVLIDNLEFHTKSRSRFSLLSTTYLIAQRFSLLEL
Ga0268244_1028855633300030501AgaveMVIIKADLLPEKKETLNEMPSLLERVTPSSKVLIDNLEFHTKSRSRFDLLSTAYLIAQRFSLLDLQISYLQCPYDI
Ga0268244_1031675623300030501AgaveMVIIKADLLPENEKILNEMSLLLERITPSSKVLIDNLEFHIKSRSRFGLLSTTYLIAQRFSLL
Ga0268244_1034479623300030501AgaveIIRAALLLEKEEIQNKMPLLLEQVSFSSKVLIDNLKFHTKSKSRSGLLFSAYLIAQRFFLLELQINYRKCPHNIQEKWFNE
Ga0268244_1035415513300030501AgaveMITQTELLSEKEEIHDKMPLLRERVTPSSKVLIDNLEFYAKSRSCFGLLSLAYLIAQRFSLLEL
Ga0268244_1036282813300030501AgaveMVIIKADLLPENEEILNEMPLLLERVTPFSKVLINNLEFHTKSRSRFCLLSTAYLIVQGFFLLDLQISYLQCPYDIQEKNKLSYLKKWFNEWYAACID
Ga0268244_1038622033300030501AgaveMVIIKADFLPEKEEIFNKIPFLSERVTPSCKVLSNNQEFHTKSRSRFGLLSTAYLIAQRFFLLKLQISYLQCPYDIQEKISYHVREKWFNEW
Ga0268244_1040527613300030501AgaveMVIITAALLLEKEEIHIEMPFLLERVTHSSKVLIDNLEFHTTSRLCFGLLSTAYLIAQRFSLLELQVNYLQYPYDIQKKKKFSCLRKMVQ
Ga0268244_1043099413300030501AgaveMVINKAALLPEKEEILNEMPFLLKWVTPSSKVLIDNLEFNAKSRSHFGLLSTAYLIAQRFFLLELQISCLQCPYDIQEKISSHIQEK
Ga0268244_1044059913300030501AgaveMVIIIAELLSAKEEIQYEMPLLLERVASSSKVLIDNWEFYIKSRLCFGFLSSTYLIIKRFSLLELQVNNLRCSY
Ga0268244_1044265113300030501AgaveNSPMVIIKADLLPEKEEILNEMSLLLERVTSSSKVLIDNLEFHAKSISHFGLLSTTYLIAQRFSF
Ga0268244_1046505513300030501AgaveMVIIKSSLLLEKEEILNEMSFMLERIMHSSKVLIEKPEFYTKNISCFGRISTACLITQRFFLLELQVSYLQCLYDIQEKISSYIREKWFNE
Ga0268244_1048135813300030501AgaveVIIKADLLLEKDEFHNEMLFLLELISPSSRVLLDNLEFHTKIRSRFGQLSTAYLITQRFSRLELQVNYLWCPYDIQEK
Ga0268244_1051081523300030501AgaveMVIIKADLLPEKEEIVNEMSFLLERVTPSSKVLIDNLEFHTKSRSRFGLLSTAYLIVQRFSLLELQLSYLQCPYEIQEKISSHIQEK
Ga0268244_1058526223300030501AgaveMVIIKADLLSEKEEILNEMSLLLEWVMPSNKVLIDNLEFHTKSRSRFGLLSTTYLMAQRFPLLKLQISYLQCPYDIQEKINSHIQEKWFKE
Ga0268244_1060880123300030501AgaveMVIIKADLLPEKEEILNEMPLLLERVTSSSKVLIDNLEFHAKSRSCFGLLSTTYLIAQRFFLLELQISYLRRPYD
Ga0268244_1061666713300030501AgaveIKADLLPEKEEIYNGMPFLLERVSPSSKVLIDNLEFHTKSRSRFGLLSTAYLIAEIFFLLELQVNYLRCPYDF
Ga0268244_1062225813300030501AgaveMVIIKADLLPKKDEIHNEMSFLLERIFPSSKVLTDNLKFHAKSRSRFGLLSSVYLIPQRFFLL
Ga0268244_1063819113300030501AgaveMAIIRAELLPTKEEIHNEMLLLLERVTPSSKVLTDNLEFHTKSRLYFGLLSSAYLIAQRFFLLELQVDYLRCPYDI
Ga0268244_1064268913300030501AgavePMLIIKADLRLEKEEILNEMSVLLERVTPSSKVLIDNLKFHIKSRSRFGLLSTAYVIAQRFFLLELQVNYLQRPYEIQEKKKFSC
Ga0268244_1066724713300030501AgaveVIIKVELLSENEKIYNQMPLLLERVSPSSKVLIDNLEFHTKSRLRFGLLSSAYLIAQRFSLLELQVNLP
Ga0268244_1067252423300030501AgaveMLIIKADLLPEKEEILNEMLVIIERVSPSSKVLIDNPEFHTKSRSHFGLLSTTYLIVQRFSLLELQISYLRCPYDIQE
Ga0268244_1067667623300030501AgaveMMIIKADLLPEKEEILNEMPILLERVTPSSKVLIDNLEFHTKSRSRFGLLSTTYLIAQRFSLLKLQISYLR
Ga0268244_1068974723300030501AgaveMVIIKADLLPENEEILNEIPFLLERGTPSSNVLIDNLEFHNESRSHFGLLSTAYLIAQRFFLLELHLSYLQCPHDIQEKKSSHVQEKWFNE
Ga0268244_1070572613300030501AgaveMVIIKADLLPEKKEILNEMPVILERVTPSSKVLIDSLEFHTKSRSRFGLLSTTYLIAQRFSLLELQISYLRCPYDIQKKISFHIQRK
Ga0268244_1071490723300030501AgaveMVIIKSDFLPKKQEIFNEMSFLLERVAPSSKVLINNLEFHKKSCSHFRLLSTIYLIARRFSLLELQISYLQCP
Ga0268244_1073486013300030501AgaveMIIIKIDLLSEKEEILNEMPFLLEQVTPSSKVLIDNLEFHTKSRSRFDILSIAYLIAQRFFLLELQVNYLQCPYDIQEKKISCLRKTVQ
Ga0268244_1075374923300030501AgaveMVIIKADLLPEKDEILNEIPLLLERVTPSSKVLIDNLEFHTKSRSHFGLLCITYLIAQRFSLMELQISYVRCPYDI
Ga0268253_1005368113300030514AgaveMVIIQAGLLLEKEEIHNEMTLLLERISPSRRILIDNMEFHTKNRLYFGLLSSAYQITQRFSLLELQI
Ga0268253_1006811223300030514AgaveMVIIQAVLLPEKEEINNEMPLLLEWDTPSSRGLIENLEFHIKSRSRFSLLSITYLITQRFFLLELQVN
Ga0268253_1006878023300030514AgaveMVIIKTNLLSEKEEIHNEMPFILERVSPSSKVLIKNLKFHIKGRSRFSLLSSTYLIAQGFSLLVLQVNYLRYPYDIQEKIG
Ga0268253_1009419513300030514AgaveVIIKADFLPEKEEILNEMSFLLERVTPSSKVLIDNLEFHTKCISHFGLLSTAYLIAQRFPLLELQVSYLQYPYDI
Ga0268253_1009515323300030514AgaveMVIIKADLVPEKEEIHNDMPLLLEWVSHSSEVRIDNLEFHTKSRSCFGLLSSAYLIAQRFSLLKLQVN
Ga0268253_1020655613300030514AgaveMVIIKVNLLPEKEKILNEMSILLERVTPSSNVLINNLEFYTKSRLHFGLLSTAYLIAQRFSLLELQVNY
Ga0268253_1028196413300030514AgaveMNSLTDSLTRELAIKVDLLPEKEKIFNEMSLLLERVAPSNKVLIDNLEFHTKSRLRFGILSTAFRITQRIFLLELQINYL
Ga0268253_1030618823300030514AgaveAILLENEEILNEMSFLLERVSLSSRVLNDKLEFHTKSRSSFGLLSTAHIIAQRFSLLEL
Ga0268253_1032169013300030514AgaveDLLPEKEEIYNGMPFLLERVSPSSKVLIDNLEFHTKSRSRFGLLSTAYLIAEIFFLLEL
Ga0268253_1033321713300030514AgaveINGDHQPEKEEILNEMPFLLEWVTLSSKVFIDNLEFHTKSRSRFGLLSTAYLMAQSFSLSELQVKYYKSCRRVTN
Ga0268253_1034499913300030514AgaveMVIIRAELLSEKKKIHNEMPLLLEQVTPSKVLIDDLEFYVKSRLRFGLLSSAYLIAQRFSLLELQVNYLRCPYDIQEKISSHV
Ga0268253_1036924523300030514AgaveMVITKADLFPEKEEILNKKLFLLERVTPSSKILIDNLEFHIKSTSCFGLLSTAYLITQRFSLIEL
Ga0268253_1037265613300030514AgaveMVIIVAEILLERAENQNEMLLLLKQVSPSSKILIDILKFHTKSRSSFGLLSFANLIMQRFSLLELQMNYLRCPYDMQEKISSHIQEKWFNKWYVTCIDCNHNYS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.