NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059980

Metagenome / Metatranscriptome Family F059980

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059980
Family Type Metagenome / Metatranscriptome
Number of Sequences 133
Average Sequence Length 42 residues
Representative Sequence MEEACKMGFSGGFEQGKPETALPELRRFIPVNTKRVNPQNKF
Number of Associated Samples 95
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.34 %
% of genes near scaffold ends (potentially truncated) 33.08 %
% of genes from short scaffolds (< 2000 bps) 80.45 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.241 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands
(12.030 % of family members)
Environment Ontology (ENVO) Unclassified
(32.331 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(28.571 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.00%    β-sheet: 0.00%    Coil/Unstructured: 80.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.22
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF02321OEP 51.13
PF00156Pribosyltran 6.02
PF01556DnaJ_C 4.51
PF01242PTPS 4.51
PF00005ABC_tran 3.76
PF07690MFS_1 1.50
PF00072Response_reg 0.75
PF13180PDZ_2 0.75
PF00291PALP 0.75
PF08239SH3_3 0.75
PF06808DctM 0.75
PF04020Phage_holin_4_2 0.75
PF06253MTTB 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 102.26
COG0484DnaJ-class molecular chaperone with C-terminal Zn finger domainPosttranslational modification, protein turnover, chaperones [O] 4.51
COG07206-pyruvoyl-tetrahydropterin synthaseCoenzyme transport and metabolism [H] 4.51
COG1950Uncharacterized membrane protein YvlD, DUF360 familyFunction unknown [S] 0.75
COG5598Trimethylamine:corrinoid methyltransferaseCoenzyme transport and metabolism [H] 0.75

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.24 %
UnclassifiedrootN/A3.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000242|TDF_OR_ARG05_123mDRAFT_1031594All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300001270|BBAY91_10073016All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria834Open in IMG/M
3300001687|WOR8_10000248All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria55809Open in IMG/M
3300001746|JGI24672J20091_10001203All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → unclassified Desulfosarcina → Desulfosarcina sp. BuS55836Open in IMG/M
3300003801|Ga0056138_1000747All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis6478Open in IMG/M
3300003989|Ga0055473_10029538All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1521Open in IMG/M
3300004000|Ga0055458_10173065Not Available642Open in IMG/M
3300004001|Ga0055450_10031450All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1754Open in IMG/M
3300004008|Ga0055446_10172081All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria633Open in IMG/M
3300004023|Ga0055441_10230979All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria523Open in IMG/M
3300004026|Ga0055443_10063638All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria976Open in IMG/M
3300004029|Ga0055442_10092200All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria892Open in IMG/M
3300004459|Ga0065201_1602566All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria568Open in IMG/M
3300005588|Ga0070728_10377384All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300005588|Ga0070728_10736049All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria504Open in IMG/M
3300005590|Ga0070727_10053548All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2418Open in IMG/M
3300005826|Ga0074477_1349841All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium857Open in IMG/M
3300005920|Ga0070725_10323944All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria680Open in IMG/M
3300005967|Ga0056128_1012208All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina10519Open in IMG/M
3300006467|Ga0099972_10270856All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1422Open in IMG/M
3300006467|Ga0099972_10440122All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria612Open in IMG/M
3300006467|Ga0099972_10637484All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria530Open in IMG/M
3300006467|Ga0099972_12188767All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis4532Open in IMG/M
3300006467|Ga0099972_12352692All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria843Open in IMG/M
3300007102|Ga0102541_1112477All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria801Open in IMG/M
3300007778|Ga0102954_1150026All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300008409|Ga0114885_10813All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae85567Open in IMG/M
3300008416|Ga0115362_100038836All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria811Open in IMG/M
3300009027|Ga0102957_1099070All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1015Open in IMG/M
3300009033|Ga0102956_1374105All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont503Open in IMG/M
3300009035|Ga0102958_1080955All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria991Open in IMG/M
3300009035|Ga0102958_1254960All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria599Open in IMG/M
3300009060|Ga0102962_1114983All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria756Open in IMG/M
3300009060|Ga0102962_1201868All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300009138|Ga0102959_1070418All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria996Open in IMG/M
3300009138|Ga0102959_1113554All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300009138|Ga0102959_1234400All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria601Open in IMG/M
3300009145|Ga0102961_1169328All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300009506|Ga0118657_10056377All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis5985Open in IMG/M
3300009506|Ga0118657_11031760All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1003Open in IMG/M
3300009509|Ga0123573_10018766All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis7802Open in IMG/M
3300009509|Ga0123573_10452815All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1225Open in IMG/M
3300010330|Ga0136651_10468397All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria616Open in IMG/M
3300010392|Ga0118731_100134854All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1347Open in IMG/M
3300010392|Ga0118731_102200794All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1177Open in IMG/M
3300010392|Ga0118731_103515734All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1173Open in IMG/M
3300010392|Ga0118731_107021664All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1880Open in IMG/M
3300010392|Ga0118731_107499379All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1022Open in IMG/M
3300010392|Ga0118731_107896856All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1385Open in IMG/M
3300010392|Ga0118731_109645394All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1048Open in IMG/M
3300010392|Ga0118731_109867061All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont672Open in IMG/M
3300010413|Ga0136851_11255711All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria716Open in IMG/M
3300010430|Ga0118733_100814288All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1862Open in IMG/M
3300010430|Ga0118733_103123983All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria905Open in IMG/M
3300010430|Ga0118733_103860489All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria807Open in IMG/M
3300011262|Ga0151668_1002115All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1363Open in IMG/M
3300011262|Ga0151668_1002120All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1469Open in IMG/M
3300013098|Ga0164320_10202830All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria918Open in IMG/M
3300013101|Ga0164313_10396075All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1153Open in IMG/M
3300017992|Ga0180435_10926792All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300019703|Ga0194021_1013743All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria748Open in IMG/M
3300019709|Ga0193967_1015602All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria790Open in IMG/M
3300019717|Ga0193972_1031725All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria611Open in IMG/M
3300019719|Ga0193977_1012008All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria913Open in IMG/M
3300019723|Ga0194004_1043348All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont587Open in IMG/M
3300019729|Ga0193968_1039364All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300019734|Ga0193970_1048577All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria577Open in IMG/M
3300019741|Ga0194020_1007720All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1078Open in IMG/M
3300019744|Ga0193998_1068664All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria547Open in IMG/M
3300019747|Ga0193978_1066604All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria548Open in IMG/M
3300019748|Ga0194018_1049495All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300021322|Ga0210330_1107435All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria811Open in IMG/M
3300021332|Ga0210339_1121710All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria893Open in IMG/M
3300021351|Ga0210365_10566313All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont557Open in IMG/M
3300021351|Ga0210365_10810165All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 14334Open in IMG/M
3300022201|Ga0224503_10097984All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria918Open in IMG/M
3300022202|Ga0224498_10050310All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300022206|Ga0224499_10022080All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae1983Open in IMG/M
3300022206|Ga0224499_10164311All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300022206|Ga0224499_10219746All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300022218|Ga0224502_10206944All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria754Open in IMG/M
3300022220|Ga0224513_10247951All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria704Open in IMG/M
3300022220|Ga0224513_10460538All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont517Open in IMG/M
(restricted) 3300024062|Ga0255039_10248898All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont751Open in IMG/M
(restricted) 3300024519|Ga0255046_10008416All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae3334Open in IMG/M
(restricted) 3300024529|Ga0255044_10455128All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont539Open in IMG/M
3300025554|Ga0210060_1095135Not Available536Open in IMG/M
3300025557|Ga0210141_1029305All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1055Open in IMG/M
3300025565|Ga0210110_1053842All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300025565|Ga0210110_1088286All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria741Open in IMG/M
3300025565|Ga0210110_1112778All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium647Open in IMG/M
3300025802|Ga0210111_1013239All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae2156Open in IMG/M
3300025883|Ga0209456_10336280All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria619Open in IMG/M
3300025895|Ga0209567_10058294All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1787Open in IMG/M
3300025895|Ga0209567_10321314All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria740Open in IMG/M
3300025995|Ga0210079_1062413All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium608Open in IMG/M
3300025995|Ga0210079_1082074All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont528Open in IMG/M
3300026007|Ga0210124_1177603All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300026106|Ga0209927_1026707All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria803Open in IMG/M
3300026133|Ga0209940_1048232All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria697Open in IMG/M
3300027098|Ga0209367_1008644All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae13900Open in IMG/M
3300027118|Ga0209454_1000192All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae35765Open in IMG/M
3300027540|Ga0209791_1000049All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria81829Open in IMG/M
3300027540|Ga0209791_1000484All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae13817Open in IMG/M
3300027599|Ga0209786_1000014All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria83804Open in IMG/M
3300027814|Ga0209742_10004090All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina5408Open in IMG/M
3300027917|Ga0209536_100055927All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae5150Open in IMG/M
3300027917|Ga0209536_100166215All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2780Open in IMG/M
3300027917|Ga0209536_100272815All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2118Open in IMG/M
3300027917|Ga0209536_100876301All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1110Open in IMG/M
3300027917|Ga0209536_101733079All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300027917|Ga0209536_101880199Not Available720Open in IMG/M
3300028599|Ga0265309_10701476All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria687Open in IMG/M
3300028883|Ga0272443_10186052All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1041Open in IMG/M
3300029827|Ga0134606_10174078All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont666Open in IMG/M
3300031256|Ga0315556_1277427All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria569Open in IMG/M
3300031359|Ga0307426_1012043All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae4356Open in IMG/M
3300031371|Ga0307423_1036090All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1723Open in IMG/M
3300031511|Ga0307424_1275217All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria515Open in IMG/M
3300031552|Ga0315542_1258770All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300032136|Ga0316201_10580496All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria959Open in IMG/M
3300032136|Ga0316201_10615886All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300032231|Ga0316187_11014969All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont608Open in IMG/M
3300032258|Ga0316191_10053676All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2982Open in IMG/M
3300032258|Ga0316191_10807645All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria679Open in IMG/M
3300032260|Ga0316192_10029520All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae3891Open in IMG/M
3300032262|Ga0316194_10517546All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria752Open in IMG/M
3300032276|Ga0316188_10530245All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont631Open in IMG/M
3300032276|Ga0316188_10698569All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria555Open in IMG/M
3300033429|Ga0316193_10313949All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1244Open in IMG/M
3300034782|Ga0373573_0202278All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria617Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands12.03%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine9.77%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment8.27%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil8.27%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment6.77%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment6.02%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow6.02%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment6.02%
Marine Gutless Worms SymbiontHost-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont4.51%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.01%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment2.26%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.26%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.26%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.26%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater2.26%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment2.26%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment1.50%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment1.50%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment1.50%
Marine Gutless Worms SymbiontHost-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont1.50%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine0.75%
SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Sediment0.75%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment0.75%
Marine Hydrothermal VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent0.75%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment0.75%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.75%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.75%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.75%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.75%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.75%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.75%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.75%
Marine SedimentEngineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Marine Sediment0.75%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000242Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3mEnvironmentalOpen in IMG/M
3300001270Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY91Host-AssociatedOpen in IMG/M
3300001687Deep Marine Sediments WOR-3-8_10EnvironmentalOpen in IMG/M
3300001746Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 2Host-AssociatedOpen in IMG/M
3300003801Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.1Host-AssociatedOpen in IMG/M
3300003989Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2EnvironmentalOpen in IMG/M
3300004000Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004001Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1EnvironmentalOpen in IMG/M
3300004008Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2EnvironmentalOpen in IMG/M
3300004023Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordA_D2EnvironmentalOpen in IMG/M
3300004026Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2EnvironmentalOpen in IMG/M
3300004029Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2EnvironmentalOpen in IMG/M
3300004459Marine microbial communities from Galveston Bay (MSEDA12C- fraction 11)EnvironmentalOpen in IMG/M
3300005588Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1EnvironmentalOpen in IMG/M
3300005589Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2EnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005826Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.186_BBAEnvironmentalOpen in IMG/M
3300005920Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2EnvironmentalOpen in IMG/M
3300005967Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus LIZARD ISLAND.2Host-AssociatedOpen in IMG/M
3300006467Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935EnvironmentalOpen in IMG/M
3300007102Combined Assembly of Marine Sediment Inoculum and EnrichmentsEngineeredOpen in IMG/M
3300007778Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MGEnvironmentalOpen in IMG/M
3300008409Coastal sediment microbial communities from intertidal sand flat, Janssand, Germany_1868_binCEnvironmentalOpen in IMG/M
3300008416Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC12BEnvironmentalOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300009033Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MGEnvironmentalOpen in IMG/M
3300009035Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MGEnvironmentalOpen in IMG/M
3300009060Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D2_MGEnvironmentalOpen in IMG/M
3300009138Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MGEnvironmentalOpen in IMG/M
3300009145Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MGEnvironmentalOpen in IMG/M
3300009314Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 900m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300009509Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11EnvironmentalOpen in IMG/M
3300010330Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaGEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010413Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300011262Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, totalEnvironmentalOpen in IMG/M
3300013098Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cmEnvironmentalOpen in IMG/M
3300013101Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cmEnvironmentalOpen in IMG/M
3300017992Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_1 metaGEnvironmentalOpen in IMG/M
3300019703Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_7-8_MGEnvironmentalOpen in IMG/M
3300019709Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_3-4_MGEnvironmentalOpen in IMG/M
3300019717Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_8-9_MGEnvironmentalOpen in IMG/M
3300019719Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_4-5_MGEnvironmentalOpen in IMG/M
3300019723Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_0-1_MGEnvironmentalOpen in IMG/M
3300019729Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_4-5_MGEnvironmentalOpen in IMG/M
3300019734Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_6-7_MGEnvironmentalOpen in IMG/M
3300019741Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_6-7_MGEnvironmentalOpen in IMG/M
3300019744Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_4-5_MGEnvironmentalOpen in IMG/M
3300019747Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_5-6_MGEnvironmentalOpen in IMG/M
3300019748Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_4-5_MGEnvironmentalOpen in IMG/M
3300021322Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.298 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021332Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021351Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.637 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022201Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21EnvironmentalOpen in IMG/M
3300022202Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21EnvironmentalOpen in IMG/M
3300022206Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24EnvironmentalOpen in IMG/M
3300022218Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13EnvironmentalOpen in IMG/M
3300022220Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300024529 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21EnvironmentalOpen in IMG/M
3300025554Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025557Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025565Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025802Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025883Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes)EnvironmentalOpen in IMG/M
3300025895Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025995Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026007Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026106Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D1_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026133Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027098Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus LIZARD ISLAND.2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027118Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus HERON ISLAND.1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027540Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027599Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ilvae ELBA.2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027814Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-8_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300028599Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300028883Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Acet-12EnvironmentalOpen in IMG/M
3300029827Marine sediment microbial communities from Barataria Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - M1047EnvironmentalOpen in IMG/M
3300031256Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-10EnvironmentalOpen in IMG/M
3300031359Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-40EnvironmentalOpen in IMG/M
3300031371Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-10EnvironmentalOpen in IMG/M
3300031511Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-20EnvironmentalOpen in IMG/M
3300031552Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-20EnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300032231Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1EnvironmentalOpen in IMG/M
3300032258Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cmEnvironmentalOpen in IMG/M
3300032260Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrowEnvironmentalOpen in IMG/M
3300032262Coastal sediment microbial communities from Maine, United States - Cross River sediment 1EnvironmentalOpen in IMG/M
3300032276Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1EnvironmentalOpen in IMG/M
3300033429Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2EnvironmentalOpen in IMG/M
3300034782Sediment microbial communities from coastal wetland in Texas, United States - D0606M02EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
TDF_OR_ARG05_123mDRAFT_103159423300000242MarineMEEACSMGFSGGFEQGKPETALPELIRFIPGNVRRVNPQNRFCCG*
BBAY91_1007301623300001270Macroalgal SurfaceMEEACSMGFSGGFEQGKPDTALPELKNVIPVKVKWVNPQNTIYRI*
WOR8_10000248203300001687Marine SedimentMEEAGLMGFSGGFGQGKPVTALPELECVISIIKERVNP*
JGI24672J20091_1000120343300001746Marine Gutless Worms SymbiontMEEAFIMGFSGGFEQGKPATALPELINSISIIIKRVNP*
Ga0056138_100074763300003801Marine Gutless Worms SymbiontMEEAFLMGFSGGFEQGKPATALPDLIDSISINIQRVNPKSAD*
Ga0055473_1002953823300003989Natural And Restored WetlandsMGFSGGFEQGKPDTALPELKNVIPVKVKGVNPQITFYRG*
Ga0055458_1017306523300004000Natural And Restored WetlandsMGFSGGFEQGKPATALPELDWFIPGNILQVNPKSAAITGRA*
Ga0055450_1003145023300004001Natural And Restored WetlandsMEEACFMGFSGGFEQGKPETALPELGRFIPVNAGRVNPQK*
Ga0055446_1017208123300004008Natural And Restored WetlandsMEEAGSMGFSGGFEQGKPETALPELIRFIPGNVKRVNPQNRFYCG*
Ga0055441_1023097913300004023Natural And Restored WetlandsACTMGFSGGFEQGKPETALPELRRFIPVNMKWVNPQNKFCYG*
Ga0055443_1006363823300004026Natural And Restored WetlandsMEEACTMGFSGGFEQGKPETALPELRRFIPVNMKWVNPQNKFCYG*
Ga0055442_1009220023300004029Natural And Restored WetlandsMEEACTMGFSGGFEQGKPETALPELRRFIPANMKRVNPQNKF*
Ga0065201_160256623300004459SedimentKKSPHLMEEACKMGLSGGFEQGKPETALPELKRLIPVNTKRVNPQNKF*
Ga0070728_1037738423300005588Marine SedimentMEEACSMGFSGGFEQGKPDTALPELKNVIPVKVKGVNPQNTFYRS*
Ga0070728_1073604923300005588Marine SedimentMEEACKMGFSGGFEQGKPETALPELRRFIPVNMKWVNPQNKFCYG*
Ga0070729_1051656023300005589Marine SedimentMEEAFLMGFSGGLEQGKPATALPELVNSISINKEGVNP*
Ga0070727_1005354833300005590Marine SedimentMEEACKMGFSGGFEQGKPETALPELKRSIPVNMKTVNPQNKFCCR*
Ga0074477_134984113300005826Sediment (Intertidal)MEEACSMGFSGGFEQGKPETALPELKKFIPVNMKKVNPLNKLCCG*
Ga0070725_1032394413300005920Marine SedimentKSLHLMEEACSMGFSGGFEQGKPDTALPELKNVIPVKVKGVNPQNTFYRS*
Ga0056128_101220833300005967Marine Gutless Worms SymbiontMEEAFLMGFSGGFEQGKPETALPELINSISTIIERVNP*
Ga0099972_1027085613300006467MarineSLHLMEEACSMGFSGGFEQGKPETALPELRRFIAVNVKRVNPQNKF*
Ga0099972_1044012213300006467MarineFDIKSLHLMEEACSMGFSGGFEQGKPETALPELRRFIPVNGKWVNPQNKFCCV*
Ga0099972_1063748413300006467MarineNNKKSPHLMEEACKMGFSGGFEQGKPETALPELRRFIPVNMPRVNPQNNF*
Ga0099972_1218876733300006467MarineMEEACSMGFSGGFEQGKPETALPELRRFIPVNVKWVNPQNRFCCS*
Ga0099972_1235269223300006467MarineMEEAFLMGFSGGFEQGKPAAALPELINFISINIEGVNP*
Ga0102541_111247713300007102Marine SedimentMEEAGSMGFSGGFEQGKPETALPELIRFIPGNVKRVNPQNRFCCG*
Ga0102954_115002613300007778WaterMEEACSMGFSGGFEQGKPETALPELKKFIPVNMKKVNPQNKICGR*
Ga0114885_10813493300008409SedimentMEEAFLMGFSGGFEQGKPATALPELINFISINIERVNP*
Ga0115362_10003883623300008416SedimentMEEAFLMGFSGGFEQGKPATALPELINSISINIEGVNP*
Ga0102957_109907013300009027Pond WaterSLHLMEEACFTGFSGGFEQGKPETALAELCRFIPVISGRVNPQK*
Ga0102956_137410513300009033SoilMEEACKMGLSGGFEQGKPETALPELKRFIPVNTKR
Ga0102958_108095523300009035SoilMEEACKMGLSGGFEQGKPETALPELKRFIPVNTKRVNPQNKF*
Ga0102958_125496013300009035SoilNIWKSLHLMEEACSMGFSGGFEQGKPEAALPELRRFIAVNVKRVNPQNKF*
Ga0102962_111498313300009060SoilSLHLMEEAGSMGFSGGFEQGNPETALPELIRFIPGNVKRVNSQNRFCCG*
Ga0102962_120186823300009060SoilMEEACSMGFSGGFEQGKPETALPELIRFIPGNVKR
Ga0102959_107041823300009138SoilSMGFSGGFEQGKPGTALPELKNVIPVKVKGVNPQNTFYRS*
Ga0102959_111355423300009138SoilMEEACSMGFSGGFEQGKPETALPELIRFIPGNVKRVNPQNRFCCG*
Ga0102959_123440023300009138SoilSMGFSGGFEQGKPETALPELIRFIPGNVKRVNPQNRFYCG*
Ga0102961_116932823300009145SoilMEEACSMGFSGGFEQGKPETALPELKKFIPVNMKKVNPQNKFCGR*
Ga0117908_100409993300009314MarineMEEACLMGFSGGSEQGKLETALLELKRYIPRKPVRVNLKEKVTL*
Ga0118657_1005637763300009506Mangrove SedimentMEEAFFMGFSGGFEQGKPATALPELIICISTKMEGVNP*
Ga0118657_1103176013300009506Mangrove SedimentMEEAFFMGFSGGFEQGKPATALPEVDCFIPGNILQVNP*
Ga0123573_1001876663300009509Mangrove SedimentMEEAVLMGFSGGFEQGKPATALPELMELISTNRNGVNP*
Ga0123573_1045281513300009509Mangrove SedimentMEEAFFMGFGGGFEQGKPATALPELVNFISIKIARVN
Ga0136651_1046839723300010330Marine Hydrothermal VentMEEAFIMGFSGGFEQGKPATALPGLSNFIPINIKRVNP*
Ga0118731_10013485413300010392MarineACSMGFSGGFEQGKPDTALPELKNVIPVKVKGVNPQNTFYRS*
Ga0118731_10220079423300010392MarineMEEACSMGFSGGFEQGKPETALPELRSFIPVNVKRVNPQN*
Ga0118731_10351573413300010392MarineKSPHLMEEACSMGFSGGFEQGKPETALPELRRFIPVNVKWVNPQNRFCCS*
Ga0118731_10702166423300010392MarineMEEACKMGLSGGFEQGKPETALPELRRFIPVNMKTVNPQNKFCCR*
Ga0118731_10749937923300010392MarineMEEACSMGFSGGFEQGKPETALPELRRFIAVNVKRVNPQNKF*
Ga0118731_10789685623300010392MarineEEACKMGFSGGFEQGKPETALPELRRFIPVNMPRVNPQNNF*
Ga0118731_10964539413300010392MarineMEEACKMGFSGGFEQGKPETALPELRRFIPANMKRVNPQNNF*
Ga0118731_10986706123300010392MarineMEEACKMGFSGGFEQGKPETALPELKRFIPVNMPRVNPQNKF*
Ga0136851_1125571113300010413Mangrove SedimentMEEALLMGFSGGFEQGKPATALPELDWFIPGNILQVNP*
Ga0118733_10081428813300010430Marine SedimentKPYIMGFSGGFEQGKPATALPELINFISINLERVNS*
Ga0118733_10312398313300010430Marine SedimentHLMEEACTMGFSGGFEQGKPETALPELRRFIPVNMSRVNPQNNF*
Ga0118733_10386048913300010430Marine SedimentMGFSGGFEQGKPETALPELKRFIPVNMKRVNPQNKF*
Ga0151668_100211513300011262MarineEACTMGFSGGFEQGKPETALPELKRFIPVNMKRVNPQNKFCCG*
Ga0151668_100212033300011262MarineEACSMGFSGGFEQGKPDTALPELKNVIPVKVKGVNPQNTFYRS*
Ga0164320_1020283023300013098Marine SedimentMEEAFIKGFSGGFEQGKPAMALPELSNFIPINIKRVNP*
Ga0164313_1039607523300013101Marine SedimentMEEACSMGFSGGFEQGKPETALPELRIPISIIIKSVN*
Ga0180435_1092679213300017992Hypersaline Lake SedimentMEEAGLMGFSGGFEQGKPDAALPELRSQIPVNAKRVNPQNRF
Ga0194021_101374323300019703SedimentMEEAGSMGFSGGFEQGKPETALPELIRFIPGNVKRVNPQNRFYCG
Ga0193967_101560213300019709SedimentMGFSGGFEQGKPETALPELIRFIPGNVKRVNPQNRFCCG
Ga0193972_103172523300019717SedimentMEEAGSMGFSGGFEQGKPETALPELIRFIPGNVKRVNSQNRFCCG
Ga0193977_101200813300019719SedimentMGFSGGFEQGKPETALPELKRLIPVNTKRVNPQNKF
Ga0194004_104334823300019723SedimentMEEACSMGFSGGFEQGKPETALPELIRFIPGNVKGVNPQNRFCCG
Ga0193968_103936423300019729SedimentMEEAGSMGFSGGFEQGKPETALPELIRFIPGNVKGVNPQNKF
Ga0193970_104857723300019734SedimentWNNKKSPHLMEEACKMGLSGGFEQGKPETALPELKRLIPVNTKRVNTQNKF
Ga0194020_100772023300019741SedimentMEEAGSMGFSGGFEQGKPETALPELKRLIPVNTKRVNPQNKF
Ga0193998_106866413300019744SedimentMEEAGSMGFSGGFEQGKPEAALPELRRFIAVNVKRVNPQNKF
Ga0193978_106660423300019747SedimentMEEACTMGFSGGFEQGKPETALPELIRFIPGNVKRVNPQNRFYCG
Ga0194018_104949513300019748SedimentMEEACSMGFSGGFEQGKPDTALPELRRFIAVNVKRVNPQNKF
Ga0210330_110743513300021322EstuarineDFDIKSLHLMEEACSIGFSGGCEQGKPETALPELRRVIPVNEKRVNPQNKFCCS
Ga0210339_112171013300021332EstuarineEACSMGFSGGFEQGKPETALPELKRFIPVNMKKVNPLNKLCCG
Ga0210365_1056631323300021351EstuarineMEEAFLTGFSGGFEQGKPATALPDLINSISINIERVNPKSADYTRAVGLDCA
Ga0210365_1081016533300021351EstuarineMEEACSMGFSGGFEQGKPGTALPELKRFIPVNMKKVNPQNKLCCG
Ga0224503_1009798413300022201SedimentMEEAYSMGFSGGFEQGKPDTALPELKNVIPVKVKGVNPQNTFYRS
Ga0224498_1005031033300022202SedimentMEEACSMGFSGGFEQGKPDTALPELKNVIPVKVKGVNPQNTFYRS
Ga0224499_1002208013300022206SedimentMEEACSMGFSGGFEQGKPETALPELRSFIPVNVKRVNPQN
Ga0224499_1016431123300022206SedimentMEEACSMGFSGGFEQGKPEAALPELRRFIAVNVKRVNPQNKF
Ga0224499_1021974623300022206SedimentMEEAGSMGFSGGFEQGKPETALPELIRFIPGNVKRVNPQNRFCCG
Ga0224502_1020694423300022218SedimentMEEACKMGLSGGFEQGKPETALPELKRFIPVNMKTVNPQNKFCCR
Ga0224513_1024795123300022220SedimentMEEAYSMGFSGGFEQGKPDTALPELKNVIPVKVKGVNPQNTF
Ga0224513_1046053823300022220SedimentMEEACKMGLSGGFEQGKPETALPELKRFIPVNTKRVNPQNKF
(restricted) Ga0255039_1024889823300024062SeawaterMEEAFLMGFSGGFEQGKPATALPELINFISINIERVNP
(restricted) Ga0255046_1000841643300024519SeawaterMEEACKMGFSGGFEQGKPETALPELKRSIPVNMKTVNPQNKFCCR
(restricted) Ga0255044_1045512823300024529SeawaterMEEAFIIGFSGGFEQGKPATALPELINSISIKIEWVNP
Ga0210060_109513523300025554Natural And Restored WetlandsMGFSGGFEQGKPATALPELDWFIPGNILQVNPKSAAITGRA
Ga0210141_102930523300025557Natural And Restored WetlandsMEEACSMGFSGGFEQGKPETALPELIRFIPGNVKRVNPQNRFYCG
Ga0210110_105384223300025565Natural And Restored WetlandsMEEAFLMGFSGGFEQGKPATALPELINFISINIKRVNP
Ga0210110_108828623300025565Natural And Restored WetlandsMEEAFCMGFSGGFEQGKPATALPELINCISTNIEGVNP
Ga0210110_111277823300025565Natural And Restored WetlandsMGFSGGFEQGKPDTALPELKNVIPVKVKGVNPQITFYRG
Ga0210111_101323943300025802Natural And Restored WetlandsMEEAFCMGFSGGFEQGKPATALPELINCISTNIEGV
Ga0209456_1033628013300025883Pelagic MarineKKSPHLMEEACKMGFSGGFEQGKPETALPELRRFIPVNMKRVNPQNNF
Ga0209567_1005829423300025895Pelagic MarineMEEACSMGFSGGFEQGKPETALPELRRFIPVNVKWVNLQNRFCCS
Ga0209567_1032131413300025895Pelagic MarineGGFEQGKPDTALPELKNVIPVKVKGVNPQNTFYRS
Ga0210079_106241323300025995Natural And Restored WetlandsMEEACKMGFSGGFEQGKPETALPELERFIPANIKRVNPQNKF
Ga0210079_108207413300025995Natural And Restored WetlandsMEEACKMGLSGGFEQGKPETALPELKRFIPVNTKRVNPQNKFXCGWEDGIY
Ga0210124_117760313300026007Natural And Restored WetlandsMEEAXSMGFSGGFEQGKPDTALPELKNVIPVKVKGVNPQITFYRGXEA
Ga0209927_102670713300026106SoilCKMGFSGGFEQGKPETALPELRRFIPVNMKWVNPQNKFCYG
Ga0209940_104823223300026133SoilHLMEEACSMGFSGGFEQGKPETALPELIRFIPGNVKRVNPQNRFCCG
Ga0209367_1008644113300027098Marine Gutless Worms SymbiontMEEAFLMGFSGGFEQGKPETALPELINSISTIIERVNP
Ga0209454_1000192153300027118Marine Gutless Worms SymbiontMEEAFVMGFSGGFEQGKPETALPELINSISTIIERVNP
Ga0209791_1000049413300027540Marine Gutless Worms SymbiontMEEAFLMGFSGGFEQGKPATALPDLIDSISINIQRVNPKSAD
Ga0209791_100048493300027540Marine Gutless Worms SymbiontMEEAFIMGFSGGFEQGKPATALPELINSISIIIKRVNP
Ga0209786_1000014503300027599Marine Gutless Worms SymbiontMEEAFIMGFSGGFEQGKPATALPELINSISIIVERVNP
Ga0209742_1000409053300027814Marine SedimentMEEAGLMGFSGGFGQGKPVTALPELECVISIIKERVNP
Ga0209536_10005592743300027917Marine SedimentMEEACKMGLSGGFEQGKPETALPELKRLIPVNTKRVNPQNKF
Ga0209536_10016621523300027917Marine SedimentMEEAVLMGFSGGFEQGKPAMALPELMELISTNRNGVNP
Ga0209536_10027281523300027917Marine SedimentMEEACSMGFSGGFEQGKPETALPELKRFIPGNVKRVNPLNRFYCG
Ga0209536_10087630113300027917Marine SedimentEEAFLMGFSGGFEQGKPATALPELTNFISINIARVNP
Ga0209536_10173307923300027917Marine SedimentMEEACSMGFSGGFEQGKPDTALPELKNVIPVKVNGVNPQITFYRS
Ga0209536_10188019923300027917Marine SedimentMEEACKMGLSGGFEQGKPETALPELRRVIPVNMNSVNSQ
Ga0265309_1070147623300028599SedimentAGSMGFSGGFEQGKPETALPELIRFIPGNVKRVNPQNRFCCG
Ga0272443_1018605223300028883Marine SedimentMEEAFLMGFGGGFEQGKPATALPELDCFLPGNILQVNP
Ga0134606_1017407823300029827Marine SedimentMEEAFFMGFSGGFEQGKPATALPELDWFIPGNNLQVNP
Ga0315556_127742713300031256Salt Marsh SedimentKPFIMGFSGGFEQGKPATALPGLDWFIAGNILEVNPKSAAISGRT
Ga0307426_101204353300031359Salt MarshLEEAFLMGFSGGLEQGKPATALPELDWFIPGNIFQVNP
Ga0307423_103609033300031371Salt MarshKSLHLMEEAFLMGFSGGLEQGKPATALPELDWFIPGNIFQVNP
Ga0307424_127521713300031511Salt MarshLEEAFLMGFSGGFEQGKPATALPELDGFIPGNILQVNP
Ga0315542_125877023300031552Salt Marsh SedimentMEEAFLMGFSGGFEQGKPATALPELAGYIPGNFLQVNPYPAAGTDLT
Ga0316201_1058049623300032136Worm BurrowMEEACSMGFSGGFEQGKPETALPELKRFIPVNVKWVNPQNEFCCG
Ga0316201_1061588623300032136Worm BurrowMEEAFLMGFSGGFEQGKPATALPELTNFISINIARVNP
Ga0316187_1101496913300032231Worm BurrowMEEACTMGFSGGFEQGKPETALPELKRFIPVNMKRVNPQNK
Ga0316191_1005367623300032258Worm BurrowMEEACTMGFSGGFEQGKPETALPELRRFIPANMKRVNPQNKF
Ga0316191_1080764523300032258Worm BurrowMEEACKMGFSGGFEQGKPETALPELRRFIPVNTKRVNPQNKF
Ga0316192_1002952053300032260Worm BurrowMEEACSMGFSGGFEQGKPETALPELIRFIPGNVKRVNPQNEFCCG
Ga0316194_1051754623300032262SedimentMEEAFLMGFSGGFEQGKPARALPELVNSISINIEGVNP
Ga0316188_1053024523300032276Worm BurrowMEEACTMGFSGGFEQGKPETALPELERFIPANIKRVNPQNKF
Ga0316188_1069856913300032276Worm BurrowMEEACSMGFSGGFEQGKPETALPELRRVIPVNVERVNPQNK
Ga0316193_1031394923300033429SedimentMEEAFIMGFSGGFEQGKPGSALPELIKSISTNIEGVNP
Ga0373573_0202278_467_5833300034782SedimentMEEASLMGFSGGFEQEKPMTALLELKALIPAKQIRVNP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.