| Basic Information | |
|---|---|
| Family ID | F059558 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 38 residues |
| Representative Sequence | RSQLLISSIKGEVKKKHISNGWTFSCFAAHLIEQDLF |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.11 % |
| % of genes near scaffold ends (potentially truncated) | 92.48 % |
| % of genes from short scaffolds (< 2000 bps) | 86.47 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.489 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.564 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.068 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.158 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.46% β-sheet: 0.00% Coil/Unstructured: 61.54% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 55.64 |
| PF01548 | DEDD_Tnp_IS110 | 0.75 |
| PF07883 | Cupin_2 | 0.75 |
| PF03729 | DUF308 | 0.75 |
| PF13620 | CarboxypepD_reg | 0.75 |
| PF13701 | DDE_Tnp_1_4 | 0.75 |
| PF04193 | PQ-loop | 0.75 |
| PF04986 | Y2_Tnp | 0.75 |
| PF04101 | Glyco_tran_28_C | 0.75 |
| PF13181 | TPR_8 | 0.75 |
| PF00990 | GGDEF | 0.75 |
| PF00691 | OmpA | 0.75 |
| PF00589 | Phage_integrase | 0.75 |
| PF00903 | Glyoxalase | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 56.39 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.49 % |
| Unclassified | root | N/A | 4.51 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000912|JGI12032J12867_1002694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
| 3300001086|JGI12709J13192_1004186 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
| 3300001164|JGI11823J13286_1004889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
| 3300001181|JGI12663J13571_100493 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100606735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101848440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300002718|JGI25454J38594_10007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10062544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300002917|JGI25616J43925_10299396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300005466|Ga0070685_10998746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300005602|Ga0070762_10682960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300009641|Ga0116120_1041152 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
| 3300010339|Ga0074046_10001168 | All Organisms → cellular organisms → Bacteria | 24185 | Open in IMG/M |
| 3300010359|Ga0126376_13045996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300010361|Ga0126378_13039101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300010362|Ga0126377_12423596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300012096|Ga0137389_11584898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300012582|Ga0137358_10195266 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300012582|Ga0137358_10340228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300012912|Ga0157306_10155092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300012915|Ga0157302_10161035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300012916|Ga0157310_10059120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1133 | Open in IMG/M |
| 3300012930|Ga0137407_10764920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300012957|Ga0164303_10805492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300015241|Ga0137418_10008567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9399 | Open in IMG/M |
| 3300015241|Ga0137418_10227835 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
| 3300015245|Ga0137409_10130186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2313 | Open in IMG/M |
| 3300017925|Ga0187856_1084066 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300018006|Ga0187804_10119534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
| 3300018057|Ga0187858_10243557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1156 | Open in IMG/M |
| 3300019866|Ga0193756_1017875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
| 3300019880|Ga0193712_1012192 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
| 3300019887|Ga0193729_1064138 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300020008|Ga0193757_1007553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1016 | Open in IMG/M |
| 3300020012|Ga0193732_1052793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300020140|Ga0179590_1015119 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
| 3300020170|Ga0179594_10152235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300020199|Ga0179592_10062285 | All Organisms → cellular organisms → Bacteria | 1703 | Open in IMG/M |
| 3300020579|Ga0210407_10552957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300020581|Ga0210399_10058498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3106 | Open in IMG/M |
| 3300020582|Ga0210395_10170506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1629 | Open in IMG/M |
| 3300020583|Ga0210401_10176062 | All Organisms → cellular organisms → Bacteria | 1994 | Open in IMG/M |
| 3300021086|Ga0179596_10058329 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
| 3300021170|Ga0210400_10197054 | All Organisms → cellular organisms → Bacteria | 1636 | Open in IMG/M |
| 3300021171|Ga0210405_10876640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300021178|Ga0210408_10192596 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
| 3300021180|Ga0210396_10107279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2523 | Open in IMG/M |
| 3300021307|Ga0179585_1131190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300021404|Ga0210389_10196445 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300021406|Ga0210386_10068106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2860 | Open in IMG/M |
| 3300021432|Ga0210384_10147566 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
| 3300021432|Ga0210384_10182712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1884 | Open in IMG/M |
| 3300021433|Ga0210391_10107952 | All Organisms → cellular organisms → Bacteria | 2192 | Open in IMG/M |
| 3300021474|Ga0210390_10006851 | All Organisms → cellular organisms → Bacteria | 9463 | Open in IMG/M |
| 3300021474|Ga0210390_10211556 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300021478|Ga0210402_10067014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3166 | Open in IMG/M |
| 3300021478|Ga0210402_10252466 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300021478|Ga0210402_10846518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300021559|Ga0210409_10230987 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
| 3300021559|Ga0210409_10414327 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300021559|Ga0210409_10438564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1165 | Open in IMG/M |
| 3300022557|Ga0212123_10170167 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
| 3300022840|Ga0224549_1005154 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
| 3300023263|Ga0247800_1076836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300024186|Ga0247688_1034875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300024284|Ga0247671_1052423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300025898|Ga0207692_10338176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300025898|Ga0207692_11068076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300025910|Ga0207684_10116187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2292 | Open in IMG/M |
| 3300025915|Ga0207693_10227533 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300025922|Ga0207646_10421516 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300025924|Ga0207694_11613316 | Not Available | 547 | Open in IMG/M |
| 3300025935|Ga0207709_11719570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300026294|Ga0209839_10035095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1881 | Open in IMG/M |
| 3300026355|Ga0257149_1004748 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
| 3300026480|Ga0257177_1043285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300026873|Ga0207620_1001351 | All Organisms → cellular organisms → Bacteria | 1719 | Open in IMG/M |
| 3300027050|Ga0209325_1005193 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300027122|Ga0207538_1001315 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300027178|Ga0207606_100070 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300027288|Ga0208525_1022301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300027397|Ga0207463_100716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
| 3300027403|Ga0207609_101734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300027411|Ga0207519_100094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1723 | Open in IMG/M |
| 3300027480|Ga0208993_1057889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300027535|Ga0209734_1101005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300027546|Ga0208984_1011845 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300027604|Ga0208324_1030610 | All Organisms → cellular organisms → Bacteria | 1621 | Open in IMG/M |
| 3300027625|Ga0208044_1003613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7054 | Open in IMG/M |
| 3300027633|Ga0208988_1028647 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300027643|Ga0209076_1026373 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300027671|Ga0209588_1033174 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
| 3300027671|Ga0209588_1034519 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300027671|Ga0209588_1073734 | Not Available | 1102 | Open in IMG/M |
| 3300027737|Ga0209038_10027728 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300027737|Ga0209038_10032899 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300027783|Ga0209448_10207966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300027821|Ga0209811_10235560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300027825|Ga0209039_10357272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300027829|Ga0209773_10062368 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300027829|Ga0209773_10104371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1171 | Open in IMG/M |
| 3300027846|Ga0209180_10113993 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
| 3300027855|Ga0209693_10371501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300027884|Ga0209275_10042166 | All Organisms → cellular organisms → Bacteria | 2156 | Open in IMG/M |
| 3300027889|Ga0209380_10627408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300027903|Ga0209488_10341110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1115 | Open in IMG/M |
| 3300028138|Ga0247684_1094057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300028145|Ga0247663_1044040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300028746|Ga0302233_10046185 | All Organisms → cellular organisms → Bacteria | 1797 | Open in IMG/M |
| 3300028776|Ga0302303_10049153 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
| 3300028798|Ga0302222_10111217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
| 3300028871|Ga0302230_10053869 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
| 3300028906|Ga0308309_10190309 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
| 3300029910|Ga0311369_10241151 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
| 3300029944|Ga0311352_10206585 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
| 3300030618|Ga0311354_10172568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2338 | Open in IMG/M |
| 3300030659|Ga0316363_10171781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
| 3300030935|Ga0075401_10042365 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300031128|Ga0170823_11567388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300031446|Ga0170820_12441072 | Not Available | 950 | Open in IMG/M |
| 3300031546|Ga0318538_10132395 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300031744|Ga0306918_10842030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300031754|Ga0307475_11219878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300031771|Ga0318546_10077608 | All Organisms → cellular organisms → Bacteria | 2136 | Open in IMG/M |
| 3300031947|Ga0310909_10676484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300032035|Ga0310911_10094588 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300032076|Ga0306924_10307598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1818 | Open in IMG/M |
| 3300032091|Ga0318577_10295986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300032180|Ga0307471_100394417 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300032783|Ga0335079_12072435 | Not Available | 546 | Open in IMG/M |
| 3300033289|Ga0310914_10475350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.29% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.26% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.26% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.01% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.26% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.50% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.75% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.75% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.75% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.75% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.75% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000912 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 | Environmental | Open in IMG/M |
| 3300001086 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 | Environmental | Open in IMG/M |
| 3300001164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 | Environmental | Open in IMG/M |
| 3300001181 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002718 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A5w-11 | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020008 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m2 | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026873 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A5-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027122 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A2-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027178 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A5-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027397 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027403 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A5-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027411 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A2-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030935 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12032J12867_10026941 | 3300000912 | Forest Soil | RLISSIKVEVKKKHPSHGRTFSCFAAHLIEQDLF* |
| JGI12709J13192_10041862 | 3300001086 | Forest Soil | RSHILISSIKGEVKKKHLSRGRNFSCFAAHLMEQDLF* |
| JGI11823J13286_10048892 | 3300001164 | Forest Soil | FQLPISSIKGEVKKKHLCDGRSFSCFAAHVMEQGLF* |
| JGI12663J13571_1004931 | 3300001181 | Forest Soil | HPDKFYKGRSSIKGEVKKKHTSFGWNFSCFAAPLIERNLF* |
| JGIcombinedJ26739_1006067353 | 3300002245 | Forest Soil | TILLVMGSSIXGKVKKKHFSRGWNFSTFAAHLIEQDLF* |
| JGIcombinedJ26739_1018484401 | 3300002245 | Forest Soil | SQLLXSSIKGEVKKKHISNGWTFSCFAAHLIEQDLF* |
| JGI25454J38594_100072 | 3300002718 | Soil | RVVAKVPVSSLKGEVKNKHNRNGWIFSCFAAHLFEQDLF* |
| JGIcombinedJ43975_100625441 | 3300002899 | Soil | RLRGQLLVCSLKGEVKKKHNCNGWIFSYFAAHLFEQDLF* |
| JGI25616J43925_102993961 | 3300002917 | Grasslands Soil | GTKSVANCLVSSIKVEVKKKHFCIGRTFSCFAAHLDEQDVF* |
| Ga0070685_109987462 | 3300005466 | Switchgrass Rhizosphere | DGVKLGSDSTCLVSSLKGEVKKKHNCNGWIFSCFAAHLFEQDLF* |
| Ga0070762_106829601 | 3300005602 | Soil | VLISSIKVEVKKKHISTGCDFSCFSAHWMEQDLF* |
| Ga0116120_10411522 | 3300009641 | Peatland | MTGPRNFCQWMYSSIKGEVKKKHISFGWSFSCFAAHLIERDLF* |
| Ga0074046_100011681 | 3300010339 | Bog Forest Soil | MGVMSCQLLISSIKVEVKKKHSSAGWNFSRFAAHWMKQDLF* |
| Ga0126376_130459961 | 3300010359 | Tropical Forest Soil | GVAKAIKGEVKKKHHSNGWIFSCFAAHLFERDLF* |
| Ga0126378_130391011 | 3300010361 | Tropical Forest Soil | GVANALPPRRVLVSSLKGEVKKKHNSNGWIFSCFAAHLNEQDLF* |
| Ga0126377_124235962 | 3300010362 | Tropical Forest Soil | CLVCSIKGEVKKKHHSNGWIFSCFAAHLFEQDLF* |
| Ga0137389_115848982 | 3300012096 | Vadose Zone Soil | HILISSVKVEVKKKHFCIGRTFSCFAAHWMEQDLF* |
| Ga0137358_101952662 | 3300012582 | Vadose Zone Soil | EDNLMSSIKGEVKKKHSSNGGNFSCFVAHLIERDLC* |
| Ga0137358_103402281 | 3300012582 | Vadose Zone Soil | DPSISGQLLVSSLKGEVKKKHNRNGWIFSCFAAHLFEQDLF* |
| Ga0157306_101550921 | 3300012912 | Soil | QLLGSSLKGEVKNKHNRNGWIFSCFAAHLFEQDLF* |
| Ga0157302_101610352 | 3300012915 | Soil | VPVGSLKGEVKNKHNRNGWIFSCFAAHLFEQDLF* |
| Ga0157310_100591202 | 3300012916 | Soil | MLSEQKEKRGKLLICSLKGEVKNKHNRNGWIFSCFAAHLFEQDLF* |
| Ga0137407_107649201 | 3300012930 | Vadose Zone Soil | PRGLVSCSIKGEVKEKNIPCGWKFSCFAAHLIERDLF* |
| Ga0164303_108054921 | 3300012957 | Soil | RIKVGQLLICSIKEEVKKKHISFGRNFSCFSAHSIEQVLF* |
| Ga0137418_100085673 | 3300015241 | Vadose Zone Soil | VRYGYTGVARSQILISSIKVEVKKKHPSHGRTFSCFAAHLIEQDLF* |
| Ga0137418_102278352 | 3300015241 | Vadose Zone Soil | SIGLVSSIKGEVKKKHTSFGWNFSCFSAHLIKRDLF* |
| Ga0137409_101301861 | 3300015245 | Vadose Zone Soil | MRKTDVGLGQLLISSIKGEVKKKHTSLGWNFSCFAAPLIERNLF* |
| Ga0187856_10840661 | 3300017925 | Peatland | EESICSIKVEVKKKHVSFGWSFSCFAAHLIEQDLF |
| Ga0187804_101195342 | 3300018006 | Freshwater Sediment | LVSSIKVEVKKKHLSNGWPFPCFAAHLIEQDLFGSAAP |
| Ga0187858_102435573 | 3300018057 | Peatland | MPKVLISSVKGEVKKKHLSIGWSFSCFAAHAMEQDLF |
| Ga0193756_10178751 | 3300019866 | Soil | KRLVSSIKGEVKKKHISLGWNFSCFAAHLIERDLF |
| Ga0193712_10121921 | 3300019880 | Soil | SFQVLISSIKGEVKKKHFSAGWNFSCFSAHWMEQDLF |
| Ga0193729_10641381 | 3300019887 | Soil | FYKGRSSIKGEVKKKHISFGRTFSCFSAHLIERDLL |
| Ga0193757_10075532 | 3300020008 | Soil | KQLPQLLISSIKGEVKKKHFSAGWNFSCFSAHWMEQDLF |
| Ga0193732_10527931 | 3300020012 | Soil | KCFLLIAQVLISSIKGEVKKKHFSAGWNFSCFSAHWMEQDLF |
| Ga0179590_10151191 | 3300020140 | Vadose Zone Soil | CCFGMCQLLVSSIKVEVKKKHLSNGWPFPRFAAHVIEQDLF |
| Ga0179594_101522353 | 3300020170 | Vadose Zone Soil | RSVALCGQVLISSIKVEVKKKHPSHGRTFSCFAAHLIEQDLF |
| Ga0179592_100622852 | 3300020199 | Vadose Zone Soil | GRHNRKNQLDRSIKVEVKKKHLSNGWPFPRFAAHVIEQDLF |
| Ga0210407_105529571 | 3300020579 | Soil | ASIQQHLISSIKEEVKKKHFSLGWKFSCFSAHTIERELF |
| Ga0210399_100584983 | 3300020581 | Soil | QTHRARKLIRSIKVEVKKKHFSFGWNFSCFAAHLIEQDLF |
| Ga0210395_101705061 | 3300020582 | Soil | IRGQVLISSIKGEVKKKHFSGGRSFSCFPAHVIERELF |
| Ga0210401_101760621 | 3300020583 | Soil | QRNPHQVLISSIKVEVKKKHLSNGWTFSCFAAHFIEQDLF |
| Ga0179596_100583291 | 3300021086 | Vadose Zone Soil | EKCLISSIKREVKKKHICNGWTFSCFAAHLKEQDLF |
| Ga0210400_101970542 | 3300021170 | Soil | YLDMSQLPISSIKVEVKKKYNPSGRKFSCFAAHLIERDLF |
| Ga0210405_108766402 | 3300021171 | Soil | AESCLVSSIKGEVKKKHLCNGWPFPRFAAHVIEQDLF |
| Ga0210408_101925962 | 3300021178 | Soil | ELLMSSLKGEVKKKHTANGWIFSCFSAHLFEQDLF |
| Ga0210396_101072793 | 3300021180 | Soil | NRRQLLIRSIKREVKKKHFRIGRSVSCFAAHLIELDRF |
| Ga0179585_11311902 | 3300021307 | Vadose Zone Soil | ARMATSPVSSIKGEVKKKHFSAGWKFSCFAAHIIEQDLY |
| Ga0210389_101964451 | 3300021404 | Soil | QLLICSIKREVKKKHFRIGRSVSCFAAHLIELDRF |
| Ga0210386_100681063 | 3300021406 | Soil | GQLLVSSIKREVKKKHFRIGRSVSCFAAHLIELDRF |
| Ga0210384_101475661 | 3300021432 | Soil | SESQVLRSSIKGEVKEKHLSRGRSFSFFAARLIEQDLF |
| Ga0210384_101827122 | 3300021432 | Soil | VGESKGLVSSIKGEVKKKHISFGWNFSCFAAHLIEQDLF |
| Ga0210391_101079521 | 3300021433 | Soil | CSKVQMRLDGQLPISSIKREVKKKQFRIGRSFSCFAAYLIELDLF |
| Ga0210390_100068511 | 3300021474 | Soil | NESQLLVSSIKVEVKKKHFPFGRNFSCFAAHVMEQDLF |
| Ga0210390_102115561 | 3300021474 | Soil | RQILISSIKVEVKKKHISTGCDFSCFSAHWMEQDLF |
| Ga0210402_100670141 | 3300021478 | Soil | PLRAGKQKLIRSIKVEVKKKHFSFGWNFSCFAAHLIEQDLF |
| Ga0210402_102524661 | 3300021478 | Soil | GQLLRSSLKGEVKKKHTANGWIFSCFSAHLFEQDLF |
| Ga0210402_108465182 | 3300021478 | Soil | DAPQDQLLVSSIKVEVKKEHVSNGWTFSSFAAHLIEQDLF |
| Ga0210409_102309871 | 3300021559 | Soil | REHNSGQLPISSIKVEVKKKYNPSGRKFSCFAAHLIERDLF |
| Ga0210409_104143271 | 3300021559 | Soil | APRQHLVRSLKGEVKKKHTANGWIFSCFSAHLFEQDLF |
| Ga0210409_104385642 | 3300021559 | Soil | EFLRSSIKREVKKKHFRIGRSVSCFAAHLIELDRF |
| Ga0212123_101701671 | 3300022557 | Iron-Sulfur Acid Spring | RSQLLISSIKGEVKKKHISNGWTFSCFAAHLIEQDLF |
| Ga0224549_10051541 | 3300022840 | Soil | PLQVLISSIKVEVKKKHFSFGWNFSCFAAHLIERELF |
| Ga0247800_10768361 | 3300023263 | Soil | THQLPVSSLKGEVKNKHNRNGWIFSCFAAHLFEQDLF |
| Ga0247688_10348752 | 3300024186 | Soil | PQVVLVSSIKVEVKKKHNSNGWNFSCFAAHLMEQDLF |
| Ga0247671_10524232 | 3300024284 | Soil | ESALVSSIKVEVKKKHNSNGWNFSCFAAHLMEQDLF |
| Ga0207692_103381761 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | KVLISSLKGEVKKKHHSNSWIFSCFAAHRLEQDLF |
| Ga0207692_110680761 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | SNSYCPVSSLKGEVKKKHNSNGWSFSCFAAHLVEQGLF |
| Ga0207684_101161871 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | CARPVKPFGRSLKGEVKKKHNSNGWTFSCFAAQLFEQDLF |
| Ga0207693_102275332 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LPNDEQDGSNSYCPVSSLKGEVKKKHNSNGWSFSCFAAHLVEQGLF |
| Ga0207646_104215162 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | AWLERSIKGEVKKKHISCGWNFSCFAAHLIERDLF |
| Ga0207694_116133161 | 3300025924 | Corn Rhizosphere | SQLLVCSLKGEVKKKHHCNGWIFSCFAAHLFEQDLF |
| Ga0207709_117195701 | 3300025935 | Miscanthus Rhizosphere | QGLDGVKLGSDSTCLVSSLKGEVKKKHNCNGWIFSCFAAHLFEQDLF |
| Ga0209839_100350951 | 3300026294 | Soil | TRLSPRRQVLISSIKVEVKKKHISFGWNFSRFAAHWIERDLF |
| Ga0257149_10047481 | 3300026355 | Soil | RVPSQVLISSIKVEVKKKHPSHGRTFSCFAAHLIEQDLF |
| Ga0257177_10432851 | 3300026480 | Soil | INDQLLISSIKVEVKKKHPSHGRTFSCFAAHLIEQDLF |
| Ga0207620_10013511 | 3300026873 | Soil | KLLICSLKGEVKNKHNRNGWIFSCFAAHLFEQDLF |
| Ga0209325_10051932 | 3300027050 | Forest Soil | ISAFGRSLKGEVKKKHNSDGWTFSCFAAQLFEQDLF |
| Ga0207538_10013151 | 3300027122 | Soil | LLLISSLKGEVKNKHNRNGWIFSCFAAHLFEQDLF |
| Ga0207606_1000701 | 3300027178 | Soil | EKRGKLLICSLKGEVKNKHNRNGWIFSCFAAHLFEQDLF |
| Ga0208525_10223011 | 3300027288 | Soil | LGIYSTCLCSSIKVEVKKKHISFGWNFSCFAAHLIERDLF |
| Ga0207463_1007161 | 3300027397 | Soil | EAFYHPTDGLLLISSLKGEVKNKHNRNGWIFSCFAAHLFEQDLF |
| Ga0207609_1017342 | 3300027403 | Soil | CVCPSNQLLGSSIKGKVKKKHFSRGWNFSTFAAHLIEQDLF |
| Ga0207519_1000941 | 3300027411 | Soil | AKVPVSSLKGEVKNKHNRNGWIFSCFAAHLFEQDLF |
| Ga0208993_10578892 | 3300027480 | Forest Soil | RSQVPISSIKEEVKKKHTSFGWNFSCFAAPLIERNLF |
| Ga0209734_11010051 | 3300027535 | Forest Soil | RFEAWPSSIKVEVKKKHFSVGRNFSCFAARLIERDLF |
| Ga0208984_10118451 | 3300027546 | Forest Soil | ASVVALIGSIKGEFKKKHLCDGRSFSCFAAHVMEQGLF |
| Ga0208324_10302641 | 3300027604 | Peatlands Soil | SALSETVLFLISSIKGEVKKKHICNGWTFSCFAAHWIEQDLF |
| Ga0208324_10306101 | 3300027604 | Peatlands Soil | RRRLESSIKGEVKKKHLSDGWNFSCFAAHLIERGLF |
| Ga0208044_10036136 | 3300027625 | Peatlands Soil | EQLSQLLVSSIKGEVKKKHLSDGWNFSCFAAHLIERGLF |
| Ga0208988_10286472 | 3300027633 | Forest Soil | QILISSIKGEVKKKHLCDGRSFSCFAAHVMEQGLF |
| Ga0209076_10263731 | 3300027643 | Vadose Zone Soil | QILISSIKVEVKKKHPSHGRTFSCFAAHLIEQDLF |
| Ga0209588_10331741 | 3300027671 | Vadose Zone Soil | RLRLALEPECSIKGEVKKKHFSAGWKFSCFAAHIIEQDLY |
| Ga0209588_10345192 | 3300027671 | Vadose Zone Soil | AFPISSIKGEVKKKHISIGRNFSCFSAHLIERDLF |
| Ga0209588_10737341 | 3300027671 | Vadose Zone Soil | VKSWYATCPVRSIKGEVKKKHFSAGWKFSCFAAHIIEQDL |
| Ga0209038_100277282 | 3300027737 | Bog Forest Soil | GQSCEAPKLLISSIKVEVKKKHISFGRDFSCFSAHWMEQDLF |
| Ga0209038_100328991 | 3300027737 | Bog Forest Soil | TPLTQLLVSSIKGGVKKKHFSTGWNVSCFSAHLDEQNLF |
| Ga0209448_102079661 | 3300027783 | Bog Forest Soil | SLGQLPISSIKGEVKKKHTSFGWSFSCFAAPLIERNLF |
| Ga0209811_102355602 | 3300027821 | Surface Soil | DKRIADQLPISSIKVEVKKKHNSNGWNFSCFAAHLMERDLF |
| Ga0209039_103572722 | 3300027825 | Bog Forest Soil | QLLISSIKVEVKKKHSSAGWNFSRFAAHWMKQDLF |
| Ga0209773_100623681 | 3300027829 | Bog Forest Soil | LQRTFSQVLISSIKGEVKKKHLSIGWKFSCFAAHTIEGELF |
| Ga0209773_101043712 | 3300027829 | Bog Forest Soil | MLDAGASVGQVLVSSIKEEVKKKDISIGWNFSCFSAHLIE |
| Ga0209180_101139932 | 3300027846 | Vadose Zone Soil | VSDLISSIKVEVKKKHVSFGWNFSCFTAHLIERDLF |
| Ga0209180_103913761 | 3300027846 | Vadose Zone Soil | LFKPKRRQVLICSIRGKVKKKNFSRGWNFSTFAAHLIEQDLF |
| Ga0209693_103715012 | 3300027855 | Soil | RVPRSSIKGEVKKKHLSAGWKFSCFAAHMMEQDLF |
| Ga0209275_100421661 | 3300027884 | Soil | STWLISSIKVEVKKKHFPFGWNFSCFAAHVMEQDLF |
| Ga0209380_106274082 | 3300027889 | Soil | RFLTRQRLISSIKGEVKKKHISHGRSFSCFPAPVIERDLF |
| Ga0209488_103411101 | 3300027903 | Vadose Zone Soil | MGQVLRSSIKGGVKKKHICFDRNFSCFPAHWIERDL |
| Ga0247684_10940571 | 3300028138 | Soil | AFSSHLISSIKVEVKKKHFRAGWNFSCFAAHLMEQDLF |
| Ga0247663_10440401 | 3300028145 | Soil | QADQILISSLKGEVKKKHNSNGWSFSCFAAHLFEQGLF |
| Ga0302233_100461854 | 3300028746 | Palsa | LCTSIGSIKAEDKKKHYFIGRTFARFAAHLIEQNLL |
| Ga0302303_100491531 | 3300028776 | Palsa | SFTARLQRLISSIKVEVKKKHFSFGWNFSCFAAHLIERELF |
| Ga0302222_101112171 | 3300028798 | Palsa | YTFSPFHAEVLISSIKGEVKKKHISCGWTFSCFAAHLIERDVF |
| Ga0302230_100538692 | 3300028871 | Palsa | RLQRLISSIKVEVKKKHFSFGWNFSCFAAHLIERELF |
| Ga0308309_101903092 | 3300028906 | Soil | GLDCRQLLISSIKREVKKKQFRIGRSFSCFAAYLIELDLF |
| Ga0311369_102411512 | 3300029910 | Palsa | SCTARLQRLISSIKVEVKKKHFSFGWNFSCFAAHLIERELF |
| Ga0311352_102065853 | 3300029944 | Palsa | WKNFAGPRQLLISSIKVEVKKKHFSFGWNFSCFAAHLIERELF |
| Ga0311354_101725683 | 3300030618 | Palsa | RKTVTCLISSIKVEVKKKHFSFGWNFSCFAAHLIERELF |
| Ga0316363_101717811 | 3300030659 | Peatlands Soil | VCQQAASSIKGEVKKKHISNGWTFSCFAAHLMERNLF |
| Ga0075401_100423652 | 3300030935 | Soil | QVLISSIKVEVKKKHLANGWPFSCFAAHWIEQDLF |
| Ga0170823_115673881 | 3300031128 | Forest Soil | AQLLVSSLKGEVKKKHNSVGWIFSCFAAPLNEQDLF |
| Ga0170820_124410721 | 3300031446 | Forest Soil | MDDSAFGRSLKGEVKKKHNSNGWTFSCFTAQLFEQDLF |
| Ga0318538_101323952 | 3300031546 | Soil | FPLKQLLVSSLKGEVKKKHKCNGWSFSCFTAHLFEQDLF |
| Ga0306918_108420301 | 3300031744 | Soil | SEGQVLVCSLKGEVKKKHNSNGRIFSCFAAHLFEQDLF |
| Ga0307475_112198782 | 3300031754 | Hardwood Forest Soil | FLLISSIEGKVKKKHSCIGRNFSCFAGYLVEQDLF |
| Ga0318546_100776083 | 3300031771 | Soil | QVPVSSLKGEVKKKHKCNGWSFSCFTAHLFEQDLF |
| Ga0310909_106764842 | 3300031947 | Soil | GRTVLICSLKGEVKKKDNPVGWIFSCFAAHLCEQDLF |
| Ga0310911_100945881 | 3300032035 | Soil | DERQLLVSSLKGEVKKKHKCNGWSFSCFTAHLFEQDLF |
| Ga0306924_103075983 | 3300032076 | Soil | KVLVSSLKGEVKKKHKCNGWSFSCFTAHLFEQDLF |
| Ga0318577_102959862 | 3300032091 | Soil | AMRIQVLISSLKGEVKKKHKCNGWSFSCFTAHLFEQDLF |
| Ga0307471_1003944172 | 3300032180 | Hardwood Forest Soil | LVEQGSLKGEVKKKHNSNGWSFSCFAAHLVEQGLF |
| Ga0335079_120724352 | 3300032783 | Soil | KVPVSSIKGEVKKKHISYGRNLSCFTADLIEQDLF |
| Ga0310914_104753501 | 3300033289 | Soil | WGRTVLICSLKGEVKKKDNPVGWIFSCFAAHLCEQDLF |
| ⦗Top⦘ |