| Basic Information | |
|---|---|
| Family ID | F054170 |
| Family Type | Metagenome |
| Number of Sequences | 140 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MNVTIGLEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 61.43 % |
| % of genes near scaffold ends (potentially truncated) | 47.14 % |
| % of genes from short scaffolds (< 2000 bps) | 79.29 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.429 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil (13.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.143 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.32% β-sheet: 0.00% Coil/Unstructured: 74.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF13505 | OMP_b-brl | 9.29 |
| PF04392 | ABC_sub_bind | 7.86 |
| PF02265 | S1-P1_nuclease | 3.57 |
| PF14534 | DUF4440 | 2.86 |
| PF07886 | BA14K | 2.86 |
| PF00501 | AMP-binding | 2.14 |
| PF01717 | Meth_synt_2 | 2.14 |
| PF04964 | Flp_Fap | 2.14 |
| PF07568 | HisKA_2 | 1.43 |
| PF09361 | Phasin_2 | 1.43 |
| PF00571 | CBS | 1.43 |
| PF13282 | DUF4070 | 0.71 |
| PF00089 | Trypsin | 0.71 |
| PF04214 | DUF411 | 0.71 |
| PF02113 | Peptidase_S13 | 0.71 |
| PF13271 | DUF4062 | 0.71 |
| PF07589 | PEP-CTERM | 0.71 |
| PF08031 | BBE | 0.71 |
| PF10947 | DUF2628 | 0.71 |
| PF04773 | FecR | 0.71 |
| PF09990 | DUF2231 | 0.71 |
| PF00011 | HSP20 | 0.71 |
| PF16868 | NMT1_3 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 7.86 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 2.14 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 2.14 |
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 1.43 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.71 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.71 |
| COG2027 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG3019 | Uncharacterized metal-binding protein, DUF411 family | Function unknown [S] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.43 % |
| All Organisms | root | All Organisms | 48.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886013|SwBSRL2_contig_6939094 | Not Available | 902 | Open in IMG/M |
| 2228664021|ICCgaii200_c0884376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1130 | Open in IMG/M |
| 3300000041|ARcpr5oldR_c000421 | All Organisms → cellular organisms → Bacteria | 5708 | Open in IMG/M |
| 3300000156|NODE_c0456791 | Not Available | 886 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101545755 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1152 | Open in IMG/M |
| 3300000890|JGI11643J12802_10671315 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300000891|JGI10214J12806_10999573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300000953|JGI11615J12901_11929941 | Not Available | 1313 | Open in IMG/M |
| 3300002820|JGI25490J38602_10200 | Not Available | 526 | Open in IMG/M |
| 3300003995|Ga0055438_10011143 | Not Available | 1844 | Open in IMG/M |
| 3300004024|Ga0055436_10112859 | Not Available | 805 | Open in IMG/M |
| 3300004058|Ga0055498_10012708 | Not Available | 1134 | Open in IMG/M |
| 3300004114|Ga0062593_100114989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1943 | Open in IMG/M |
| 3300004114|Ga0062593_101601441 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 707 | Open in IMG/M |
| 3300004156|Ga0062589_100075324 | All Organisms → cellular organisms → Bacteria | 2030 | Open in IMG/M |
| 3300004156|Ga0062589_100448299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1068 | Open in IMG/M |
| 3300004156|Ga0062589_100745360 | Not Available | 878 | Open in IMG/M |
| 3300004156|Ga0062589_101533173 | Not Available | 657 | Open in IMG/M |
| 3300004463|Ga0063356_100185258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2431 | Open in IMG/M |
| 3300004463|Ga0063356_101391925 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300004463|Ga0063356_102738732 | Not Available | 759 | Open in IMG/M |
| 3300004479|Ga0062595_100027348 | All Organisms → cellular organisms → Bacteria | 2284 | Open in IMG/M |
| 3300004479|Ga0062595_100173736 | Not Available | 1292 | Open in IMG/M |
| 3300004479|Ga0062595_101254825 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300005093|Ga0062594_100008940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3457 | Open in IMG/M |
| 3300005093|Ga0062594_100082962 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1828 | Open in IMG/M |
| 3300005093|Ga0062594_101166370 | Not Available | 760 | Open in IMG/M |
| 3300005093|Ga0062594_102920492 | Not Available | 533 | Open in IMG/M |
| 3300005104|Ga0066818_1024045 | Not Available | 523 | Open in IMG/M |
| 3300005183|Ga0068993_10125216 | Not Available | 846 | Open in IMG/M |
| 3300005332|Ga0066388_101074588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1359 | Open in IMG/M |
| 3300005336|Ga0070680_100104131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2358 | Open in IMG/M |
| 3300005336|Ga0070680_100814620 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300005366|Ga0070659_101108260 | Not Available | 698 | Open in IMG/M |
| 3300005367|Ga0070667_100747224 | Not Available | 906 | Open in IMG/M |
| 3300005440|Ga0070705_100253571 | Not Available | 1236 | Open in IMG/M |
| 3300005455|Ga0070663_101141197 | Not Available | 683 | Open in IMG/M |
| 3300005468|Ga0070707_101679259 | Not Available | 602 | Open in IMG/M |
| 3300005545|Ga0070695_100683483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 813 | Open in IMG/M |
| 3300005564|Ga0070664_101707722 | Not Available | 597 | Open in IMG/M |
| 3300005719|Ga0068861_100147590 | All Organisms → cellular organisms → Bacteria | 1926 | Open in IMG/M |
| 3300005844|Ga0068862_102194694 | Not Available | 563 | Open in IMG/M |
| 3300005937|Ga0081455_10000585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 47472 | Open in IMG/M |
| 3300006042|Ga0075368_10293860 | Not Available | 700 | Open in IMG/M |
| 3300006042|Ga0075368_10396803 | Not Available | 605 | Open in IMG/M |
| 3300006048|Ga0075363_100720618 | Not Available | 603 | Open in IMG/M |
| 3300006048|Ga0075363_100829431 | Not Available | 563 | Open in IMG/M |
| 3300006178|Ga0075367_10024043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3434 | Open in IMG/M |
| 3300006353|Ga0075370_10430001 | Not Available | 793 | Open in IMG/M |
| 3300006353|Ga0075370_10939620 | Not Available | 529 | Open in IMG/M |
| 3300006847|Ga0075431_101984423 | Not Available | 537 | Open in IMG/M |
| 3300006931|Ga0097620_102970182 | Not Available | 518 | Open in IMG/M |
| 3300006954|Ga0079219_12359557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300009094|Ga0111539_10286379 | Not Available | 1917 | Open in IMG/M |
| 3300009147|Ga0114129_12013666 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300009148|Ga0105243_10006116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9306 | Open in IMG/M |
| 3300009156|Ga0111538_12508906 | Not Available | 647 | Open in IMG/M |
| 3300010359|Ga0126376_10644942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1009 | Open in IMG/M |
| 3300010362|Ga0126377_10769627 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1020 | Open in IMG/M |
| 3300010371|Ga0134125_10602901 | Not Available | 1214 | Open in IMG/M |
| 3300010373|Ga0134128_10573959 | Not Available | 1256 | Open in IMG/M |
| 3300010399|Ga0134127_13373800 | Not Available | 523 | Open in IMG/M |
| 3300012892|Ga0157294_10000111 | All Organisms → cellular organisms → Bacteria | 7431 | Open in IMG/M |
| 3300012896|Ga0157303_10246494 | Not Available | 542 | Open in IMG/M |
| 3300012899|Ga0157299_10109576 | Not Available | 727 | Open in IMG/M |
| 3300012900|Ga0157292_10162153 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300012907|Ga0157283_10342293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300012909|Ga0157290_10251314 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300012912|Ga0157306_10004307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2588 | Open in IMG/M |
| 3300012913|Ga0157298_10118305 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300012987|Ga0164307_11363504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 595 | Open in IMG/M |
| 3300012989|Ga0164305_10789268 | Not Available | 786 | Open in IMG/M |
| 3300013102|Ga0157371_11624648 | Not Available | 506 | Open in IMG/M |
| 3300013297|Ga0157378_11650590 | Not Available | 687 | Open in IMG/M |
| 3300014299|Ga0075303_1003703 | Not Available | 1733 | Open in IMG/M |
| 3300015201|Ga0173478_10102826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1057 | Open in IMG/M |
| 3300015371|Ga0132258_10656002 | Not Available | 2639 | Open in IMG/M |
| 3300015371|Ga0132258_10797687 | Not Available | 2381 | Open in IMG/M |
| 3300015371|Ga0132258_10803529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2371 | Open in IMG/M |
| 3300015371|Ga0132258_12566747 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300015371|Ga0132258_13006587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1168 | Open in IMG/M |
| 3300015372|Ga0132256_100006759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9880 | Open in IMG/M |
| 3300015372|Ga0132256_100028451 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5032 | Open in IMG/M |
| 3300015372|Ga0132256_102752437 | Not Available | 591 | Open in IMG/M |
| 3300015373|Ga0132257_100235863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2180 | Open in IMG/M |
| 3300015374|Ga0132255_102265695 | Not Available | 829 | Open in IMG/M |
| 3300015374|Ga0132255_103160036 | Not Available | 702 | Open in IMG/M |
| 3300015374|Ga0132255_106086652 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300019356|Ga0173481_10003010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4325 | Open in IMG/M |
| 3300019356|Ga0173481_10463770 | Not Available | 636 | Open in IMG/M |
| 3300019356|Ga0173481_10552419 | Not Available | 597 | Open in IMG/M |
| 3300021560|Ga0126371_10571732 | Not Available | 1279 | Open in IMG/M |
| 3300022880|Ga0247792_1010543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1415 | Open in IMG/M |
| 3300023168|Ga0247748_1033166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 752 | Open in IMG/M |
| 3300025900|Ga0207710_10441583 | Not Available | 671 | Open in IMG/M |
| 3300025903|Ga0207680_10019894 | All Organisms → cellular organisms → Bacteria | 3601 | Open in IMG/M |
| 3300025917|Ga0207660_10231136 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1454 | Open in IMG/M |
| 3300025930|Ga0207701_10082067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2913 | Open in IMG/M |
| 3300025930|Ga0207701_10408251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1169 | Open in IMG/M |
| 3300025930|Ga0207701_10685902 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300025931|Ga0207644_10818056 | Not Available | 779 | Open in IMG/M |
| 3300025932|Ga0207690_10454834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1030 | Open in IMG/M |
| 3300025945|Ga0207679_10736351 | Not Available | 896 | Open in IMG/M |
| 3300025953|Ga0210068_1010423 | Not Available | 1248 | Open in IMG/M |
| 3300025957|Ga0210089_1029828 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300025961|Ga0207712_10233778 | Not Available | 1477 | Open in IMG/M |
| 3300025961|Ga0207712_10736441 | Not Available | 863 | Open in IMG/M |
| 3300026088|Ga0207641_10244706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1673 | Open in IMG/M |
| 3300026118|Ga0207675_100175343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2051 | Open in IMG/M |
| 3300026118|Ga0207675_100479874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1235 | Open in IMG/M |
| 3300026452|Ga0256821_1019120 | Not Available | 717 | Open in IMG/M |
| 3300026758|Ga0207559_103696 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300026784|Ga0207453_101292 | Not Available | 706 | Open in IMG/M |
| 3300026853|Ga0207443_1005677 | Not Available | 659 | Open in IMG/M |
| 3300027036|Ga0207467_1000486 | All Organisms → cellular organisms → Bacteria | 2354 | Open in IMG/M |
| 3300027116|Ga0207539_100519 | Not Available | 926 | Open in IMG/M |
| 3300027252|Ga0209973_1016207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Variibacter → Variibacter gotjawalensis | 948 | Open in IMG/M |
| 3300027523|Ga0208890_1025497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 871 | Open in IMG/M |
| 3300027695|Ga0209966_1000908 | All Organisms → cellular organisms → Bacteria | 5638 | Open in IMG/M |
| 3300027717|Ga0209998_10000966 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7289 | Open in IMG/M |
| 3300027866|Ga0209813_10322588 | Not Available | 605 | Open in IMG/M |
| 3300027876|Ga0209974_10243164 | Not Available | 675 | Open in IMG/M |
| 3300027993|Ga0247749_1008417 | Not Available | 981 | Open in IMG/M |
| 3300028380|Ga0268265_11024495 | Not Available | 816 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1031758 | Not Available | 1101 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1143618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10049042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1103 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1165025 | Not Available | 554 | Open in IMG/M |
| 3300031716|Ga0310813_10007045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7072 | Open in IMG/M |
| 3300031716|Ga0310813_10676014 | Not Available | 920 | Open in IMG/M |
| 3300031720|Ga0307469_11420209 | Not Available | 662 | Open in IMG/M |
| 3300031858|Ga0310892_11200928 | Not Available | 540 | Open in IMG/M |
| 3300031908|Ga0310900_10011411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4383 | Open in IMG/M |
| 3300031908|Ga0310900_10987376 | Not Available | 691 | Open in IMG/M |
| 3300031943|Ga0310885_10012605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2960 | Open in IMG/M |
| 3300032174|Ga0307470_11440868 | Not Available | 570 | Open in IMG/M |
| 3300032179|Ga0310889_10010567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2964 | Open in IMG/M |
| 3300032421|Ga0310812_10010320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3093 | Open in IMG/M |
| 3300033004|Ga0335084_11075167 | Not Available | 808 | Open in IMG/M |
| 3300034820|Ga0373959_0187812 | Not Available | 540 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 13.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.14% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 7.14% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 5.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.00% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 5.00% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.57% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 2.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 2.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.14% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.14% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.43% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.43% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.71% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.71% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.71% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.71% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Host-Associated | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300002820 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K2-12 | Environmental | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005104 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAC | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014299 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300023168 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025953 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025957 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026452 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4 | Environmental | Open in IMG/M |
| 3300026758 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K4-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026784 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01.2K2-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026853 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A5w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027036 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A5-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027116 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A4-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027993 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5 | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwBSRL2_0287.00007970 | 2162886013 | Switchgrass Rhizosphere | VMNVTVGFEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS |
| ICCgaii200_08843762 | 2228664021 | Soil | MNGTLDREEEILSWDVSDEALEIAGAAGQVVAGAYTLQFCTSVDCALVS |
| ARcpr5oldR_0004212 | 3300000041 | Arabidopsis Rhizosphere | MNVTVGFEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS* |
| NODE_04567912 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MDAIIALEEADILSWDVSDESLESAGAGQGVAGAYTLQFCTSQDCALVS* |
| INPhiseqgaiiFebDRAFT_1015457551 | 3300000364 | Soil | MSVVIEEAEEILNWDVSDEALEIAGAAGQEMAGAYTLQFCTTSRDCAS* |
| JGI11643J12802_106713152 | 3300000890 | Soil | DVSDEALEIAGAAGQVVAGAYTLQFCTSVDCALVS* |
| JGI10214J12806_109995731 | 3300000891 | Soil | MNVTIGIEESGEILSWDVSDDALEIAGAAGQVIAGGYTLQFCTSVDCALVS* |
| JGI11615J12901_119299413 | 3300000953 | Soil | MSVTIGVEEVEEILNWNVSDEALEIAGAPGQEIAGGYTLQFCTSMDCALVS* |
| JGI25490J38602_102003 | 3300002820 | Soil | MNVTIGFQETEEILSWDVSDEALEIAGTAGQEIAGAYTLQFCTSMDCA |
| Ga0055438_100111432 | 3300003995 | Natural And Restored Wetlands | MNMTIGLEEAEEILSRDVSDEALEIAGAGHEIAGGYTLQFCTSQDCALAS* |
| Ga0055436_101128591 | 3300004024 | Natural And Restored Wetlands | SWRRTQRGNTVMNMTIGLEEAEEILSRDVSDEALEIAGAGHEIAGGYTLQFCTSQDCALAS* |
| Ga0055498_100127082 | 3300004058 | Natural And Restored Wetlands | MNVTIGLEEVEEILSRDVSDEALEIAGAGHEIAGGYTLQFCTSQDCALAS* |
| Ga0062593_1001149893 | 3300004114 | Soil | MNVTIGLEDAEEILSWDVSDAALEIAGAAGPEMAGGYTLQFCTS |
| Ga0062593_1016014411 | 3300004114 | Soil | MNVTIGLEESEEILSWDVSDDALEIAGAAGQVIAGGYTLQFCTSVDCALVS* |
| Ga0062589_1000753244 | 3300004156 | Soil | MNVTIGLEDAEEILSWDVSDAALEIAGAAGPEMAGGYTLQFCTSQDCALVS* |
| Ga0062589_1004482993 | 3300004156 | Soil | LLAQEAKGDNVMNVTIGLEESEEILSWDVSDDALEIAGAAGQVIAGGYTLQFCTSVDCALVS* |
| Ga0062589_1007453603 | 3300004156 | Soil | ITRASQEAEGGNVMGMTLDLEAAEDILTWDVSDEALEIAGAAGPEIAGGYTLQFCTSMDCALVS* |
| Ga0062589_1015331731 | 3300004156 | Soil | MPAHSWMEAKGSIAMNLTSGLEEQILYWDVSDEALESAAGLEIAGAYTLQFCTSTDCALVS* |
| Ga0063356_1001852584 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNATIRREDAEEILSRDVSDEALEMAGAGHEIAGGYTLQFCTSQDCALLS* |
| Ga0063356_1013919252 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNVTIGLEDAEEILSWDVSDAALEIAGAAGPEMAGGYTLQFCTSQDCALV |
| Ga0063356_1027387322 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MGMTLDLEAAEDILTWDVSDEALEIAGAAGPEIAGGYTLQFCTSMDCALVS* |
| Ga0062595_1000273483 | 3300004479 | Soil | MNVTIGFQETEEILSWDVSDEALEIAGTAGQEIAGAYTLQFCTSMDCALAS* |
| Ga0062595_1001737361 | 3300004479 | Soil | MDAIIALEEAEILSWDVSDESLESAGAGQGVAGAYTLQFCTSQDCALVS* |
| Ga0062595_1012548251 | 3300004479 | Soil | LAQDAKGDTVMNVTIGLEDAEEILSWDVSDAALEIAGAAGPEMAGGYTLQFCTSQDCALVS* |
| Ga0062594_1000089401 | 3300005093 | Soil | MNVTIGLEDAEEILSWDVSDAALEIAGAAGPEMAGGYTLQFCTSQDCA |
| Ga0062594_1000829625 | 3300005093 | Soil | EESEEILSWDVSDDALEIAGAAGQVIAGGYTLQFCTSVDCALVS* |
| Ga0062594_1011663702 | 3300005093 | Soil | MNVTIGLEDVEEILSWDVSDEALEIAGAGDEIAGAYTLQFCTSQDCALVS* |
| Ga0062594_1029204922 | 3300005093 | Soil | MNVTIDPQETEEILSWDVSDETLESAGAAGQEIAGGYTLQFCTSTDCALVS* |
| Ga0066818_10240451 | 3300005104 | Soil | LAQDAKGNTIMNVTIGLDEAEEILSWDVSDEALEIAGAPGHEIAGGYTLQFCTSMDCALVS* |
| Ga0068993_101252162 | 3300005183 | Natural And Restored Wetlands | TQRGNTVMNMTIGLEEAEEILSRDVSDEALEIAGAGHEIAGGYTLQFCTSQDCALAS* |
| Ga0066388_1010745882 | 3300005332 | Tropical Forest Soil | MSAVIEEAEEILSWDVSDEALEIAGAAGPEMAGAYTLQFCTTTRDCAS* |
| Ga0070680_1001041312 | 3300005336 | Corn Rhizosphere | MNVTIGIEESEEILSWDVSDDALEIAGAAGQVIAGGYTLQFCTSVDCALVS* |
| Ga0070680_1008146203 | 3300005336 | Corn Rhizosphere | MNVTVGFEDAEEILSWDVSDEALELAGTAGQEIAGAYTLQFCTSQDCALVS* |
| Ga0070659_1011082601 | 3300005366 | Corn Rhizosphere | MDAIIALEEAEILSWDVSDESLESAGAGQGVAGAYTLQFCTSQDCAL |
| Ga0070667_1007472241 | 3300005367 | Switchgrass Rhizosphere | MNVTVGFEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQF |
| Ga0070705_1002535713 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAQSWMEAKGNIAMNLTSGLEEEILYWDVSDEALESAAGLEIAGAYTLQFCTSTDCALVS* |
| Ga0070663_1011411972 | 3300005455 | Corn Rhizosphere | MDAIIALEEAEILSWDVSDESLESAGAGQGVAGAYTLQFCTSQ |
| Ga0070707_1016792591 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | KGNIAMNLTSGLEEEILYWDVSDEALESAAGLEIAGAYTLQFCTSTDCALVS* |
| Ga0070695_1006834831 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLTSGLEEEILYWDVSDEALESAAGLEIAGAYTLQFCTSTDCALVS* |
| Ga0070664_1017077222 | 3300005564 | Corn Rhizosphere | MDAIIALEEAEILSWDVSDESLESAGAGQGVAGAYTLQFC |
| Ga0068861_1001475901 | 3300005719 | Switchgrass Rhizosphere | LSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS* |
| Ga0068862_1021946942 | 3300005844 | Switchgrass Rhizosphere | GKNVMNVTVGFEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS* |
| Ga0081455_1000058517 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MGVVIEEAEEILSWDVSDEALEIAGAAGQEMAGAYTLQFCTTSRDCAS* |
| Ga0075368_102938602 | 3300006042 | Populus Endosphere | MPAQSWMEAKGNIAMNLTSGLEEEILYWDVSDEALESAAGLEIAGVYTLQFCTSTDCALVS* |
| Ga0075368_103968032 | 3300006042 | Populus Endosphere | TEEILSWDVSDEALEIAGTAGQEIAGAYTLQFCTSMDCALAS* |
| Ga0075363_1007206182 | 3300006048 | Populus Endosphere | WDVSDEALEIAGTAGQEIAGAYTLQFCTSMDCALAS* |
| Ga0075363_1008294311 | 3300006048 | Populus Endosphere | MPAQSWMEAKGNIAMNLTSGLEEEILYWDVSDEALERAAGLEIAGAYTLQFC |
| Ga0075367_100240431 | 3300006178 | Populus Endosphere | MNVTIGFQETEEILSWDVSDEALEIAGTAGQEIAGAYTLQFCTSMD |
| Ga0075370_104300012 | 3300006353 | Populus Endosphere | MPAQSWMEAKGNIAMNLTSGLEEEILYWDVSDEALERAAGLEIAGAYTLQFCTSTDCALVS* |
| Ga0075370_109396201 | 3300006353 | Populus Endosphere | ARETKGNTIMNVTIGLEDAEEILSWDVSDEALEIAGTAGQEIAGAYTLQFCTSMDCALAS |
| Ga0075431_1019844232 | 3300006847 | Populus Rhizosphere | MNVTIGLEESEEILSWDVSDEALEIAGAAGQVVAGAYTLQFCTSVDCALVS* |
| Ga0097620_1029701822 | 3300006931 | Switchgrass Rhizosphere | MPAQSWMEAKGNIAMNLTSGLEEEILYWDVSDEALESAAGLEIAGAYTLQFCTSTDC |
| Ga0079219_123595572 | 3300006954 | Agricultural Soil | VSTTVDLEEEKEILNRDVPDDALEIAGAAGQEVAGGYTLQFCTSMDCALIS* |
| Ga0111539_102863792 | 3300009094 | Populus Rhizosphere | MSVTIGLEDVEEILNWNVSDEALEIAGAPGQEIAGGYTLQFCTSMDCALVS* |
| Ga0114129_120136661 | 3300009147 | Populus Rhizosphere | MNVTIGLEEMEEILSWDVSDEALEIAGTAGQVVAGAYTLQFCTSVDCALVS* |
| Ga0105243_100061168 | 3300009148 | Miscanthus Rhizosphere | MNVTIGFQETEEILSWDVSDEALEIAGAAGQEIAGAYTLQFCTSMDCALAS* |
| Ga0111538_125089061 | 3300009156 | Populus Rhizosphere | MSVTIGVEEVEEILNWNVSDEALEIAGTPGQEITAGYTLQFCTSMDCALVS* |
| Ga0126376_106449421 | 3300010359 | Tropical Forest Soil | MSVVIEEAEAILSWDVSDEALEVAGAAGQEMAGAYTMQFCTTTRDCAG* |
| Ga0126377_107696272 | 3300010362 | Tropical Forest Soil | MSVVIEEAEAILSWDVSDEALEIAGAAGQEMAGAYTLQFCTTSRDCAG* |
| Ga0134125_106029014 | 3300010371 | Terrestrial Soil | EILSWDVSDESLESAGAGQGVAGAYTLQFCTSQDCALVS* |
| Ga0134128_105739592 | 3300010373 | Terrestrial Soil | MEAKGNIAMNLTSGLEEEILYWDVSDEALESAAGLEIAGAYTLQFCTSTDCALVS* |
| Ga0134127_133738002 | 3300010399 | Terrestrial Soil | EEILSWDVSDAALEIAGAAGPEMAGGYTLQFCTSQDCALVS* |
| Ga0157294_100001117 | 3300012892 | Soil | MNVIIGLQETEEILSWDVSDEALEIAGTAGQEIAGAYTLQFCTSMDCALAS* |
| Ga0157303_102464941 | 3300012896 | Soil | GNTAMNVTSSPEDEILHCDVSDEALEIAAGQEIAGAYTLQFCTSTDCALVS* |
| Ga0157299_101095762 | 3300012899 | Soil | MEAKGSIAMNLTSGLEEEILYWDVSDEALESAAGLEIAGAYTLQFCTSTDCALVS* |
| Ga0157292_101621532 | 3300012900 | Soil | VSDEALELAGTAGQEIAGAYTLQFCTSQDCALVS* |
| Ga0157283_103422932 | 3300012907 | Soil | FEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS* |
| Ga0157290_102513141 | 3300012909 | Soil | ETEEILSWDVSDEALELAGTAGQEIAGAYTLQFCTSQDCALVS* |
| Ga0157306_100043075 | 3300012912 | Soil | QDARGKNVMNVTVGFEDAEEILSWDVSDEALELAGTAGQEIAGAYTLQFCTSQDCALVS* |
| Ga0157298_101183051 | 3300012913 | Soil | QDAKGKNVMNVTVGFEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS* |
| Ga0164307_113635042 | 3300012987 | Soil | DARGKNVMNVTVGFEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS* |
| Ga0164305_107892681 | 3300012989 | Soil | EDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS* |
| Ga0157371_116246481 | 3300013102 | Corn Rhizosphere | LEEEILYWDVSDEALESAAGLEIAGAYTLQFCTSTDCALVS* |
| Ga0157378_116505902 | 3300013297 | Miscanthus Rhizosphere | EEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS* |
| Ga0075303_10037033 | 3300014299 | Natural And Restored Wetlands | RTQRGNTVMNMTIGLEEAEEILSRDVSDEALEIAGAGHEIAGGYTLQFCTSQDCALAS* |
| Ga0173478_101028263 | 3300015201 | Soil | RGKNVMNVTVGFEDAEEILSWDVSDEALELAGTAGQEIAGAYTLQFCTSQDCALVS* |
| Ga0132258_106560024 | 3300015371 | Arabidopsis Rhizosphere | LAQETKGNNVMNVTIGLRETEEILSWDVSDEALEIAGAAGQELAAAYTLQFCTSTDCALVS* |
| Ga0132258_107976873 | 3300015371 | Arabidopsis Rhizosphere | LRGWCGKLKGNTVMNVTIDREEADEVLSRDVSDEALEIAGSAEIAGGYTLQFCTSMECALVS* |
| Ga0132258_108035292 | 3300015371 | Arabidopsis Rhizosphere | VQETKGNTVMNATIRFEDADEILSRDVSDEALEIAGSAEIAGGYTLQFCTSMDCALVS* |
| Ga0132258_125667473 | 3300015371 | Arabidopsis Rhizosphere | MTTSFDLEEEVLNRDVSDEALESAAGLEIAGAYTLQFCTSTDCALVS* |
| Ga0132258_130065872 | 3300015371 | Arabidopsis Rhizosphere | MNATIGLEDAEEILSWDVSDEALEIAGAGHEIAGGYTLQFCTSQDCALVS* |
| Ga0132256_1000067591 | 3300015372 | Arabidopsis Rhizosphere | EILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS* |
| Ga0132256_1000284516 | 3300015372 | Arabidopsis Rhizosphere | LRGWCGKLKGNTVMNVTIDREEADEVLSRDVSDEALEIAGSAEIAGGYTLQFCTSMDCALVS* |
| Ga0132256_1027524372 | 3300015372 | Arabidopsis Rhizosphere | AEEILSWDVSDEALELAGTAGQEIAGAYTLQFCTSQDCALVS* |
| Ga0132257_1002358638 | 3300015373 | Arabidopsis Rhizosphere | LRGWCGKLKGNTVMNVTIDREEADEVLSRDVSDEALEIAGSAEIAGGYTLQFCTS |
| Ga0132255_1022656951 | 3300015374 | Arabidopsis Rhizosphere | MTTSFDLGEEVLNWDDSDEARESAAGLEIAGACTLQFCTSTDCALVS* |
| Ga0132255_1031600361 | 3300015374 | Arabidopsis Rhizosphere | MNVTVGFEDAEDILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCAL |
| Ga0132255_1060866521 | 3300015374 | Arabidopsis Rhizosphere | MNVTVGLEDVEEILSWDISDAALEIAGAGHEMAGAYTLQFCTSQDCALAS* |
| Ga0173481_100030108 | 3300019356 | Soil | MNVTIGFQETEEILSWDVSDEALEIAGTAGQEIAGAYTLQFCTSMDCALAS |
| Ga0173481_104637703 | 3300019356 | Soil | MNVIIGLQETEEILSWDVSDEALEIAGAAGQEIAGAYTLQFCTSMDCALATQSAAMVLILDR |
| Ga0173481_105524191 | 3300019356 | Soil | MNVTVGFEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS |
| Ga0126371_105717322 | 3300021560 | Tropical Forest Soil | MDAINALEKAEILSWDVSDESLESAGAGQGVAGAYTLQFCTSQDCALVS |
| Ga0247792_10105433 | 3300022880 | Soil | MNVTVGFEDAEEILSWDVSDEALELAGTAGQEIAGAYTLQFCTSQDCALVS |
| Ga0247748_10331661 | 3300023168 | Soil | DARGKNVMNVTVGFEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS |
| Ga0207710_104415832 | 3300025900 | Switchgrass Rhizosphere | MPAQSWMEAKGNIAMNLTSGLEEEILYWDVSDEALESAAGLEIAGAYTLQFCTSTDCALV |
| Ga0207680_100198941 | 3300025903 | Switchgrass Rhizosphere | MNVTIGFQETEEILSWDVSDEALEIAGTAGQEIAGAYTLKFCT |
| Ga0207660_102311362 | 3300025917 | Corn Rhizosphere | MNVTIGIEESEEILSWDVSDDALEIAGAAGQVIAGGYTLQFCTSVDCALVS |
| Ga0207701_100820671 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | FEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS |
| Ga0207701_104082513 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | GKNVMNVTVGFEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS |
| Ga0207701_106859022 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVTIGLEDAEEILSWDVSDAALEIAGAAGPEMAGGYTLQFCTSQDCALVS |
| Ga0207644_108180562 | 3300025931 | Switchgrass Rhizosphere | MPAQSWMEAKGNIAMNPTSGLEEEILYWDVSDEALESAAGLEIAGAYTLQFCTSTDCALV |
| Ga0207690_104548341 | 3300025932 | Corn Rhizosphere | MNVTVGFEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQD |
| Ga0207679_107363512 | 3300025945 | Corn Rhizosphere | MPAQSWMEAKGNIAMNLTSGLEEEILYWDVSDEALESAAGLEIAGVYTLQFCTSTDCALV |
| Ga0210068_10104231 | 3300025953 | Natural And Restored Wetlands | MNMTIGLEEAEEILSRDVSDEALEIAGAGHEIAGGYTLQFCTSQDCALAS |
| Ga0210089_10298281 | 3300025957 | Natural And Restored Wetlands | MNVTIGLEEVEEILSRDVSDEALEIAGAGHEIAGGYTLQFCTSQDCALAS |
| Ga0207712_102337783 | 3300025961 | Switchgrass Rhizosphere | QDARGKNVMNVTVGFEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS |
| Ga0207712_107364411 | 3300025961 | Switchgrass Rhizosphere | MNVTVGFEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQ |
| Ga0207641_102447061 | 3300026088 | Switchgrass Rhizosphere | AKGNIAMNLTSGLEEEILYWDVSDEALASAAGLEIAGAYTLQFCTSTDCALVS |
| Ga0207675_1001753431 | 3300026118 | Switchgrass Rhizosphere | GFEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS |
| Ga0207675_1004798741 | 3300026118 | Switchgrass Rhizosphere | MNVTVGFEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCT |
| Ga0256821_10191202 | 3300026452 | Sediment | MNVTIGLEEAEEILSRDVSDEALEIAGEGHEIAGGYTLQFCTSRDCALAS |
| Ga0207559_1036962 | 3300026758 | Soil | MNVTIGFQETEEILSWDVSDEALELAGTAGQEIAGAYTLQFCTSQDCALVS |
| Ga0207453_1012922 | 3300026784 | Soil | MNVTIGFQETEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS |
| Ga0207443_10056773 | 3300026853 | Soil | MNVTIGFQETEEILSWDVSDEALEIAGTAGQEIAGAYTLQFCT |
| Ga0207467_10004862 | 3300027036 | Soil | MNVTIGFQETEEILSWDVSDEALEIAGAAGQEIAGAYTLQFCTSMDCALATQSAAMVLILDR |
| Ga0207539_1005192 | 3300027116 | Soil | AGNKRQLSAIDLEETEEILSWDVSDEALEIAGTAGQEIAGAYTLQFCTSMDCALAS |
| Ga0209973_10162072 | 3300027252 | Arabidopsis Thaliana Rhizosphere | MNVTIGLEDVEEILSWDVSDEALEIAGAGHEIAGGYTLQFCTSQDCALVS |
| Ga0208890_10254972 | 3300027523 | Soil | MNVTIGLEEAEEILSWDVSDEALEIAGTAGHVIAGGYTLQFCTSMDCALVS |
| Ga0209966_10009082 | 3300027695 | Arabidopsis Thaliana Rhizosphere | MNVTIGLEEMEEILSWDVSDEALEIAGAAGQVVAGAYTLQFCTSVDCALVS |
| Ga0209998_1000096611 | 3300027717 | Arabidopsis Thaliana Rhizosphere | MNVTIGFQETEEILSWDVSDEALEIAGAAGQVVAGAYTLQFCTSVDCALVS |
| Ga0209813_103225882 | 3300027866 | Populus Endosphere | TEEILSWDVSDEALEIAGTAGQEIAGAYTLQFCTSMDCALAS |
| Ga0209974_102431642 | 3300027876 | Arabidopsis Thaliana Rhizosphere | VMNVTIGLEDVEEILSWDVSDEALEIAGAGDEIAGAYTLQFCTSQDCALVS |
| Ga0247749_10084171 | 3300027993 | Soil | ILSWDVSDEALEIAGTAGQEIAGAYTLQFCTSMDCALAS |
| Ga0268265_110244951 | 3300028380 | Switchgrass Rhizosphere | EEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS |
| (restricted) Ga0255311_10317582 | 3300031150 | Sandy Soil | MNVTIGLEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS |
| (restricted) Ga0255311_11436181 | 3300031150 | Sandy Soil | MNVTFGLEESEEILSWDVSDEALEIAGTAWQVIAGGYTLQFCTSTDCALVS |
| (restricted) Ga0255310_100490421 | 3300031197 | Sandy Soil | MNVTVGFEDAEEILSWDVSDEALENAGTAGQETAGAYTLQFCTSQDCALVS |
| (restricted) Ga0255312_11650251 | 3300031248 | Sandy Soil | MNVTVGFEDAAEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS |
| Ga0310813_100070454 | 3300031716 | Soil | MNATIRREDAEEILSRDVSDEALEMAGAGHEIAGGYTLQFCTSQDCALVS |
| Ga0310813_106760141 | 3300031716 | Soil | DCAAQRGNKTMDAIIALEEAEILSWNVSDESLESAGAGQGVAGAYTLQFCTSQDCALVS |
| Ga0307469_114202092 | 3300031720 | Hardwood Forest Soil | MSVVIEEAEEILSWDVSDEALEIAGAAGQEMAGAYTMQFCTTSRDCAS |
| Ga0310892_112009283 | 3300031858 | Soil | WDVSDEALEIAGTAGHVIAGGYTLQFCTSMDCALVS |
| Ga0310900_100114114 | 3300031908 | Soil | MSAFGGRADLITCAVAQDARGKNVMNVTVGFEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS |
| Ga0310900_109873761 | 3300031908 | Soil | MGNTVMNVSIGLEDAEEILNWDVSDEAFEIAGAAGQELAGAYTLQFCTSQDCALVS |
| Ga0310885_100126054 | 3300031943 | Soil | WDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS |
| Ga0307470_114408681 | 3300032174 | Hardwood Forest Soil | MNVTIGLEETEAILSWDISDEALEIAGTAGQVIAGGYTLQFCTSMDCALVS |
| Ga0310889_100105674 | 3300032179 | Soil | NVMNVTVGFEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCALVS |
| Ga0310812_100103203 | 3300032421 | Soil | ILSRDVSDEALEMAGAGHEIAGGYTLQFCTSQDCALVS |
| Ga0335084_110751673 | 3300033004 | Soil | DAEEILSWDVSDEALEIAGAGHEIAGGYTLQFCTSQDCALVS |
| Ga0373959_0187812_3_146 | 3300034820 | Rhizosphere Soil | MNVTVGFEDAEEILSWDVSDEALESAGTAGQEIAGAYTLQFCTSQDCA |
| ⦗Top⦘ |