NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002820

3300002820: Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K2-12



Overview

Basic Information
IMG/M Taxon OID3300002820 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0095510 | Gp0072106 | Ga0007231
Sample NameSoil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K2-12
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1961622
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeagricultural fieldagricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Michigan
CoordinatesLat. (o)42.4Long. (o)-85.37Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F052029Metagenome143Y
F054170Metagenome140Y
F065229Metagenome / Metatranscriptome128Y
F097305Metagenome / Metatranscriptome104N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI25490J38602_10103Not Available620Open in IMG/M
JGI25490J38602_10149Not Available564Open in IMG/M
JGI25490J38602_10161All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales551Open in IMG/M
JGI25490J38602_10200Not Available526Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI25490J38602_10103JGI25490J38602_101031F052029LALNFRSLLPANPVAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA*
JGI25490J38602_10149JGI25490J38602_101491F097305KSGKDKKSDSRSQRLAAELRENLRRRKAQVRGRKAPAAGEGTKRPGLPPRGG*
JGI25490J38602_10161JGI25490J38602_101612F065229LSAIILSDAIPAMLLIRFAISVFALMLLGLAVSLSVAQSEDETNAAQAATFIHQ*
JGI25490J38602_10200JGI25490J38602_102003F054170MNVTIGFQETEEILSWDVSDEALEIAGTAGQEIAGAYTLQFCTSMDCA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.