Metagenome / Metatranscriptome Family F045796

Overview

Basic Information

• Family ID: F045796
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 152
• Average Sequence Length: 36 residues
• Representative Sequence: MTLSYNSLQSLALSLVGALVASSLFLSAAVGPVPVI
• Number of Associated Samples: 112
• Number of Associated Scaffolds: 152

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 92.72 %
• % of genes near scaffold ends (potentially truncated): 7.24 %
• % of genes from short scaffolds (< 2000 bps): 74.34 %
• Associated GOLD sequencing projects: 106
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (58.553 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (28.947 % of family members)
• Environment Ontology (ENVO): Unclassified (44.737 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (53.947 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Fibrous
• Signal Peptide: Yes
• Secondary Structure distribution:
  α-helix: 40.62%
  β-sheet: 0.00%
  Coil/Unstructured: 59.38%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 152 Family Scaffolds
PF04024	PspC	48.03
PF13561	adh_short_C2	5.26
PF00375	SDF	3.95
PF11026	DUF2721	3.29
PF13545	HTH_Crp_2	2.63
PF07715	Plug	1.97
PF01274	Malate_synthase	1.97
PF09836	DUF2063	1.32
PF09411	PagL	1.32
PF06127	Mpo1-like	1.32
PF00578	AhpC-TSA	1.32
PF07896	DUF1674	0.66
PF06242	TrcR	0.66
PF00345	PapD_N	0.66
PF00144	Beta-lactamase	0.66
PF06348	DUF1059	0.66
PF01755	Glyco_transf_25	0.66
PF14219	DUF4328	0.66
PF05114	DUF692	0.66
PF09966	DUF2200	0.66
PF13520	AA_permease_2	0.66
PF12760	Zn_Tnp_IS1595	0.66
PF12697	Abhydrolase_6	0.66
PF05960	DUF885	0.66
PF08309	LVIVD	0.66
PF00271	Helicase_C	0.66
PF02586	SRAP	0.66
PF03544	TonB_C	0.66
PF00194	Carb_anhydrase	0.66
PF01189	Methyltr_RsmB-F	0.66
PF07681	DoxX	0.66
PF12902	Ferritin-like	0.66
PF13439	Glyco_transf_4	0.66
PF07498	Rho_N	0.66
PF04055	Radical_SAM	0.66
PF06736	TMEM175	0.66
PF06841	Phage_T4_gp19	0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 152 Family Scaffolds
COG2225	Malate synthase	Energy production and conversion [C]	1.97
COG4539	2-hydroxy fatty acid dioxygenase MPO1 (alpha-oxidation of fatty acids)	Lipid transport and metabolism [I]	1.32
COG3121	P pilus assembly protein, chaperone PapD	Extracellular structures [W]	1.32
COG3220	Uncharacterized conserved protein, UPF0276 family	Function unknown [S]	0.66
COG5508	Uncharacterized conserved protein, DUF1674 domain	Function unknown [S]	0.66
COG5276	Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain	Function unknown [S]	0.66
COG4805	Uncharacterized conserved protein, DUF885 family	Function unknown [S]	0.66
COG4270	Uncharacterized membrane protein	Function unknown [S]	0.66
COG3820	Cell cycle regulator TrcR, DUF1013 family	Transcription [K]	0.66
COG3548	Uncharacterized membrane protein	Function unknown [S]	0.66
COG3338	Carbonic anhydrase	Inorganic ion transport and metabolism [P]	0.66
COG3306	Glycosyltransferase involved in LPS biosynthesis, GR25 family	Cell wall/membrane/envelope biogenesis [M]	0.66
COG0144	16S rRNA C967 or C1407 C5-methylase, RsmB/RsmF family	Translation, ribosomal structure and biogenesis [J]	0.66
COG2367	Beta-lactamase class A	Defense mechanisms [V]	0.66
COG2259	Uncharacterized membrane protein YphA, DoxX/SURF4 family	Function unknown [S]	0.66
COG2135	ssDNA abasic site-binding protein YedK/HMCES, SRAP family	Replication, recombination and repair [L]	0.66
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.66
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	0.66
COG0810	Periplasmic protein TonB, links inner and outer membranes	Cell wall/membrane/envelope biogenesis [M]	0.66

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	58.55 %
Unclassified	root	N/A	41.45 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	58.55 %
Unclassified	root	N/A	41.45 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	58.55 %
Unclassified	root	N/A	41.45 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	52.63 %
Unclassified	root	N/A	41.45 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.32 %

Level 5

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	50.66 %
Unclassified	root	N/A	41.45 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.32 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.45 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	35.53 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	1.97 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.32 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.45 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	27.63 %
Sphingosinicellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae	3.29 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.97 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	1.32 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.45 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	19.74 %
Sphingosinicella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella	3.29 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.97 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1.32 %
Novosphingobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium	1.32 %
unclassified Sphingomonadaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae	1.32 %
Parasphingorhabdus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Parasphingorhabdus	0.66 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.45 %
unclassified Sphingosinicella	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella	1.97 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.97 %
Novosphingobium resinovorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum	1.32 %
Sphingomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	1.32 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1.32 %
Parasphingorhabdus marina	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Parasphingorhabdus → Parasphingorhabdus marina	0.66 %
unclassified Sphingomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas	0.66 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.45 %
Sphingosinicella sp. CPCC 101087	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. CPCC 101087	1.97 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.97 %
Novosphingobium resinovorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum	1.32 %
Sphingomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	1.32 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1.32 %
Sphingomonas sp. ERG5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. ERG5	0.66 %
Parasphingorhabdus marina DSM 22363	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Parasphingorhabdus → Parasphingorhabdus marina → Parasphingorhabdus marina DSM 22363	0.66 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300001686|C688J18823_10203653	Not Available	1333
3300001989|JGI24739J22299_10058130	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1229
3300002184|JGI24770J26754_10018689	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3731
3300005334|Ga0068869_101045272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	713
3300005355|Ga0070671_100938020	Not Available	757
3300005543|Ga0070672_100552863	Not Available	1000
3300005548|Ga0070665_100000317	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	74997
3300005564|Ga0070664_101960253	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	556
3300005719|Ga0068861_102095380	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	565
3300005843|Ga0068860_100504023	All Organisms → cellular organisms → Bacteria	1209
3300006031|Ga0066651_10001442	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	8170
3300006353|Ga0075370_10377661	Not Available	849
3300006871|Ga0075434_100265297	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1736
3300007004|Ga0079218_13319789	Not Available	545
3300009078|Ga0105106_11331930	Not Available	509
3300009094|Ga0111539_11554347	Not Available	767
3300009094|Ga0111539_11705907	All Organisms → cellular organisms → Bacteria → Proteobacteria	730
3300009098|Ga0105245_10067230	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	3245
3300009098|Ga0105245_10625604	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1105
3300009098|Ga0105245_12052808	Not Available	625
3300009148|Ga0105243_10514201	Not Available	1137
3300009176|Ga0105242_11759605	Not Available	657
3300009553|Ga0105249_12150032	Not Available	631
3300010051|Ga0133939_1041623	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	8095
3300010333|Ga0134080_10510298	Not Available	573
3300010371|Ga0134125_12728627	Not Available	537
3300010399|Ga0134127_12038818	Not Available	652
3300010399|Ga0134127_12955294	Not Available	554
3300010400|Ga0134122_11685636	Not Available	661
3300010400|Ga0134122_12033518	Not Available	614
3300010401|Ga0134121_10556797	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	1066
3300010874|Ga0136264_10367729	Not Available	524
3300011119|Ga0105246_10501011	All Organisms → cellular organisms → Bacteria	1031
3300011196|Ga0137482_100334	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	8007
3300011198|Ga0137472_100753	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1949
3300011244|Ga0137483_102524	Not Available	2103
3300011443|Ga0137457_1104495	Not Available	903
3300012208|Ga0137376_11377484	Not Available	596
3300012212|Ga0150985_104776044	Not Available	591
3300012212|Ga0150985_120476194	Not Available	926
3300012668|Ga0157216_10009848	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5237
3300012892|Ga0157294_10226827	Not Available	563
3300012943|Ga0164241_10189984	All Organisms → cellular organisms → Bacteria	1469
3300012958|Ga0164299_11178093	Not Available	578
3300012989|Ga0164305_10480706	Not Available	972
3300013297|Ga0157378_12745934	Not Available	545
3300013308|Ga0157375_11248358	Not Available	872
3300014325|Ga0163163_11810342	Not Available	671
3300014325|Ga0163163_11858845	Not Available	662
3300014326|Ga0157380_10958063	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	886
3300014969|Ga0157376_11637636	Not Available	678
3300015064|Ga0167641_109216	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1172
3300015067|Ga0167640_109719	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	907
3300015069|Ga0167633_100120	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	37799
3300015161|Ga0167623_1055993	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	750
3300015168|Ga0167631_1029217	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	885
3300015189|Ga0167667_1005627	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3983
3300015371|Ga0132258_10731565	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	2492
3300015371|Ga0132258_11489292	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1709
3300015374|Ga0132255_102868047	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	737
3300017792|Ga0163161_10937366	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. CPCC 101087	736
3300017965|Ga0190266_10000528	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	6384
3300018422|Ga0190265_10000200	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	56003
3300018422|Ga0190265_10001317	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	16197
3300018422|Ga0190265_10002832	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	11721
3300018422|Ga0190265_10056931	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3449
3300018422|Ga0190265_10098595	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	2731
3300018422|Ga0190265_10233622	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1875
3300018422|Ga0190265_10580425	Not Available	1239
3300018422|Ga0190265_10666633	Not Available	1161
3300018422|Ga0190265_10776296	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1081
3300018422|Ga0190265_10822855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1051
3300018422|Ga0190265_10866254	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1026
3300018429|Ga0190272_10060934	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2238
3300018429|Ga0190272_10213273	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1409
3300018429|Ga0190272_10227313	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum	1377
3300018429|Ga0190272_10448557	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1074
3300018429|Ga0190272_10738823	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	894
3300018429|Ga0190272_10996148	Not Available	799
3300018429|Ga0190272_11581223	Not Available	671
3300018429|Ga0190272_11927628	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	622
3300018432|Ga0190275_10000015	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	287251
3300018432|Ga0190275_10000352	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	43086
3300018465|Ga0190269_10156769	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	1185
3300018469|Ga0190270_12084085	Not Available	626
3300018476|Ga0190274_10000220	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	38564
3300018476|Ga0190274_10642989	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella	1095
3300018476|Ga0190274_11663386	Not Available	732
3300018481|Ga0190271_11357511	Not Available	830
3300018920|Ga0190273_11822555	Not Available	555
3300019208|Ga0180110_1097874	Not Available	573
3300019360|Ga0187894_10000007	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	405218
3300019360|Ga0187894_10000398	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	58544
3300019361|Ga0173482_10442771	Not Available	615
3300019377|Ga0190264_10093047	Not Available	1387
3300020027|Ga0193752_1011699	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	4565
3300020027|Ga0193752_1122379	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. CPCC 101087	1044
3300020027|Ga0193752_1182875	Not Available	806
3300020034|Ga0193753_10162578	Not Available	1053
3300020059|Ga0193745_1000005	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	267691
3300020202|Ga0196964_10102525	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella	1261
3300021061|Ga0196973_1056756	Not Available	753
3300021067|Ga0196978_1001856	All Organisms → cellular organisms → Bacteria → Proteobacteria	8562
3300021339|Ga0193706_1129971	Not Available	686
3300025315|Ga0207697_10227427	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Parasphingorhabdus → Parasphingorhabdus marina → Parasphingorhabdus marina DSM 22363	823
3300025893|Ga0207682_10000998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	13085
3300025893|Ga0207682_10162785	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. ERG5	1012
3300025901|Ga0207688_10294403	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	991
3300025903|Ga0207680_11050578	Not Available	583
3300025907|Ga0207645_10465205	Not Available	854
3300025923|Ga0207681_10318946	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1235
3300025923|Ga0207681_10749774	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. CPCC 101087	814
3300025926|Ga0207659_11010523	Not Available	716
3300025927|Ga0207687_11226419	Not Available	645
3300025930|Ga0207701_11284902	Not Available	600
3300025935|Ga0207709_10273256	All Organisms → cellular organisms → Bacteria	1245
3300025941|Ga0207711_10491035	Not Available	1144
3300025942|Ga0207689_10172844	All Organisms → cellular organisms → Bacteria	1781
3300025960|Ga0207651_10329514	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum	1279
3300025972|Ga0207668_10154125	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1783
3300026306|Ga0209468_1005306	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5044
3300027907|Ga0207428_11211571	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	525
3300028379|Ga0268266_10000388	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	66871
3300028380|Ga0268265_10390155	All Organisms → cellular organisms → Bacteria	1284
3300028578|Ga0272482_10013960	Not Available	2010
3300028578|Ga0272482_10077602	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	913
3300028590|Ga0247823_10627082	All Organisms → cellular organisms → Bacteria	809
3300028596|Ga0247821_10310706	Not Available	963
3300028802|Ga0307503_10000015	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	206343
3300031228|Ga0299914_10522675	Not Available	1023
3300031229|Ga0299913_10003962	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	12317
3300031455|Ga0307505_10030563	All Organisms → cellular organisms → Bacteria → Proteobacteria	2438
3300031455|Ga0307505_10346443	Not Available	701
3300031456|Ga0307513_10167417	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2080
3300031456|Ga0307513_10484052	Not Available	957
3300031548|Ga0307408_100717779	Not Available	900
3300031824|Ga0307413_10059868	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2342
3300032004|Ga0307414_10371081	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1234
3300032004|Ga0307414_10979810	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	778
3300032005|Ga0307411_10741283	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	860
3300032075|Ga0310890_11386658	Not Available	577
3300032205|Ga0307472_100334547	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1235
3300032896|Ga0335075_10000067	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	215320
3300032896|Ga0335075_10723177	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	952
3300034006|Ga0334934_006018	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1618
3300034006|Ga0334934_016257	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1004
3300034134|Ga0334928_138934	Not Available	503
3300034169|Ga0370480_0253804	Not Available	593
3300034195|Ga0370501_0386833	Not Available	511
3300034251|Ga0334947_001471	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	6597
3300034965|Ga0370497_0000001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	865326

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	61.84%
Host-Associated	Host-Associated	37.50%
Engineered	Engineered	0.66%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	59.21%
Plants	Host-Associated → Plants	37.50%
Aquatic	Environmental → Aquatic	2.63%
Wastewater	Engineered → Wastewater	0.66%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	57.89%
Rhizosphere	Host-Associated → Plants → Rhizosphere	25.00%
Rhizoplane	Host-Associated → Plants → Rhizoplane	9.21%
Roots	Host-Associated → Plants → Roots	3.29%
Freshwater	Environmental → Aquatic → Freshwater	1.97%
Cave	Environmental → Terrestrial → Cave	1.32%
Sediment	Environmental → Aquatic → Sediment	0.66%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	0.66%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	50.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	15.13%
Soil	Host-Associated → Plants → Rhizosphere → Soil	9.87%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.92%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	3.29%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.29%
Soil Crust	Environmental → Terrestrial → Soil → Soil Crust	1.97%
Sand	Environmental → Terrestrial → Soil → Sand	1.97%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.32%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	1.32%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.32%
Unclassified	Host-Associated → Plants → Roots → Unclassified	1.32%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.66%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.66%
Loam	Environmental → Terrestrial → Soil → Loam	0.66%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.66%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	0.66%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	40.79%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	15.13%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	9.87%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.92%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	3.29%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.29%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	2.63%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.97%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.97%
Unclassified	Environmental → Terrestrial → Soil → Soil Crust → Unclassified	1.97%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	1.97%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.32%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.32%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	1.32%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.32%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	1.32%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	0.66%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.66%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.66%
Desert	Environmental → Terrestrial → Soil → Unclassified → Desert	0.66%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.66%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.66%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	0.66%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	28.95%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	6.58%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	5.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	5.26%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.95%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	3.29%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	3.29%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	2.63%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.63%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.97%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	1.97%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	1.97%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.97%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.97%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.97%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.32%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.32%
Biocrust	Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust	1.32%
Microbial Mat On Rocks	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks	1.32%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	1.32%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.32%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	1.32%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	1.32%
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	1.32%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.32%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.66%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.66%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	0.66%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.66%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.66%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.66%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.66%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.66%
Sub-Biocrust Soil	Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil	0.66%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.66%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.66%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.66%
Hypolithic Biocrust	Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust	0.66%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.66%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.66%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.66%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.66%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.66%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater	0.66%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300001686	Grasslands soil microbial communities from Hopland, California, USA	Environmental
3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Host-Associated
3300002184	Freshwater and sediment microbial communities from Lake Erie, Canada	Environmental
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental
3300006353	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Host-Associated
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated
3300010051	Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196	Engineered
3300010333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG	Environmental
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300010874	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 3)	Environmental
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated
3300011196	Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 17 - S13.2.60.2.a - transect 2, repeat 2, age 113 years, surface depth)	Environmental
3300011198	Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 7 - S13.1.40.a - transect 1, age 29 years, surface depth)	Environmental
3300011244	Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 18 - S13.2.60.3.a - transect 2, repeat 3, age 113 years, surface depth)	Environmental
3300011443	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2	Environmental
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300012668	Arctic soils microbial communities. Combined Assembly of 23 SPs	Environmental
3300012892	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1	Environmental
3300012943	Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)	Environmental
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated
3300015064	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7B, Adjacent to main proglacial river, mid transect (Watson river))	Environmental
3300015067	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7A, Adjacent to main proglacial river, mid transect (Watson river))	Environmental
3300015069	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4C, Ice margin, adjacent to proglacial lake	Environmental
3300015161	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin)	Environmental
3300015168	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake)	Environmental
3300015189	Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb2a, glacial moraine)	Environmental
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300015374	Col-0 rhizosphere combined assembly	Host-Associated
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated
3300017965	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T	Environmental
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental
3300018465	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS	Environmental
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental
3300019208	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome)	Environmental
3300019360	White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG	Environmental
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental
3300020027	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1	Environmental
3300020034	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2	Environmental
3300020059	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2	Environmental
3300020202	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10	Environmental
3300021061	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5-13C	Environmental
3300021067	Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20-13C	Environmental
3300021339	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1	Environmental
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated
3300026306	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)	Environmental
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated
3300028578	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0	Environmental
3300028590	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30	Environmental
3300028596	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14	Environmental
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental
3300031228	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57	Environmental
3300031229	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38	Environmental
3300031455	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S	Environmental
3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Host-Associated
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated
3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Host-Associated
3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Host-Associated
3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Host-Associated
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental
3300032896	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4	Environmental
3300034006	Biocrust microbial communities from Mojave Desert, California, United States - 30SMC	Environmental
3300034134	Biocrust microbial communities from Mojave Desert, California, United States - 24HNC	Environmental
3300034169	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15	Environmental
3300034195	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17	Environmental
3300034251	Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 43SMS	Environmental
3300034965	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
C688J18823_102036532	3300001686	Soil	MSLSIHNIQALALSVIGAVLASSLFLSAAVGPVPVI*
JGI24739J22299_100581302	3300001989	Corn Rhizosphere	MTISFNTMQSLAISLVGALVASSLFLSAAVGPVPMI*
JGI24770J26754_100186895	3300002184	Freshwater And Sediment	MTVSYNLQKLALSVFGALVASSLFLAAAVGPVPVI*
Ga0068869_1010452721	3300005334	Miscanthus Rhizosphere	RYEMTLSLNSLQTLAFSLVGALVASSLFLSAAVGPVPMI*
Ga0070671_1009380201	3300005355	Switchgrass Rhizosphere	MTYSLNSLQTLAFSLVGALVASSLFLSAAVGPADDLIPLTR
Ga0070672_1005528633	3300005543	Miscanthus Rhizosphere	MSTYANLYNVAFSIVGALFASTLFISAAVGPVQVI*
Ga0070665_10000031769	3300005548	Switchgrass Rhizosphere	MSVSFNLQKLALSVFGALVASSLFLTAALGPVPVI*
Ga0070664_1019602532	3300005564	Corn Rhizosphere	MTLSYNSLQSLALSLVGALVASSLFLSAAVGPVPMI*
Ga0068861_1020953801	3300005719	Switchgrass Rhizosphere	RRYEMTLSINSLQSLAISLVGALVASSLFLSAAVGPVPVI*
Ga0068860_1005040233	3300005843	Switchgrass Rhizosphere	MTVSYNLQKLVLSVFGALVASSLFLTAAVGPVPVI*
Ga0066651_100014421	3300006031	Soil	MTLSIHSLQTLAFSLVGALVASSLFLSAAIGPVPVI*
Ga0075370_103776613	3300006353	Populus Endosphere	MTLSLNSLQTLAFSLVGALVASSLFLSAAVGPVPMI*
Ga0075434_1002652971	3300006871	Populus Rhizosphere	MTLSINSLQTLTISLFGALVASSLFLSAAVGPVPVL*
Ga0079218_133197892	3300007004	Agricultural Soil	MTLSYANLHQIAYSILGALFASSLFISAAVGPVPVI*
Ga0105106_113319301	3300009078	Freshwater Sediment	MSISYANLQSLVVSVIGAVLASSLFISAAGSVPIV*
Ga0111539_115543472	3300009094	Populus Rhizosphere	MKMSIYANLYNVAFSIVGALFASTLFISAAVGPVQVI*
Ga0111539_117059071	3300009094	Populus Rhizosphere	SDGPVARFRRMKMSISYANLYNVAFSIVGALFASSLFISAAVGPVQII*
Ga0105245_100672304	3300009098	Miscanthus Rhizosphere	MSLSINSLQSLAISLVGALVASSLFLSAAVGPVPVI*
Ga0105245_106256042	3300009098	Miscanthus Rhizosphere	MTLSLNSLQTLAFSLVGALVASSLFLSAAMGPVQIV*
Ga0105245_120528082	3300009098	Miscanthus Rhizosphere	MSLSINSLQSLAISLIGALVASSLFLSAAVGPVPVI*
Ga0105243_105142011	3300009148	Miscanthus Rhizosphere	MTLSINSLQSLAISLVGALVASSLFLSAAIGPVPQVL*
Ga0105242_117596053	3300009176	Miscanthus Rhizosphere	MTLSINSLQSLALSFVGALVASSLFLSAAVGPVPTII*
Ga0105249_121500322	3300009553	Switchgrass Rhizosphere	MKMSISYANLYSVAFSIVGALFASSLFISAAVGPVQII*
Ga0133939_10416239	3300010051	Industrial Wastewater	MSVSLPSLQNLTLSVVGAVIASSLFLSAALSSAPIL*
Ga0134080_105102981	3300010333	Grasslands Soil	MTLSLNTLQTLTVSLVGALVASSLFLSAAVGPVPII*
Ga0134125_127286272	3300010371	Terrestrial Soil	MTLSINTMQSLAISLVGALVASSLFLSAAVGPVPAII*
Ga0134127_120388182	3300010399	Terrestrial Soil	MTLSYSNLQSLAVSVVGALLAASLFVSAAVGPVPIV*
Ga0134127_129552941	3300010399	Terrestrial Soil	MTLSINSLQSLAISLVGALVASSLFLSAAVGPVPMI*
Ga0134122_116856362	3300010400	Terrestrial Soil	MSISINSLQSLAISLVGALVASSLFLSAAIGPVPVI*
Ga0134122_120335183	3300010400	Terrestrial Soil	MTLSINTMQSLAISLVGALVASSLFLSAAVGPVPVI*
Ga0134121_105567972	3300010401	Terrestrial Soil	MTLSYSNLQSLAVSVIGAMLAASLFVSAAIGPVPIV*
Ga0136264_103677292	3300010874	Soil	RYQMSLSIQNLQSLAVSLVGAVLVSSLFLSAAMGPVSVI*
Ga0105246_105010112	3300011119	Miscanthus Rhizosphere	MTLSLNSLQSLALSFVGALVASSLFLSAAVGPVPMI*
Ga0137482_1003345	3300011196	Glacier Forefield Soil	MTLSYSNLQQLAVSLIGAIVASSLFISAAVGPVPIV*
Ga0137472_1007533	3300011198	Glacier Forefield Soil	MTLSINLQKLALSVFGALVASSLFISAAVGPVSVI*
Ga0137483_1025243	3300011244	Glacier Forefield Soil	MSISLTSLQSLAVSLIGAIVASSLLLSAAMGPVPIV*
Ga0137457_11044952	3300011443	Soil	MKMSIYANLYNVAFSIVGALFASSLFISAAVGPVPVI*
Ga0137376_113774842	3300012208	Vadose Zone Soil	MTLSLNSLQTLAFSLVGALVASSLFLSAAMGPVQII*
Ga0150985_1047760443	3300012212	Avena Fatua Rhizosphere	MTLSLNTLQTLTVSLVGALVASSLFLSAAIGPVPII*
Ga0150985_1204761944	3300012212	Avena Fatua Rhizosphere	MTLSLNTMQSLALSLVGALVASSLFLSAAMGPVQIV*
Ga0157216_100098487	3300012668	Glacier Forefield Soil	MSLSIHGLQSLAISMIGAVFASSLFLSAALSSAPVI*
Ga0157294_102268271	3300012892	Soil	MTLSYSNLQALTVSVVGALLAASLFVSAAVGPVPIV*
Ga0164241_101899841	3300012943	Soil	MTVSYNLQKLLLSAFGALVASSLFLTAAMGPVPVI*
Ga0164299_111780931	3300012958	Soil	MTLSINTLQTLTVSLVGALVASSLFLSAVIGPVSMV*
Ga0164305_104807062	3300012989	Soil	MTVSYNLQKLALSVFGALVASSLFLTAAVGPVPVI*
Ga0157378_127459341	3300013297	Miscanthus Rhizosphere	MSLSINGLQSLAISLIGALVASSLFLSAAVGPVPVI*
Ga0157375_112483581	3300013308	Miscanthus Rhizosphere	MTLSLNSLQTLAFSLVGALVASSLFLSAAMGPVQVV*
Ga0163163_118103421	3300014325	Switchgrass Rhizosphere	MTLSYNSLQSLALSLVGALVASSLFLSAAVGPVPVI*
Ga0163163_118588451	3300014325	Switchgrass Rhizosphere	MTYSLNSLQTLAFSLVGALVASSHFLSAAVGPVPMI*
Ga0157380_109580631	3300014326	Switchgrass Rhizosphere	MSITFNLQKLALSVFGALVASSLFLTAAVGPVPVI*
Ga0157376_116376361	3300014969	Miscanthus Rhizosphere	SRSRRYEMTLSLNSLQTLAFSLVGALVASSLFLSAAVGPVPMI*
Ga0167641_1092161	3300015064	Glacier Forefield Soil	MSLSIHSLQSLAISLVGAIVASSLFLSAAVGPVPVI*
Ga0167640_1097194	3300015067	Glacier Forefield Soil	MTLSFNMQKLALSVFGALLASSLFLSAAIGPVPVI*
Ga0167633_10012015	3300015069	Glacier Forefield Soil	MTLSFNLQQLAVSVIGALLASSLFISAAIGPVPII*
Ga0167623_10559933	3300015161	Glacier Forefield Soil	MSLSIQSLQSLAISLIGAFVASSLFLSAAIGPVPVI*
Ga0167631_10292172	3300015168	Glacier Forefield Soil	MTLSFNMQKLALSVFGALVASSLFLSAAIGPVPIA*
Ga0167667_10056274	3300015189	Glacier Forefield Soil	MTLSINLQKLTLSVFGALVASSLFISAAVGPVPVI*
Ga0132258_107315653	3300015371	Arabidopsis Rhizosphere	MSISIHSLQTMAVSLIGALVASSLFLSAAVGPVPVI*
Ga0132258_114892923	3300015371	Arabidopsis Rhizosphere	MSISIHNLQTMAVSLIGALVASSLFLSAAVGPVPVI*
Ga0132255_1028680472	3300015374	Arabidopsis Rhizosphere	MTLSLNSLQTLAFSLVGALVASSLFLSAAVGPVPII*
Ga0163161_109373662	3300017792	Switchgrass Rhizosphere	MTVSYNLQKLVLSVFGALVASSLFLTAAMGPVQVI
Ga0190266_1000052813	3300017965	Soil	MTLSIHSLQTMAFSLIGALVASSLFLSAAIGPVPVI
Ga0190265_1000020057	3300018422	Soil	MTLSFNIQQLAFSVIGALVASSLFISAAVGPVPVI
Ga0190265_100013174	3300018422	Soil	MTFSYANIQQMALSVIGALVASSLFISAAVGPVPIL
Ga0190265_1000283219	3300018422	Soil	MTLSFNSLQQLVVSAIGAVLVSTLFISAAIGPVPIV
Ga0190265_100569313	3300018422	Soil	MTLSFNLQQLAVSVIGALVASSLFISAAVGPVPII
Ga0190265_100985955	3300018422	Soil	MTLNLTSLQQIAFSVVGALFASSLFLTAAIGPVPIV
Ga0190265_102336223	3300018422	Soil	MTLSYSTLQQLAVSVIGALVASSLFISAAIGPVPII
Ga0190265_105804254	3300018422	Soil	MTISLNIQQLAVSLIGALVASSLFISAAVGPVPVI
Ga0190265_106666331	3300018422	Soil	MSVSFNLQKLALSVFGALVASSLFLTAAVGPVPIV
Ga0190265_107762961	3300018422	Soil	MSLSIHSLQSLAISLIGAVFASSLFLSAALSSAPVI
Ga0190265_108228552	3300018422	Soil	MTLSYANLHQIAYSILGALFASSLFISAAVGPVPVI
Ga0190265_108662542	3300018422	Soil	MTLSYASLHQIAFSVLGALFASTLFISAAVGPVPVI
Ga0190272_100609344	3300018429	Soil	MTLSINLQKLALSVFGALVASSLFLSAAVGPAQVI
Ga0190272_102132733	3300018429	Soil	MTLSYNMQQLALSVIGALVASSLFISAAVGPVPVI
Ga0190272_102273133	3300018429	Soil	MTLSLNIQQLAVSVLGALVASSLFISAAVGPVPVI
Ga0190272_104485573	3300018429	Soil	MTLSYSNLQQLAVSLIGAIVASSLFISAAVGPVPIV
Ga0190272_107388231	3300018429	Soil	MTVSLNLQKLALSVFGALVASSLFLTAAVGPVPVI
Ga0190272_109961483	3300018429	Soil	MTMSYNFSQLMVSLVGALIASSLFITAAVGPVPII
Ga0190272_115812232	3300018429	Soil	MTLSYANMQQLALSVIGALVASSLFISAAVGPVPII
Ga0190272_119276283	3300018429	Soil	TMTLSINLQKLALSVFGALVASSLFLSAAVGPVQVI
Ga0190275_10000015152	3300018432	Soil	MTLSINLQKLALSVFGAIVASSLFLSAAVGPVQVI
Ga0190275_1000035234	3300018432	Soil	MSLSIHSLQSLAISLIGAVFASSLFLSAALSSASVI
Ga0190269_101567692	3300018465	Soil	MTVTSNLQKLALSVFGALVASSLFLTAAVGPVPVI
Ga0190270_120840852	3300018469	Soil	MSISYANLQSLVVSVIGAVLASSLFISAAGSVPIV
Ga0190274_100002202	3300018476	Soil	MTLSFNNLQQLAASVIGAVLVSTLFISAAIGPVPIV
Ga0190274_106429891	3300018476	Soil	WRPKMTLTYANLQKITFSIVGALVASSLFLSAAVGPVPFV
Ga0190274_116633862	3300018476	Soil	MTLSYSNLQALTVSVVGALLAASLFVSAAVGPVPII
Ga0190271_113575112	3300018481	Soil	MKMSIYANLQHVALSIVGALLASSLFISAAVGPVPVI
Ga0190273_118225551	3300018920	Soil	MTLSYDKLHRIAFSVLGALFASSLFISAAVGPVPVI
Ga0180110_10978743	3300019208	Groundwater Sediment	GPVARFRRMKMSIYANLYNVAFSIVGALFASSLFISAAVGPVQVI
Ga0187894_10000007171	3300019360	Microbial Mat On Rocks	MTIYANLQSLALSVVGAIVASSLFITAAVGPVPVI
Ga0187894_1000039837	3300019360	Microbial Mat On Rocks	MSVSINLQKLALSVFGALVASSLFLTAAVGPVPVI
Ga0173482_104427712	3300019361	Soil	MKMSIYANLYNVAFSIVGALFASTLFISAAVGPVQVI
Ga0190264_100930472	3300019377	Soil	MTISLNLQQLALSVIGALVASSLFISAAVGPVPVV
Ga0193752_10116995	3300020027	Soil	MTISFNLQQLAVSVIGALLASSLFISAAVGPVPII
Ga0193752_11223791	3300020027	Soil	MTLSINLQKLALSVFGAVVASSLFLSAAVGPGQII
Ga0193752_11828754	3300020027	Soil	MTLSINSLQTLAFSLIGALVASSLFLSAAVGPVPVI
Ga0193753_101625784	3300020034	Soil	MTVTINTMQSLAISLFGALVATSLFLSAAVGPAPVL
Ga0193745_100000567	3300020059	Soil	MSLSIHSLQSLAISLVGAIVASSLFLSAAVGPVPVI
Ga0196964_101025253	3300020202	Soil	MTLSYTFSQLMVSAIGALVASSLFISAAVGPVPVI
Ga0196973_10567562	3300021061	Soil	MSLSYANLQALALSVVGAIIASSLFVSAAVGPVPIV
Ga0196978_10018569	3300021067	Soil	MTLSYDNMHRIAFSVLGALFASTLFISAAVGPVPVI
Ga0193706_11299712	3300021339	Soil	MTLSINLQKLALSVFGALVASSLFISAAVGPVPII
Ga0207697_102274273	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MTVSYNLQKLALSVFGALVASSLFLTAAVGPVPVI
Ga0207682_1000099810	3300025893	Miscanthus Rhizosphere	MTLSFNNLQQLAASVIGAVLVSTLFISAAVGPVPII
Ga0207682_101627851	3300025893	Miscanthus Rhizosphere	MTLSIHSLQTMAFSLVGALVASSLFLSAAIGPVPVI
Ga0207688_102944032	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	MTVSYNLQKLVLSVFGALVASSLFLTAAVGPVPVI
Ga0207680_110505783	3300025903	Switchgrass Rhizosphere	MTLSLNSLQTLAFSLVGALVASSLFLSAAMGPVQIV
Ga0207645_104652052	3300025907	Miscanthus Rhizosphere	MSLSINSLQSLAISLVGALVASSLFLSAAVGPVPVI
Ga0207681_103189464	3300025923	Switchgrass Rhizosphere	MTLSIHGLQTLAFSLVGALVASSLFLSAAIGPVPVL
Ga0207681_107497742	3300025923	Switchgrass Rhizosphere	MSVSINLQKLAISVFGALVASSLFLTAAVGPVPVI
Ga0207659_110105232	3300025926	Miscanthus Rhizosphere	MTVSHNLQKLALSVFGALVASSLFLTAAVGPVPVI
Ga0207687_112264192	3300025927	Miscanthus Rhizosphere	MSLSINSLQSLAISLIGALVASSLFLSAAVGPVPVI
Ga0207701_112849022	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	MSIYANLYNVAFSIVGALFASTLFISAAVGPVQII
Ga0207709_102732562	3300025935	Miscanthus Rhizosphere	MTLSINSLQSLAISLVGALVASSLFLSAAIGPVPQVL
Ga0207711_104910351	3300025941	Switchgrass Rhizosphere	MTLSYNSLQSLALSLVGALVASSLFLSAAMGPVQVV
Ga0207689_101728443	3300025942	Miscanthus Rhizosphere	MTLSLNSLQTLAFSLVGALVASSLFLSAAVGPVPMI
Ga0207651_103295143	3300025960	Switchgrass Rhizosphere	MSLSIQSLQSLAISLVGALVASSLFLSAAVGPVPVI
Ga0207668_101541252	3300025972	Switchgrass Rhizosphere	MTVSYNLQKLALSVFGALVASSLFLAAAVGPVQVI
Ga0209468_10053067	3300026306	Soil	MTLSIHSLQTLAFSLVGALVASSLFLSAAIGPVPVI
Ga0207428_112115711	3300027907	Populus Rhizosphere	ARFRRMKMSISYANLYNVAFSIVGALFASSLFISAAVGPVQII
Ga0268266_100003889	3300028379	Switchgrass Rhizosphere	MSVSFNLQKLALSVFGALVASSLFLTAALGPVPVI
Ga0268266_1000048957	3300028379	Switchgrass Rhizosphere	MTLSINTLQTLTISVFGALLASSLFLSAVIGPVSMV
Ga0268265_103901553	3300028380	Switchgrass Rhizosphere	MSTYANLYNVAFSIVGALFASTLFISAAVGPVQVI
Ga0272482_100139602	3300028578	Soil	MTISLNIQQLAVSLIGALVASSLFISAAVGPVPII
Ga0272482_100776022	3300028578	Soil	MTLSYANLHQIAFSVFGALFASMLFISAAVGPVPVI
Ga0247823_106270821	3300028590	Soil	MSVSFNLQKLALSVFGALVASSLFLTAAVGPVPVI
Ga0247821_103107063	3300028596	Soil	MSIYANLHQIALSVVGALVASSLFITAAVSSAPVI
Ga0307503_10000015168	3300028802	Soil	MTLSINLQKLAVSVFGALVASSLFLSAAIGPVQIV
Ga0299914_105226754	3300031228	Soil	MTLSFANLHQTALSIVGALFASTLFVSAAVGSVPVI
Ga0299913_100039627	3300031229	Soil	MTLSFANLHQIALSIVGALFASSLFLSAAVGPVPVI
Ga0307505_100305633	3300031455	Soil	MSISFNLQQIAVSVIGALVASSLFISAAVGPVPII
Ga0307505_103464432	3300031455	Soil	MTLSYNFSQLMVSVMGALIASSLFISAAVGPVPVI
Ga0307513_101674172	3300031456	Ectomycorrhiza	MTLSYSNLQSLAVSVVGALFAASLFVSAAVGPVPIV
Ga0307513_104840522	3300031456	Ectomycorrhiza	MTLSYSNLQALTVSVVGALLAASLFVSAAVGPVPIV
Ga0307408_1007177792	3300031548	Rhizosphere	MTLSYTFSQLMVSVMGALIASSLFISAAVGPVPVI
Ga0307413_100598684	3300031824	Rhizosphere	MTFSYISLQQLALSIFAAVVTSSLLISAAVGPVPVI
Ga0307414_103710811	3300032004	Rhizosphere	MTLSYISLQQLAISIVGAVLASSLFISAAVGPVPLI
Ga0307414_109798101	3300032004	Rhizosphere	MTLSYINLQQLALSIVGAVVASSLFISAAVGPVPVI
Ga0307411_107412831	3300032005	Rhizosphere	MTVSFNLQKLALSVFGALVASSLFLTAAAGPVLVA
Ga0310890_113866583	3300032075	Soil	MSISYANLYSVAFSIVGALFASTLFISAAVGPVQVI
Ga0307472_1003345472	3300032205	Hardwood Forest Soil	MSLSIHSLQTMAVSLIGALVASSLFLSAAVGPVPVI
Ga0335075_100000674	3300032896	Soil	MSITFNLQKLALSVFGAVVASSLFLAAAVGPVPVI
Ga0335075_107231772	3300032896	Soil	MIASVNLQQLAVSVIGALVASSLFLSAAIGPVPVI
Ga0334934_006018_468_578	3300034006	Biocrust	MTLSYANLHRLALSVVGALFASTMFITAAVGPVPVI
Ga0334934_016257_839_949	3300034006	Biocrust	MTLSYDNFHRIAFSIVGALLASSLFVSAAVGPVPVI
Ga0334928_138934_243_356	3300034134	Hypolithic Biocrust	MTFNFSNLQQIAISAVGALLAASLFLSAAAGPVVQFV
Ga0370480_0253804_88_195	3300034169	Untreated Peat Soil	MTISYNLQQLAVSVIGALLASSLFISAAIGPVAIV
Ga0370501_0386833_198_308	3300034195	Untreated Peat Soil	MTLSLNGLQTLAFSLVGALVASSLFLSAAMGPVQIV
Ga0334947_001471_5299_5406	3300034251	Sub-Biocrust Soil	MTLSYNFPQLMVSLVGALVASSLFISAAVGPVPVI
Ga0370497_0000001_223177_223284	3300034965	Untreated Peat Soil	MTLSINLQKLALSAFGALVASTLFLSAAIGPVQVI