Metagenome / Metatranscriptome Family F044151

Overview

Basic Information

• Family ID: F044151
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 155
• Average Sequence Length: 41 residues
• Representative Sequence: ALYFLEPMLIELGLGTSFDERDRLASDEPNVNLTSPT
• Number of Associated Samples: 138
• Number of Associated Scaffolds: 155

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 6.49 %
• % of genes near scaffold ends (potentially truncated): 83.87 %
• % of genes from short scaffolds (< 2000 bps): 85.16 %
• Associated GOLD sequencing projects: 133
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.24

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (56.129 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater (19.355 % of family members)
• Environment Ontology (ENVO): Unclassified (31.613 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline) (69.032 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 23.08%
  β-sheet: 0.00%
  Coil/Unstructured: 76.92%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 155 Family Scaffolds
PF01925	TauE	23.87
PF10370	DUF2437	17.42
PF05164	ZapA	12.26
PF01878	EVE	7.74
PF01165	Ribosomal_S21	5.16
PF02558	ApbA	4.52
PF07715	Plug	2.58
PF03401	TctC	1.94
PF01882	DUF58	1.94
PF08546	ApbA_C	1.94
PF09424	YqeY	1.94
PF00550	PP-binding	1.29
PF00990	GGDEF	1.29
PF01032	FecCD	1.29
PF13386	DsbD_2	1.29
PF13193	AMP-binding_C	0.65
PF04402	SIMPL	0.65
PF02417	Chromate_transp	0.65
PF13406	SLT_2	0.65
PF01497	Peripla_BP_2	0.65
PF02537	CRCB	0.65
PF02954	HTH_8	0.65
PF03737	RraA-like	0.65
PF03060	NMO	0.65
PF00365	PFK	0.65
PF00887	ACBP	0.65
PF04273	BLH_phosphatase	0.65
PF03028	Dynein_heavy	0.65
PF00581	Rhodanese	0.65
PF01557	FAA_hydrolase	0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 155 Family Scaffolds
COG0730	Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family	Inorganic ion transport and metabolism [P]	23.87
COG3027	Cell division protein ZapA, inhibits GTPase activity of FtsZ	Cell cycle control, cell division, chromosome partitioning [D]	12.26
COG1673	Predicted RNA-binding protein, contains PUA-like EVE domain	General function prediction only [R]	7.74
COG2947	Predicted RNA-binding protein, contains EVE domain	General function prediction only [R]	7.74
COG0828	Ribosomal protein S21	Translation, ribosomal structure and biogenesis [J]	5.16
COG1721	Uncharacterized conserved protein, DUF58 family, contains vWF domain	Function unknown [S]	1.94
COG1893	Ketopantoate reductase	Coenzyme transport and metabolism [H]	1.94
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	1.94
COG2859	Outer membrane channel-forming protein BP26/OMP28, SIMPL family	Cell wall/membrane/envelope biogenesis [M]	0.65
COG4607	ABC-type enterochelin transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.65
COG4594	ABC-type Fe3+-citrate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.65
COG4592	ABC-type Fe2+-enterobactin transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.65
COG4558	ABC-type hemin transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.65
COG4281	Acyl-CoA-binding protein	Lipid transport and metabolism [I]	0.65
COG3471	Predicted secreted (periplasmic) protein	Function unknown [S]	0.65
COG3453	Predicted phosphohydrolase, protein tyrosine phosphatase (PTP) superfamily, DUF442 family	General function prediction only [R]	0.65
COG2968	Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain	Function unknown [S]	0.65
COG0205	6-phosphofructokinase	Carbohydrate transport and metabolism [G]	0.65
COG2070	NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family	General function prediction only [R]	0.65
COG2059	Chromate transport protein ChrA	Inorganic ion transport and metabolism [P]	0.65
COG0684	RNA degradosome component RraA (regulator of RNase E activity)	Translation, ribosomal structure and biogenesis [J]	0.65
COG0614	ABC-type Fe3+-hydroxamate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.65
COG0516	IMP dehydrogenase/GMP reductase	Nucleotide transport and metabolism [F]	0.65
COG0239	Fluoride ion exporter CrcB/FEX, affects chromosome condensation	Cell cycle control, cell division, chromosome partitioning [D]	0.65

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	58.06 %
Unclassified	root	N/A	41.94 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	58.06 %
Unclassified	root	N/A	41.94 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	56.13 %
Unclassified	root	N/A	41.94 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	1.94 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	52.26 %
Unclassified	root	N/A	41.94 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.65 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.65 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 5

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	48.39 %
Unclassified	root	N/A	41.94 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.94 %
Alveolata	clade	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata	0.65 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.65 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 6

Name	Rank	Taxonomy	Distribution
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	43.87 %
Unclassified	root	N/A	41.94 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.65 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.65 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.65 %
Ciliophora	phylum	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.94 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	23.23 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.65 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.65 %
Intramacronucleata	subphylum	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata	0.65 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.65 %
unclassified Burkholderiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales	0.65 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.94 %
Limnohabitans	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans	10.97 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.65 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.65 %
Spirotrichea	class	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	0.65 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.65 %
Acidovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax	0.65 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.65 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.94 %
unclassified Limnohabitans	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans	10.97 %
Cupriavidus taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis	0.65 %
Stichotrichia	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia	0.65 %
Methylobacterium soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium soli	0.65 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.65 %
Acidovorax avenae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax avenae	0.65 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.65 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.94 %
Limnohabitans sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	7.10 %
Limnohabitans sp. Rim28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	3.87 %
Sporadotrichida	order	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida	0.65 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.65 %
Cupriavidus taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis	0.65 %
Methylobacterium soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium soli	0.65 %
Acidovorax avenae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax avenae	0.65 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.65 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.94 %
Limnohabitans sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	7.10 %
Limnohabitans sp. Rim28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	3.87 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.65 %
Oxytrichidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	0.65 %
Cupriavidus taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis	0.65 %
Methylobacterium soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium soli	0.65 %
Acidovorax avenae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax avenae	0.65 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.65 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.94 %
Limnohabitans sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	7.10 %
Limnohabitans sp. Rim28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	3.87 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.65 %
Oxytrichidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	0.65 %
Cupriavidus taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis	0.65 %
Methylobacterium soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium soli	0.65 %
Acidovorax avenae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax avenae	0.65 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.65 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.94 %
Limnohabitans sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	7.10 %
Limnohabitans sp. Rim28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	3.87 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.65 %
Oxytrichidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	0.65 %
Cupriavidus taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis	0.65 %
Methylobacterium soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium soli	0.65 %
Acidovorax avenae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax avenae	0.65 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.65 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.94 %
Limnohabitans sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	7.10 %
Limnohabitans sp. Rim28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	3.87 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.65 %
Oxytrichidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	0.65 %
Cupriavidus taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis	0.65 %
Methylobacterium soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium soli	0.65 %
Acidovorax avenae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax avenae	0.65 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.65 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.94 %
Limnohabitans sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	7.10 %
Limnohabitans sp. Rim28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	3.87 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.65 %
Oxytrichidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	0.65 %
Cupriavidus taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis	0.65 %
Methylobacterium soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium soli	0.65 %
Acidovorax avenae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax avenae	0.65 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.65 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.94 %
Limnohabitans sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	7.10 %
Limnohabitans sp. Rim28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	3.87 %
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	0.65 %
Oxytrichidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	0.65 %
Cupriavidus taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis	0.65 %
Methylobacterium soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium soli	0.65 %
Acidovorax avenae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax avenae	0.65 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.65 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.94 %
Limnohabitans sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	7.10 %
Limnohabitans sp. Rim28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	3.87 %
campanulids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids	0.65 %
Oxytrichidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	0.65 %
Cupriavidus taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis	0.65 %
Methylobacterium soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium soli	0.65 %
Acidovorax avenae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax avenae	0.65 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.65 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.94 %
Limnohabitans sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	7.10 %
Limnohabitans sp. Rim28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	3.87 %
Asterales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales	0.65 %
Oxytrichidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	0.65 %
Cupriavidus taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis	0.65 %
Methylobacterium soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium soli	0.65 %
Acidovorax avenae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax avenae	0.65 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.65 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.94 %
Limnohabitans sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	7.10 %
Limnohabitans sp. Rim28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	3.87 %
Asteraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae	0.65 %
Oxytrichidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	0.65 %
Cupriavidus taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis	0.65 %
Methylobacterium soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium soli	0.65 %
Acidovorax avenae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax avenae	0.65 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.65 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.94 %
Limnohabitans sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	7.10 %
Limnohabitans sp. Rim28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	3.87 %
Asteroideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae	0.65 %
Oxytrichidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	0.65 %
Cupriavidus taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis	0.65 %
Methylobacterium soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium soli	0.65 %
Acidovorax avenae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax avenae	0.65 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.65 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.94 %
Limnohabitans sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	7.10 %
Limnohabitans sp. Rim28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	3.87 %
Anthemideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae	0.65 %
Oxytrichidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	0.65 %
Cupriavidus taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis	0.65 %
Methylobacterium soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium soli	0.65 %
Acidovorax avenae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax avenae	0.65 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.65 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.94 %
Limnohabitans sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	7.10 %
Limnohabitans sp. Rim28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	3.87 %
Anthemidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae	0.65 %
Oxytrichidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	0.65 %
Cupriavidus taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis	0.65 %
Methylobacterium soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium soli	0.65 %
Acidovorax avenae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax avenae	0.65 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.65 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.94 %
Limnohabitans sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	7.10 %
Limnohabitans sp. Rim28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	3.87 %
Tanacetum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum	0.65 %
Oxytrichidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	0.65 %
Cupriavidus taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis	0.65 %
Methylobacterium soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium soli	0.65 %
Acidovorax avenae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax avenae	0.65 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.65 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.94 %
Limnohabitans sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	7.10 %
Limnohabitans sp. Rim28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	3.87 %
Tanacetum cinerariifolium	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	0.65 %
Oxytrichidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	0.65 %
Cupriavidus taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis	0.65 %
Methylobacterium soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium soli	0.65 %
Acidovorax avenae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax avenae	0.65 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.65 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300000268|M3P_10032237	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1830
3300001839|RCM40_1034068	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium soli	818
3300002132|M2t6BS2_1423370	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	714879
3300003493|JGI25923J51411_1011568	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	1899
3300004766|Ga0007747_1031278	Not Available	607
3300004786|Ga0007753_1494908	Not Available	518
3300005581|Ga0049081_10047041	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	1635
3300005660|Ga0073904_10274192	Not Available	964
3300005662|Ga0078894_10235539	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1659
3300005662|Ga0078894_10746543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	860
3300005758|Ga0078117_1080123	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1238
3300005833|Ga0074472_10790192	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1662
3300006040|Ga0073914_10121846	Not Available	524
3300006056|Ga0075163_10309225	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1795
3300006164|Ga0075441_10052186	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1620
3300006381|Ga0079102_1034162	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	836
3300006638|Ga0075522_10389063	All Organisms → cellular organisms → Bacteria → Proteobacteria	661
3300006949|Ga0075528_10226055	Not Available	510
3300007214|Ga0103959_1053231	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2188
3300007544|Ga0102861_1045711	Not Available	1132
3300007597|Ga0102919_1204083	Not Available	618
3300007627|Ga0102869_1178803	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	570
3300007642|Ga0102876_1159470	Not Available	603
3300008072|Ga0110929_1104826	Not Available	617
3300009151|Ga0114962_10565630	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	594
3300009154|Ga0114963_10165681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1301
3300009160|Ga0114981_10123911	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1430
3300009161|Ga0114966_10138585	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1594
3300009163|Ga0114970_10110615	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	1690
3300009164|Ga0114975_10261588	Not Available	966
3300009164|Ga0114975_10749287	Not Available	514
3300009169|Ga0105097_10180985	Not Available	1160
3300009180|Ga0114979_10437807	Not Available	761
3300009455|Ga0114939_10117990	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1124
3300009527|Ga0114942_1054542	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1235
3300009774|Ga0123339_10480959	All Organisms → cellular organisms → Bacteria	522
3300009787|Ga0116226_10104073	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2936
3300009787|Ga0116226_10203225	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2057
3300010051|Ga0133939_1000830	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	153195
3300010134|Ga0127484_1169149	All Organisms → cellular organisms → Eukaryota → Opisthokonta	633
3300010885|Ga0133913_10712056	Not Available	2625
3300010885|Ga0133913_12231507	Not Available	1348
3300011009|Ga0129318_10243993	Not Available	591
3300011340|Ga0151652_13230566	Not Available	667
3300012212|Ga0150985_105757923	Not Available	615
3300012212|Ga0150985_109479538	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	716
3300012212|Ga0150985_111003545	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	581
3300012345|Ga0157139_1001286	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	1157
3300012688|Ga0157541_1018611	Not Available	542
3300012688|Ga0157541_1125325	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	1173
3300012702|Ga0157596_1027279	Not Available	764
3300012712|Ga0157598_1003894	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	720
3300012715|Ga0157599_1245430	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	698
3300012718|Ga0157557_1211509	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	1547
3300012719|Ga0157600_1186539	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	579
3300012720|Ga0157613_1198238	Not Available	638
3300012724|Ga0157611_1245168	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	794
3300012727|Ga0157531_1117210	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	1072
3300012731|Ga0157616_1272107	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	757
3300012734|Ga0157615_1008449	All Organisms → cellular organisms → Bacteria	530
3300012772|Ga0138287_1120599	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	559
3300012773|Ga0138290_1270051	Not Available	660
3300012778|Ga0138269_1396765	Not Available	543
3300012783|Ga0157524_134316	All Organisms → cellular organisms → Bacteria	569
3300013286|Ga0136641_1213138	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax avenae	509
3300013295|Ga0170791_13558592	Not Available	710
3300014297|Ga0075306_1080257	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	598
3300014319|Ga0075348_1172186	All Organisms → cellular organisms → Bacteria → Proteobacteria	585
3300015201|Ga0173478_10231291	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	796
3300016694|Ga0180051_1151620	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	542
3300020048|Ga0207193_1223457	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	1457
3300020167|Ga0194035_1149191	Not Available	735
3300020407|Ga0211575_10307465	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	657
3300020489|Ga0207910_109261	Not Available	1085
3300021072|Ga0194057_10126410	Not Available	920
3300021323|Ga0210295_1136799	All Organisms → cellular organisms → Bacteria	563
3300021440|Ga0213919_1005868	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	3284
3300021516|Ga0194045_1031629	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1377
3300021516|Ga0194045_1118337	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	659
3300021519|Ga0194048_10067432	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1413
3300021859|Ga0210334_10011750	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis	787
3300021952|Ga0213921_1005454	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	2576
3300022147|Ga0213930_107648	Not Available	769
3300022147|Ga0213930_109555	Not Available	700
3300022156|Ga0213934_1022113	Not Available	843
3300022156|Ga0213934_1066700	Not Available	512
3300022213|Ga0224500_10001944	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	11629
3300022748|Ga0228702_1085992	Not Available	763
3300023174|Ga0214921_10001900	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	34986
3300023174|Ga0214921_10451219	Not Available	633
3300023300|Ga0256702_12451605	Not Available	569
3300023311|Ga0256681_12574576	Not Available	721
3300023697|Ga0228706_1042691	Not Available	571
3300023700|Ga0228707_1027196	Not Available	822
3300023700|Ga0228707_1033722	Not Available	735
3300023703|Ga0228708_1014658	Not Available	1178
3300024481|Ga0256330_1085993	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	665
3300024501|Ga0255208_1004842	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2566
3300024534|Ga0256357_1011340	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	1689
3300024542|Ga0256350_1092607	Not Available	540
3300024553|Ga0255301_1016077	Not Available	1354
3300024561|Ga0255288_1016630	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	1630
3300024561|Ga0255288_1082963	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	718
3300024563|Ga0255236_1006609	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	2604
3300024568|Ga0255238_1001678	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	4794
3300024569|Ga0255243_1032427	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	1348
3300024569|Ga0255243_1094052	Not Available	740
3300024573|Ga0256337_1181923	Not Available	521
3300024854|Ga0255287_1063135	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	840
3300024857|Ga0256339_1087232	Not Available	645
3300024857|Ga0256339_1096749	Not Available	607
3300024968|Ga0208264_1032678	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	804
3300025435|Ga0208618_1021969	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1268
3300025489|Ga0208611_10530	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	4648
3300025753|Ga0255235_1014765	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	1192
3300025763|Ga0255250_1033022	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp.	1126
3300025896|Ga0208916_10204863	Not Available	854
3300026072|Ga0208292_1058736	All Organisms → cellular organisms → Bacteria → Proteobacteria	505
3300026410|Ga0256325_1031788	Not Available	753
3300026425|Ga0256300_1036612	Not Available	694
3300026566|Ga0256334_1124343	Not Available	586
3300026570|Ga0255274_1112430	Not Available	693
3300027295|Ga0255126_1012689	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	2190
3300027299|Ga0255124_1016545	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	1454
3300027300|Ga0255140_1002703	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28	4681
3300027487|Ga0255091_1030446	Not Available	923
3300027708|Ga0209188_1003812	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	10185
3300027708|Ga0209188_1020542	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	3391
3300027714|Ga0209815_1037668	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1837
3300027721|Ga0209492_1198198	Not Available	690
3300027754|Ga0209596_1179556	Not Available	918
3300027806|Ga0209985_10304360	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	719
3300027831|Ga0209797_10004241	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	7037
3300027910|Ga0209583_10403448	Not Available	651
3300027969|Ga0209191_1260813	Not Available	656
3300027971|Ga0209401_1069026	Not Available	1537
3300027974|Ga0209299_1093804	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1184
3300028077|Ga0256323_1020045	Not Available	1010
3300028080|Ga0256324_1048149	Not Available	632
3300028267|Ga0256358_1082373	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	633
3300028271|Ga0255256_1076280	Not Available	586
3300028286|Ga0256331_1108657	Not Available	627
3300028813|Ga0302157_10002395	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	21886
3300028813|Ga0302157_10007023	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	11455
3300029907|Ga0311329_10004765	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	12866
3300031852|Ga0307410_11696843	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	560
3300031902|Ga0302322_100857492	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1087
3300031951|Ga0315904_11257574	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	563
3300032050|Ga0315906_10420028	Not Available	1158
3300032116|Ga0315903_10471776	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1000
3300033984|Ga0334989_0235931	Not Available	995
3300034060|Ga0334983_0124643	All Organisms → cellular organisms → Bacteria	1645
3300034096|Ga0335025_0433601	Not Available	673
3300034168|Ga0335061_0598445	Not Available	554

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	92.90%
Engineered	Engineered	3.23%
Host-Associated	Host-Associated	3.87%

Class

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	84.52%
Terrestrial	Environmental → Terrestrial	8.39%
Plants	Host-Associated → Plants	3.87%
Wastewater	Engineered → Wastewater	2.58%
Bioreactor	Engineered → Bioreactor	0.65%

Category

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	74.84%
Marine	Environmental → Aquatic → Marine	7.74%
Soil	Environmental → Terrestrial → Soil	5.16%
Peat	Environmental → Terrestrial → Peat	2.58%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.94%
Sediment	Environmental → Aquatic → Sediment	1.29%
Peat Moss	Host-Associated → Plants → Peat Moss	1.29%
Unclassified	Environmental → Aquatic → Unclassified	0.65%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	0.65%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.65%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.65%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	0.65%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	0.65%
Nutrient Removal	Engineered → Wastewater → Nutrient Removal	0.65%
Aerobic	Engineered → Bioreactor → Aerobic	0.65%

Type

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	32.90%
River	Environmental → Aquatic → Freshwater → River	19.35%
Creek	Environmental → Aquatic → Freshwater → Creek	7.10%
Lentic	Environmental → Aquatic → Freshwater → Lentic	5.81%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	3.87%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	2.58%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	2.58%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	2.58%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.94%
Lotic	Environmental → Aquatic → Freshwater → Lotic	1.94%
Unclassified	Environmental → Aquatic → Marine → Unclassified	1.94%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.94%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.94%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.29%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	1.29%
Coastal	Environmental → Aquatic → Marine → Coastal	1.29%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.29%
Unclassified	Host-Associated → Plants → Peat Moss → Unclassified	1.29%
Ice	Environmental → Aquatic → Freshwater → Ice	0.65%
Sediment	Environmental → Aquatic → Marine → Sediment	0.65%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified	0.65%
Sand	Environmental → Terrestrial → Soil → Sand	0.65%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	0.65%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.65%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.65%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	0.65%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	0.65%
Unclassified	Engineered → Wastewater → Nutrient Removal → Unclassified	0.65%
Unclassified	Engineered → Bioreactor → Aerobic → Unclassified	0.65%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	32.26%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	19.35%
Unclassified	Environmental → Aquatic → Freshwater → Creek → Unclassified	7.10%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	5.16%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	3.87%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	2.58%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	2.58%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.94%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	1.94%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	1.94%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.94%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.94%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	1.29%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	1.29%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.29%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.29%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	1.29%
Unclassified	Host-Associated → Plants → Peat Moss → Unclassified → Unclassified	1.29%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	0.65%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.65%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.65%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.65%
Glacier	Environmental → Aquatic → Freshwater → Ice → Glacier	0.65%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	0.65%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified → Unclassified	0.65%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.65%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	0.65%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.65%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.65%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	0.65%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	0.65%
Unclassified	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified	0.65%
Unclassified	Engineered → Bioreactor → Aerobic → Unclassified → Unclassified	0.65%

Habitat

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	19.35%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	12.90%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	12.90%
Freshwater	Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater	7.10%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	3.23%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	3.87%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	3.87%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	1.94%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	1.94%
Marine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine	1.94%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	1.94%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	1.94%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	1.94%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.29%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	1.29%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	1.29%
Host-Associated	Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated	1.29%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.65%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	0.65%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.65%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	0.65%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.65%
Lake Water	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water	0.65%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	0.65%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	0.65%
Wetland	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland	0.65%
Marine Plankton	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton	0.65%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.65%
Lotic	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic	0.65%
Water Bodies	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies	0.65%
Glacier Valley	Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley	0.65%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	0.65%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	0.65%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	0.65%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.65%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.65%
Marine	Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine	0.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.65%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.65%
Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Sand	0.65%
Serpentinite Rock And Fluid	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid	0.65%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.65%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.65%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.65%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	0.65%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater	0.65%
Wastewater Effluent	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent	0.65%
Food Waste	Engineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste	0.65%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300000268	Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters ver2	Environmental
3300001839	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b	Environmental
3300002132	Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t6BS2 (105f)	Environmental
3300003493	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN	Environmental
3300004766	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (Metagenome Metatranscriptome)	Environmental
3300004786	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (Metagenome Metatranscriptome)	Environmental
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental
3300005660	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate	Engineered
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental
3300005758	Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore	Environmental
3300005833	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK	Environmental
3300006040	Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_30-Apr-14	Environmental
3300006056	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA	Engineered
3300006164	Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA	Environmental
3300006381	Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Total_1113_SludgeMetaT (Metagenome Metatranscriptome)	Engineered
3300006638	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A	Environmental
3300006949	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B	Environmental
3300007214	Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects	Environmental
3300007544	Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3	Environmental
3300007597	Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02	Environmental
3300007627	Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02	Environmental
3300007642	Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3	Environmental
3300008072	Microbial Communities in Water bodies, Singapore - Site MA	Environmental
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental
3300009154	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG	Environmental
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental
3300009163	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG	Environmental
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental
3300009169	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015	Environmental
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental
3300009187	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG	Environmental
3300009455	Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring	Environmental
3300009527	Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek	Environmental
3300009774	Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - lysozymeSSSS metaG	Environmental
3300009787	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG	Host-Associated
3300010051	Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196	Engineered
3300010134	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome)	Environmental
3300010885	northern Canada Lakes Co-assembly	Environmental
3300011009	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA	Environmental
3300011340	Combined Assembly of Wetland Metatranscriptomes	Environmental
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300012345	Freshwater microbial communities from Burnt River, Ontario, Canada - S22	Environmental
3300012688	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES030 metaT (Metagenome Metatranscriptome)	Environmental
3300012702	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome)	Environmental
3300012712	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES121 metaT (Metagenome Metatranscriptome)	Environmental
3300012715	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome)	Environmental
3300012718	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES050 metaT (Metagenome Metatranscriptome)	Environmental
3300012719	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES123 metaT (Metagenome Metatranscriptome)	Environmental
3300012720	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome)	Environmental
3300012724	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome)	Environmental
3300012727	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES016 metaT (Metagenome Metatranscriptome)	Environmental
3300012731	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome)	Environmental
3300012734	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome)	Environmental
3300012772	Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome)	Environmental
3300012773	Freshwater microbial communities from Lake Simoncouche, Canada - S_140212_E_mt (Metagenome Metatranscriptome)	Environmental
3300012778	Freshwater microbial communities from Lake Croche, Canada - C_130208_E_mt (Metagenome Metatranscriptome)	Environmental
3300012783	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES002 metaT (Metagenome Metatranscriptome)	Environmental
3300013286	Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y	Environmental
3300013295	northern Canada Lakes metatranscriptome co-assembly	Environmental
3300014297	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D1	Environmental
3300014319	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1	Environmental
3300015201	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)	Environmental
3300016694	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES040 metaT (Metagenome Metatranscriptome)	Environmental
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental
3300020167	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m	Environmental
3300020407	Marine microbial communities from Tara Oceans - TARA_B100001105 (ERX556033-ERR599115)	Environmental
3300020489	Freshwater microbial communities from Lake Mendota, WI - 21JUL2008 deep hole epilimnion (SPAdes)	Environmental
3300021072	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-15m	Environmental
3300021323	Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome)	Environmental
3300021440	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17 MG	Environmental
3300021516	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L626-11m	Environmental
3300021519	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m	Environmental
3300021859	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome)	Environmental
3300021952	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG	Environmental
3300022147	Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 2-17 MT (Metagenome Metatranscriptome)	Environmental
3300022156	Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MT (Metagenome Metatranscriptome)	Environmental
3300022213	Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1	Environmental
3300022748	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG	Environmental
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental
3300023300	Food waste microbial community from Durham, Ontario, Canada. Combined Assembly of Gp0238881, Gp0242100	Engineered
3300023311	Combined Assembly of Gp0281739, Gp0281740, Gp0281741	Environmental
3300023697	Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17_Aug_MT (Metagenome Metatranscriptome)	Environmental
3300023700	Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MT (Metagenome Metatranscriptome)	Environmental
3300023703	Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MT (Metagenome Metatranscriptome)	Environmental
3300024481	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome)	Environmental
3300024501	Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepB_8d	Environmental
3300024534	Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8h (Metagenome Metatranscriptome)	Environmental
3300024542	Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8h (Metagenome Metatranscriptome)	Environmental
3300024553	Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_8d (Metagenome Metatranscriptome)	Environmental
3300024561	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d (Metagenome Metatranscriptome)	Environmental
3300024563	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d (Metagenome Metatranscriptome)	Environmental
3300024568	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d (Metagenome Metatranscriptome)	Environmental
3300024569	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d (Metagenome Metatranscriptome)	Environmental
3300024573	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome)	Environmental
3300024854	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d (Metagenome Metatranscriptome)	Environmental
3300024857	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome)	Environmental
3300024968	Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 31_HOW6 (SPAdes)	Environmental
3300025435	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (SPAdes)	Environmental
3300025489	Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Mar_QV11C (SPAdes)	Environmental
3300025753	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8d (Metagenome Metatranscriptome)	Environmental
3300025763	Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8h (Metagenome Metatranscriptome)	Environmental
3300025896	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)	Environmental
3300026072	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 (SPAdes)	Environmental
3300026410	Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8d (Metagenome Metatranscriptome)	Environmental
3300026425	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome)	Environmental
3300026566	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome)	Environmental
3300026570	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h (Metagenome Metatranscriptome)	Environmental
3300027295	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8d	Environmental
3300027299	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8d	Environmental
3300027300	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8d	Environmental
3300027487	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d	Environmental
3300027708	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)	Environmental
3300027714	Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)	Environmental
3300027721	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)	Environmental
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental
3300027806	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes)	Environmental
3300027831	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)	Environmental
3300027910	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)	Environmental
3300027969	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)	Environmental
3300027971	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)	Environmental
3300027974	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)	Environmental
3300028077	Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8d (Metagenome Metatranscriptome)	Environmental
3300028080	Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8d (Metagenome Metatranscriptome)	Environmental
3300028267	Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepC_8h (Metagenome Metatranscriptome)	Environmental
3300028271	Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h (Metagenome Metatranscriptome)	Environmental
3300028286	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome)	Environmental
3300028813	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3	Environmental
3300029907	I_Bog_N1 coassembly	Environmental
3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Host-Associated
3300031902	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2	Environmental
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental
3300032050	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122	Environmental
3300032116	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119	Environmental
3300033984	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030	Environmental
3300034060	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016	Environmental
3300034096	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098	Environmental
3300034168	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
M3P_100322374	3300000268	Lotic	VCAYNGVVCSACWALYFLEPMLLEPGLGTLSGERDRLAS
RCM40_10340681	3300001839	Marine Plankton	ALYFLEPMLLEPGLGTSAGERDRLASDEPNASLPSPT*
M2t6BS2_1423370381	3300002132	Marine	MKLFAEFGLLYVLEPMLFEPGLGTLQHGCDRLASDEPEVLLTSPT*
JGI25923J51411_10115683	3300003493	Freshwater Lake	VCSACWALYFLEPMLLEPGLGTLSGERDHLASDEPNASLTLPT*
Ga0007747_10312782	3300004766	Freshwater Lake	RLQVLRALYFLEPMLIELGLGTSVDERDRLASDEPNVDLTSPT*
Ga0007753_14949081	3300004786	Freshwater Lake	ACWALYFLEPMLLEPGLGTLSGERDHLASDEPNASLTLPT*
Ga0049081_100470411	3300005581	Freshwater Lentic	VCSACWALYFLEPMLLEPGLGTSSGERDHLASDEPNASLTLPT*
Ga0073904_102741922	3300005660	Activated Sludge	YFLEPMLIEHGLGTSPGERDHLASDEPNAWLPSPT*
Ga0078894_102355393	3300005662	Freshwater Lake	VCSVLGALYFLEPMLIELGLGTSFDERDRLASDEPNVNLTSPT*
Ga0078894_107465431	3300005662	Freshwater Lake	VTQVYNPRVCSVLGALYFLEPMLIELGLGTSFDERDRLASDEPNVNL
Ga0078117_10801232	3300005758	Lake Water	MLVSGVASRALYFLEPMLIEPGLGTLRGGRDHLASDEPEAVLTSPT*
Ga0074472_107901921	3300005833	Sediment (Intertidal)	MILSAAFSRVLYFLEPMLDEQGLGTLLGRCEHLASDEPEASLTSPT*
Ga0073914_101218462	3300006040	Sand	VLYFLEPMLFEQGLGTSLGGCDRLASDEPEAKLTSPT*
Ga0075163_103092252	3300006056	Wastewater Effluent	MEVSAVLPGFYFLEPMLIEHGLGISPGERDHLASDEPNAWLPSPT*
Ga0075441_100521862	3300006164	Marine	MDSSVAFVEAKYFLEPMLYEQGLGRLLGWCDRLASDEPEALLTSPT*
Ga0079102_10341623	3300006381	Anaerobic Digestor Sludge	AGVLYFLEPMLFEQGLGTSLGRCDRLASDEPEALLTSPT*
Ga0075522_103890632	3300006638	Arctic Peat Soil	LRCVSGFNFLEPMLLELGLGISPGERDHLALDEPNARLPSPT*
Ga0075528_102260552	3300006949	Arctic Peat Soil	FLEPMLLEPGLGTSLVRRDHLALDEPNVQLTSPT*
Ga0103959_10532315	3300007214	Freshwater Lake	YFLEPMLIEPGLGTSLGGRDRLASDEPEALLTSPT*
Ga0102861_10457114	3300007544	Estuarine	VTQVYNPHVCSVLGALYFLEPMLIELGLGTSFDERDRLASDEPN
Ga0102919_12040832	3300007597	Estuarine	VTQVYNESVCSVLGALYFLEPMLIELGLGTSFDERDRLASDEPNVNLTSPT*
Ga0102869_11788032	3300007627	Estuarine	CWALYFLEPMLLEPGLGTLSGERDRLASDEPNASLPSPT*
Ga0102876_11594702	3300007642	Estuarine	FLEPMLFEPGLGTSLVKRDHLALDEPNDLLTSPT*
Ga0110929_11048262	3300008072	Water Bodies	VTQVYNPSVCSVLGALYFLEPMLIELGLGTSFDERDRLASDEPNVNLTSPT*
Ga0114962_105656301	3300009151	Freshwater Lake	VTQVYNQSVCSVLGALYFLEPMLLELGLGTSFDERVRLASDEPN
Ga0114963_101656813	3300009154	Freshwater Lake	VCSVLGALYFLEPMLIELGLGTSVDERDRLASDEPNVNLTSPT*
Ga0114981_101239112	3300009160	Freshwater Lake	VTQVYNPHVCSVLGALYFLEPMLIELGLGTSFDERDRLASDEPNVNLTSPT*
Ga0114966_101385851	3300009161	Freshwater Lake	VTQVYNESVCSVLGALYFLEPMLIELGLGTSFDERDRLASDEPNVNLT
Ga0114970_101106151	3300009163	Freshwater Lake	FLEPMLIELGLGTSFDERDRLASDEPNVNLTSPT*
Ga0114975_102615884	3300009164	Freshwater Lake	MQVYNLSVCSALGALYFLEPMLLELGLGTSFDERDRLASDEPNVNLTSPT*
Ga0114975_107492871	3300009164	Freshwater Lake	NPHVCSVLGALYFLEPMLIELGLGTSFDERDRLASDEPNVKLTSPT*
Ga0105097_101809851	3300009169	Freshwater Sediment	FLEPMVNDQGLGKLPGWCERLASDEPEARLTSPT*
Ga0114979_104378074	3300009180	Freshwater Lake	MQVYNLSVCSALGALYFLEPMLLELGLGTSFDERDRLASDEPN
Ga0114972_105545852	3300009187	Freshwater Lake	TRQPIVVTQVYNQSVCSVLGALYFLEPMLLELGLGTSFDERDRLASDEPNVNLTSPT*
Ga0114939_101179901	3300009455	Groundwater	QCLLGLQFLEPMLLKLGLGKLIRWCDRLASDEPDVNLPSPT*
Ga0114942_10545423	3300009527	Groundwater	MDSSVAFAGVLYFLEPMLFEQALGTSLGGRDRLASDEPEAKLTSPT*
Ga0123339_104809592	3300009774	Glacier Valley	ALYFLVPMLYELGLSQSSGWRDRLALDEPEARLTSPT*
Ga0116226_101040731	3300009787	Host-Associated	MESSVAFARVLYFLEPMLFELGLGTSSGWRDRLASDEPDTRLT
Ga0116226_102032254	3300009787	Host-Associated	MDSSVAFARVLYFLEPMLFELGLGTSSGWRDRLASDEPDTRLT
Ga0133939_100083061	3300010051	Industrial Wastewater	MDPSVAFAGVLYFLEPMLIEQGLGTSLGWCDRLASDEPEALLTSPT*
Ga0127484_11691492	3300010134	Grasslands Soil	MLLELGLGTLHGWRDRLASDEPKAVLTSPTCIHLGS
Ga0133913_107120564	3300010885	Freshwater Lake	LYFLEPMLIELGLGTSFDERDRLASDEPNVKLTSPT*
Ga0133913_122315071	3300010885	Freshwater Lake	LQSRRLQVLGALYFLEPMLIELGLGTSFDEREHLASDEPNVKLTSPT*
Ga0129318_102439931	3300011009	Freshwater To Marine Saline Gradient	ALYFLEPMLIELGLGTSVDERDRLASDEPNVDLTSPT*
Ga0151652_132305662	3300011340	Wetland	FARVFNFLDPKVYDQGLGILLGRCERLASDEPEAKLTSPT*
Ga0150985_1057579231	3300012212	Avena Fatua Rhizosphere	FLEPMLDEQGLGTLSGWCDRLASDEPEAGLTSPT*
Ga0150985_1094795381	3300012212	Avena Fatua Rhizosphere	TCALPIYFLEPMLYEQGLGTSPGWCDRLASDEPEARLTSPT*
Ga0150985_1110035451	3300012212	Avena Fatua Rhizosphere	ALARALYFLEPMLYEQGLGKSPGWCDRLASDEPEAGLTSPT*
Ga0157139_10012861	3300012345	Freshwater	ALYFLEPMLLEPGLGTSSGERDHLASDEPNASLTLPT*
Ga0157541_10186111	3300012688	Freshwater	WALYFLEPMLLEPGLGTLSGERDHLASDEPNASLTLPT*
Ga0157541_11253251	3300012688	Freshwater	RVLYFLEPMLHELGLGTLTGERDHLASDEPNVSLPSPT*
Ga0157596_10272792	3300012702	Freshwater	LYFLEPMLFELGLGTSAGERDHLASDEPNASLPSPT*
Ga0157598_10038943	3300012712	Freshwater	WRALYFLEPMLIEPGLGTSLGGRDRLASDEPEALLTSPT*
Ga0157599_12454303	3300012715	Freshwater	LYFLEPMLIEPGLGTSLGGRDRLASDEPEALLTSPT*
Ga0157557_12115091	3300012718	Freshwater	ACRVLYFLEPMLHELGLGTLTGERDHLASDEPNVSLPSPT*
Ga0157600_11865391	3300012719	Freshwater	GVNFLEPMLIEPGLGTSRGGRDRLASDEPEAQLTSPT*
Ga0157613_11982382	3300012720	Freshwater	LYFLEPMLLEPGLGTLSGERDRLASDEPNASLPSPT*
Ga0157611_12451681	3300012724	Freshwater	RALYFLEPMLIEPGLGTSLGGRDRLASDEPEALLTSPT*
Ga0157531_11172101	3300012727	Freshwater	CRVLYFLEPMLHELGLGTLTGERDHLASDEPNVSLPSPT*
Ga0157616_12721073	3300012731	Freshwater	VVWRALYFLEPMLIEPGLGTSLGGRDRLASDEPEALLTSPT*
Ga0157615_10084492	3300012734	Freshwater	ALYVLVPMLYGAGLGKSLDGCDHLASDEPEVLLPSPT*
Ga0138287_11205991	3300012772	Freshwater Lake	MKESGVNWQALYFLEPMLIEPGLGILRGGREHLASDEPEAALTSPT*
Ga0138290_12700511	3300012773	Freshwater Lake	YFLEPMLLEPGLGTLSGERDHLASDEPNASLTLPT*
Ga0138269_13967652	3300012778	Freshwater Lake	VLGALYFLEPMLLELGLGTSFDERDRLASDEPNVNLTSPT*
Ga0157524_1343162	3300012783	Freshwater	LYFLEPMLHELGLGTLTGERDHLASDEPNVSLPSPT*
Ga0136641_12131382	3300013286	Freshwater	QVCSARRALYFLEPMLHELGLGTLADERDHLALDEPNVSLPSPT*
Ga0170791_135585922	3300013295	Freshwater	RVLYFLEPMLHELGLGTLTGERDHLALDEPNVSLPSPT*
Ga0075306_10802572	3300014297	Natural And Restored Wetlands	MFLSVAFAGVLYFLEPMLFEQGLGTSLGGRDRLASDEPEAKLTSPT*
Ga0075348_11721862	3300014319	Natural And Restored Wetlands	MFLSVAFAGVLYFLEPMLFEQGLGTSLGGRDRLASDEPEAMLTSPT*
Ga0173478_102312911	3300015201	Soil	MFSSAAFARVLYFLEPMLSEQGLGTSQGWCERLASDEPEALLTSPT*
Ga0180051_11516202	3300016694	Freshwater	RVLYFLEPMLHELGLGTLTGERDHLASDEPNVSLPSPT
Ga0207193_12234571	3300020048	Freshwater Lake Sediment	NGLVCSACRALYFLEPMLLEPGLGTLAGERDHLASDEPNASLPLPT
Ga0194035_11491912	3300020167	Anoxic Zone Freshwater	WALYFLEPMLLEPGLGTSSGERDHLASDEPNASLT
Ga0211575_103074652	3300020407	Marine	SSVAFARVLYFLEPMVYDQGLGTSLGWCDRLASDEPEALLTSPT
Ga0207910_1092611	3300020489	Freshwater	CSACRALYFLEPMLLEPGLGTLAGERDHLASDEPNASLPSPT
Ga0194057_101264101	3300021072	Anoxic Zone Freshwater	VYFLEPMLIEPGLGTSLLKRDHLASDEPNEQLTSPT
Ga0210295_11367992	3300021323	Estuarine	YFLEPMLLEPGLGTSSGERDHLASDEPNASLTLPT
Ga0213919_10058681	3300021440	Freshwater	MGLQVLGALYFLEPMLIELGLGTSFDEREHLASDEPNVKLTSPT
Ga0194045_10316291	3300021516	Anoxic Zone Freshwater	VYNQSVCSVLGALYFLEPMLLELGLGTSFDERDRLASDEPNVNLTSPT
Ga0194045_11183371	3300021516	Anoxic Zone Freshwater	VTQVYNPHVCSVLGALYFLEPMLIELGLGTSFDERDRLASDEPNVKLTSPT
Ga0194048_100674322	3300021519	Anoxic Zone Freshwater	VTQVYNPHVCSVLGALYFLEPMLIELGLGTSFDERDRLASDEPNVNLTSPT
Ga0210334_100117503	3300021859	Estuarine	SSAAFARVLYFLEPMVNDQGLGTLQGWCERLASDEPETLLTSPT
Ga0213921_10054544	3300021952	Freshwater	RLQVLGALYFLEPMLIELGLGTSVDERDRLASDEPNVDLTSPT
Ga0213930_1076482	3300022147	Freshwater	GALYFLEPMLIELGLGTSVDERDRLASDEPNVDLTSPT
Ga0213930_1095552	3300022147	Freshwater	VLRALYFLEPMLIEPGLGTSFDEREHLASDEPNVKLTSPT
Ga0213934_10221132	3300022156	Freshwater	ALYFLEPMLIELGLGTSVDERDRLASDEPNVDLTSPT
Ga0213934_10667001	3300022156	Freshwater	RLQVLGALYFLEPMLIELGLGTSVDERDRLASDEPNVNLTSPT
Ga0224500_100019447	3300022213	Sediment	MKSSAAFARVLYFLEPMLDEQGLGTSQGRCDRLASDEPEALLTSPT
Ga0228702_10859922	3300022748	Freshwater	FFERAYNPSVCSVLGALYFLEPMLIELGLGTSFDERDRLASDEPNVNLTSPT
Ga0214921_100019001	3300023174	Freshwater	VTQVYNPRVCSVLGALYFLEPMLIELGLGTSFDERDRLASDEPNVNLTSP
Ga0214921_104512191	3300023174	Freshwater	VTRVYNPHVCSVLGALYFLEPMLIELGLGTSFDERDRLASDEPNVNLTSP
Ga0256702_124516052	3300023300	Food Waste	YYLEPMLIEHGLDTLPSKRDRLALDEPNAGLLSPT
Ga0256681_125745764	3300023311	Freshwater	LKQAYNSSVCSDLGALYFLEPMLIELGLGTSFDERDRLASDE
Ga0228706_10426912	3300023697	Freshwater	YFLEPMLIELGLGTSVDERDRLASDEPNVNLTSPT
Ga0228707_10271961	3300023700	Freshwater	LYFLEPMLIDLGRGTSVDERDRLASDEPNVNLTSPT
Ga0228707_10337222	3300023700	Freshwater	LGALYFLEPMLIELGLGTSVDERDRLASDEHNVDLTSPT
Ga0228708_10146581	3300023703	Freshwater	LYFLEPMLIELGLGTSVDERDRLASDEPNVDLTSPT
Ga0256330_10859932	3300024481	Freshwater	NWQALYFLEPMLIEPGLGILRGGREHLASDEPKAALTSPT
Ga0255208_10048424	3300024501	Freshwater	LYFLDPMLFEPGLGTSQGWCDRLASDEPEASLTSPT
Ga0256357_10113401	3300024534	Freshwater	LYFLEPMLIELGLGTSSLQRDRLASDEPKGSLPSPT
Ga0256350_10926072	3300024542	Freshwater	GVNQIFLEPMLIELGLGKSSGKRARLALDEPNTTLTSPT
Ga0255301_10160771	3300024553	Freshwater	SHRVLYFLEPMLFELGLGTSAGERDRLASDEPNASLPSPT
Ga0255288_10166301	3300024561	Freshwater	WALYFLEPLLLEPGLGTSSDERDRLAADEPNPSLPSPT
Ga0255288_10829633	3300024561	Freshwater	QALYFLEPMLIEPGLGTLRGGREHLASDEPKAALTSPT
Ga0255236_10066091	3300024563	Freshwater	VCGACRALYFLEPMLLEPGLGTLAGERDHLASDEPNASLPSPT
Ga0255238_10016786	3300024568	Freshwater	RALYFLEPMLLEPGLGTSSGERDHLASDEPNASLPSPT
Ga0255243_10324271	3300024569	Freshwater	ALYFLEPMLLEPGLGTSSGERDHLASDEPNASLPSPT
Ga0255243_10940521	3300024569	Freshwater	ALYFLEPMLLEPGLGTSAGERDHLASDEPNASLPSPT
Ga0256337_11819232	3300024573	Freshwater	ALYFLEPMLIELGLGTSFDERDRLASDEPNVNLTSPT
Ga0255287_10631352	3300024854	Freshwater	ARRALYFLEPMLYEPGLGTLRDGCERLASDEPEVPLPSPT
Ga0256339_10872321	3300024857	Freshwater	TDGGSFLYFLEPMLIELGLGTSSLQRDRLASDEPKGSLPSPT
Ga0256339_10967491	3300024857	Freshwater	RALYFLEPMLSEPGLGTLRSWCERLASDEPEAALPSPP
Ga0208264_10326781	3300024968	Freshwater Sediment	LYFLEPMLSEQGLGTLLGWCDRLASDEPEVLLTSPT
Ga0208618_10219693	3300025435	Freshwater	ALYFLEPMLIELGLGTSFGERDHLASDEPNAILTSPT
Ga0208611_105304	3300025489	Serpentinite Rock And Fluid	MNLSAACRALYFLEPMLIEPGLGTLCSGRDRLASDEPEAVLPSPT
Ga0255235_10147653	3300025753	Freshwater	RALYFLEPMLLEPGLGTSAGERDHLASDEPNASLPSPT
Ga0255250_10330221	3300025763	Freshwater	WALYFLEPMLLEPGLGTSSGERDHLPSDEPNASLTLPT
Ga0208916_102048631	3300025896	Aqueous	RLVCGACRALYFLEPMLIEPGLGTLFGERDHLASDEPNTNLPSPT
Ga0208292_10587362	3300026072	Natural And Restored Wetlands	MFLSVAFAGVLYFLEPMLFEQGLGTSLGGRDRLASDEPEAKLTSPT
Ga0256325_10317881	3300026410	Freshwater	WALYFLEPMLLEPGLGTSSGERDHLASDEPNASLTLPT
Ga0256300_10366121	3300026425	Freshwater	YNDPVCSARQALYFLEPMLLEPGLGTLAGERDHLASDEPNASLPSPT
Ga0256334_11243431	3300026566	Freshwater	RRALYFLEPMLNELGLGTLSLQRDRLASDEPKVSLPSPT
Ga0255274_11124302	3300026570	Freshwater	WALYFLEPMLLEPGLGTSSGERDRLASDEPNASLPSPT
Ga0255126_10126894	3300027295	Freshwater	SLYNGPVCSARRALYFLEPMLLEPGLGTLAGERDHLASDEPNASLPSPT
Ga0255124_10165453	3300027299	Freshwater	YNAMVCGACRALYFLEPMLLEPGLGTLAGERDHLASDEPNASLPLPT
Ga0255140_10027031	3300027300	Freshwater	YFLEPMLLEPGLGTSAGERDHLASDEPNASLPSPT
Ga0255091_10304462	3300027487	Freshwater	VCSARWALYFLEPMLLEPGLGTLSGERDRLASDEPNASLPSPT
Ga0209188_10038121	3300027708	Freshwater Lake	VCSVLGALYFLEPMLLELGLGTSFDERDRLASDEPNVNLTSPT
Ga0209188_10205421	3300027708	Freshwater Lake	VTQVYNQSVCSVLGALYFLEPMLLELGLGTSFDERDRLASDEPNVNLTSP
Ga0209815_10376682	3300027714	Marine	MDSSVAFVEAKYFLEPMLYEQGLGRLLGWCDRLASDEPEALLTSPT
Ga0209492_11981983	3300027721	Freshwater Sediment	VFNFLEPMVNDQGLGKLPGWCERLASDEPEARLTSPT
Ga0209596_11795562	3300027754	Freshwater Lake	QVYNPHVCSVLGALYFLEPMLIELGLGTSFDERDRLASDEPNVNLTSPT
Ga0209985_103043603	3300027806	Freshwater Lake	NGDVRCDLRALYFLEPMLIEPGLGTLRGGRDHLASDEPEAMLTSPT
Ga0209797_100042411	3300027831	Wetland Sediment	MNSSAAFTRVLYFLEPMLDEQGLGTLLGRCEHLASDEPEASLTSPT
Ga0209583_104034482	3300027910	Watersheds	VESSLSAASTRVLYFLEPMLYEQGLGTLQGGRDHLASDEPEASLTSPT
Ga0209191_12608131	3300027969	Freshwater Lake	CSACWALYFLEPMLLEPGLGTLSGERDRLASDEPNASLPSPT
Ga0209401_10690262	3300027971	Freshwater Lake	VTRVYNPHVCSVLGALYFLEPMLIELGLGTSFDERDRLASDEPNVNLTSPT
Ga0209299_10938043	3300027974	Freshwater Lake	SAYNRAVCSACWALYFLEPMLLEPGLGTLSGERDRLASDEPNASLPSPT
Ga0256323_10200452	3300028077	Freshwater	ACRALYFLEPMLLEPGLGTLAGERDHLASDEPNASLPSPT
Ga0256324_10481491	3300028080	Freshwater	ALYFLEPMLLEPGLGTLAGERDHLASDEPNASLPSPT
Ga0256358_10823731	3300028267	Freshwater	RRVLYFLEPMLIEPGLGTLLGGRDHLASDEPEALLTSPT
Ga0255256_10762801	3300028271	Freshwater	ALYFLEPMLLEPGLGTLSGERDHLASDEPNASLTLPT
Ga0256331_11086572	3300028286	Freshwater	ARWALYFLEPMLLEPGLGTSSGERDRLASDEPNASLPSPT
Ga0302157_100023951	3300028813	Bog	MDSSVAFARVLYFLEPMLFELGLGTSSGWRDRLASDEPDSRLTS
Ga0302157_1000702312	3300028813	Bog	MESSVAFARVLYFLEPMLFELGLGTSSGWRDRLASDEPDSRLTS
Ga0311329_100047651	3300029907	Bog	MESSVAFARVLYFLEPMLFELGLGTSSGWRDRLAS
Ga0307410_116968431	3300031852	Rhizosphere	YFLEPMLFEPGLGTSLGERDRLASDEPNTKLTSPT
Ga0302322_1008574921	3300031902	Fen	MKPSAAFARVLYFLEPMLSEQGLGTSPGWRDRLASDEPDARLTS
Ga0315904_112575741	3300031951	Freshwater	MDSSDVASRALYFLEPMLIEPGLGTLRGGRDHLASDEPEAALTSPT
Ga0315906_104200284	3300032050	Freshwater	VTQVYNPRVCSVLGALYFLEPMLIELGLGTSFDERDRLASDEPNVNLTS
Ga0315903_104717761	3300032116	Freshwater	ALYFLEPMLIEPGLGTLRGGRDHLASDEPEAMLTSPT
Ga0334989_0235931_2_130	3300033984	Freshwater	CSVLGALYFLEPMLIELGLGTSFDERDRLASDEPNVNLTSPT
Ga0334983_0124643_94_249	3300034060	Freshwater	VTQVYNPSVCSVLGALYFLEPMLIELGLGTSFDERDRLASDEPNVNLTSPT
Ga0335025_0433601_1_132	3300034096	Freshwater	VCSVLGALYFLEPMLIELGLGTSFDERDRLASDEPNVNLTSPT
Ga0335061_0598445_404_553	3300034168	Freshwater	TAYNEGVCSARRALYFLEPMLLEPGLGTFPRKRDHLALDGPNVRLTSPT