| Basic Information | |
|---|---|
| Family ID | F042010 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 159 |
| Average Sequence Length | 39 residues |
| Representative Sequence | XTGSIGNNERWKTPLGARLSRDDIVEKLKAILGSSSGLVA |
| Number of Associated Samples | 123 |
| Number of Associated Scaffolds | 159 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 5.66 % |
| % of genes near scaffold ends (potentially truncated) | 93.08 % |
| % of genes from short scaffolds (< 2000 bps) | 77.99 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.862 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine (16.981 % of family members) |
| Environment Ontology (ENVO) | Unclassified (71.698 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (94.969 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.00% β-sheet: 0.00% Coil/Unstructured: 70.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 159 Family Scaffolds |
|---|---|---|
| PF02381 | MraZ | 61.64 |
| PF12327 | FtsZ_C | 10.06 |
| PF00091 | Tubulin | 5.03 |
| PF01795 | Methyltransf_5 | 3.14 |
| PF03717 | PBP_dimer | 2.52 |
| PF01510 | Amidase_2 | 2.52 |
| PF08245 | Mur_ligase_M | 1.89 |
| PF00497 | SBP_bac_3 | 0.63 |
| PF04333 | MlaA | 0.63 |
| PF01145 | Band_7 | 0.63 |
| PF05670 | NFACT-R_1 | 0.63 |
| PF05494 | MlaC | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
|---|---|---|---|
| COG2001 | MraZ, DNA-binding transcriptional regulator and inhibitor of RsmH methyltransferase activity | Translation, ribosomal structure and biogenesis [J] | 61.64 |
| COG0275 | 16S rRNA C1402 N4-methylase RsmH | Translation, ribosomal structure and biogenesis [J] | 3.14 |
| COG0768 | Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2) | Cell cycle control, cell division, chromosome partitioning [D] | 2.52 |
| COG1293 | Ribosome quality control (RQC) protein RqcH, Rqc2/NEMF/Tae2 family, contains fibronectin-(FbpA) and RNA- (NFACT) binding domains | Translation, ribosomal structure and biogenesis [J] | 0.63 |
| COG2853 | Lipoprotein subunit MlaA of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.63 |
| COG2854 | Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.86 % |
| All Organisms | root | All Organisms | 42.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000158|SI54feb11_100mDRAFT_c1017052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1328 | Open in IMG/M |
| 3300000170|SI36aug09_135mDRAFT_c1002753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 5184 | Open in IMG/M |
| 3300000223|LPjun09P410mDRAFT_1006755 | Not Available | 1036 | Open in IMG/M |
| 3300000257|LP_F_10_SI03_100DRAFT_1022798 | Not Available | 1078 | Open in IMG/M |
| 3300001344|JGI20152J14361_10005432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 6536 | Open in IMG/M |
| 3300001344|JGI20152J14361_10044664 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300001346|JGI20151J14362_10135508 | Not Available | 765 | Open in IMG/M |
| 3300001349|JGI20160J14292_10009932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 6223 | Open in IMG/M |
| 3300001349|JGI20160J14292_10028700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2922 | Open in IMG/M |
| 3300001349|JGI20160J14292_10033759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2576 | Open in IMG/M |
| 3300001349|JGI20160J14292_10126127 | Not Available | 849 | Open in IMG/M |
| 3300001353|JGI20159J14440_10003851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 9545 | Open in IMG/M |
| 3300001353|JGI20159J14440_10046844 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
| 3300001353|JGI20159J14440_10180655 | Not Available | 591 | Open in IMG/M |
| 3300001354|JGI20155J14468_10158252 | Not Available | 716 | Open in IMG/M |
| 3300001354|JGI20155J14468_10248077 | Not Available | 517 | Open in IMG/M |
| 3300001354|JGI20155J14468_10249514 | Not Available | 515 | Open in IMG/M |
| 3300001748|JGI11772J19994_1003696 | Not Available | 3019 | Open in IMG/M |
| 3300001942|GOS2262_1014861 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1810 | Open in IMG/M |
| 3300001942|GOS2262_1025400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1698 | Open in IMG/M |
| 3300001952|GOS2224_1049744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2544 | Open in IMG/M |
| 3300001955|GOS2237_1020600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1874 | Open in IMG/M |
| 3300001956|GOS2266_1052868 | Not Available | 980 | Open in IMG/M |
| 3300001957|GOS2250_1032751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1379 | Open in IMG/M |
| 3300001957|GOS2250_1049731 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1449 | Open in IMG/M |
| 3300001959|GOS2247_1000425 | Not Available | 1317 | Open in IMG/M |
| 3300001965|GOS2243_1011589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1889 | Open in IMG/M |
| 3300001971|GOS2215_10032823 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
| 3300001971|GOS2215_10074919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1592 | Open in IMG/M |
| 3300001974|GOS2246_10032015 | Not Available | 1313 | Open in IMG/M |
| 3300002033|GOS24894_10182712 | Not Available | 789 | Open in IMG/M |
| 3300002033|GOS24894_10532270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1702 | Open in IMG/M |
| 3300002040|GOScombined01_102074683 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
| 3300002040|GOScombined01_103003030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 964 | Open in IMG/M |
| 3300002040|GOScombined01_104724123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1615 | Open in IMG/M |
| 3300002040|GOScombined01_105790239 | Not Available | 1213 | Open in IMG/M |
| 3300003474|NAP4_1007943 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1799 | Open in IMG/M |
| 3300003474|NAP4_1034732 | Not Available | 963 | Open in IMG/M |
| 3300003474|NAP4_1145016 | Not Available | 506 | Open in IMG/M |
| 3300003478|JGI26238J51125_1003060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 5452 | Open in IMG/M |
| 3300003498|JGI26239J51126_1001938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 8580 | Open in IMG/M |
| 3300003500|JGI26242J51144_1018045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1348 | Open in IMG/M |
| 3300003584|JGI26254J51713_1003053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HTCC7211 | 5491 | Open in IMG/M |
| 3300003584|JGI26254J51713_1068478 | Not Available | 625 | Open in IMG/M |
| 3300003585|JGI26249J51723_1001343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 7832 | Open in IMG/M |
| 3300003587|JGI26256J51712_1000761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 13291 | Open in IMG/M |
| 3300003587|JGI26256J51712_1072738 | Not Available | 523 | Open in IMG/M |
| 3300003591|JGI26250J51715_1006432 | Not Available | 2519 | Open in IMG/M |
| 3300003595|JGI26263J51726_1005326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3600 | Open in IMG/M |
| 3300003601|JGI26382J51730_1007256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HTCC7211 | 3557 | Open in IMG/M |
| 3300003618|JGI26381J51731_1016650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2134 | Open in IMG/M |
| 3300003645|NAP1_1064474 | Not Available | 506 | Open in IMG/M |
| 3300004279|Ga0066605_10045583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2006 | Open in IMG/M |
| 3300005430|Ga0066849_10200271 | Not Available | 777 | Open in IMG/M |
| 3300005430|Ga0066849_10210289 | Not Available | 755 | Open in IMG/M |
| 3300005514|Ga0066866_10323024 | Not Available | 524 | Open in IMG/M |
| 3300005521|Ga0066862_10127451 | Not Available | 861 | Open in IMG/M |
| 3300005521|Ga0066862_10263865 | Not Available | 561 | Open in IMG/M |
| 3300005523|Ga0066865_10263901 | Not Available | 649 | Open in IMG/M |
| 3300005611|Ga0074647_1023323 | Not Available | 954 | Open in IMG/M |
| 3300005838|Ga0008649_10024321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2942 | Open in IMG/M |
| 3300005960|Ga0066364_10145673 | Not Available | 810 | Open in IMG/M |
| 3300005971|Ga0066370_10201934 | Not Available | 695 | Open in IMG/M |
| 3300006027|Ga0075462_10248524 | Not Available | 527 | Open in IMG/M |
| 3300006166|Ga0066836_10021025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3640 | Open in IMG/M |
| 3300006190|Ga0075446_10085701 | Not Available | 935 | Open in IMG/M |
| 3300006334|Ga0099675_1029754 | Not Available | 1455 | Open in IMG/M |
| 3300006334|Ga0099675_1568364 | Not Available | 515 | Open in IMG/M |
| 3300006337|Ga0068495_1162526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1272 | Open in IMG/M |
| 3300006869|Ga0075477_10170968 | Not Available | 900 | Open in IMG/M |
| 3300006947|Ga0075444_10158942 | Not Available | 941 | Open in IMG/M |
| 3300007041|Ga0101669_130530 | Not Available | 518 | Open in IMG/M |
| 3300007116|Ga0101667_1103978 | Not Available | 518 | Open in IMG/M |
| 3300007681|Ga0102824_1117130 | Not Available | 700 | Open in IMG/M |
| 3300008961|Ga0102887_1133725 | Not Available | 772 | Open in IMG/M |
| 3300009049|Ga0102911_1134873 | Not Available | 702 | Open in IMG/M |
| 3300009052|Ga0102886_1125129 | Not Available | 773 | Open in IMG/M |
| 3300009076|Ga0115550_1016222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3703 | Open in IMG/M |
| 3300009420|Ga0114994_10723190 | Not Available | 649 | Open in IMG/M |
| 3300009422|Ga0114998_10268993 | Not Available | 801 | Open in IMG/M |
| 3300009476|Ga0115555_1240789 | Not Available | 737 | Open in IMG/M |
| 3300009476|Ga0115555_1299263 | Not Available | 648 | Open in IMG/M |
| 3300009508|Ga0115567_10732530 | Not Available | 591 | Open in IMG/M |
| 3300009508|Ga0115567_10955574 | Not Available | 507 | Open in IMG/M |
| 3300009785|Ga0115001_10989136 | Not Available | 504 | Open in IMG/M |
| 3300010296|Ga0129348_1284443 | Not Available | 553 | Open in IMG/M |
| 3300010297|Ga0129345_1276652 | Not Available | 584 | Open in IMG/M |
| 3300010297|Ga0129345_1351969 | Not Available | 507 | Open in IMG/M |
| 3300012919|Ga0160422_10232874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1121 | Open in IMG/M |
| 3300012936|Ga0163109_10557210 | Not Available | 839 | Open in IMG/M |
| 3300012936|Ga0163109_10729021 | Not Available | 725 | Open in IMG/M |
| 3300012954|Ga0163111_10367702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1296 | Open in IMG/M |
| 3300012954|Ga0163111_11240339 | Not Available | 729 | Open in IMG/M |
| 3300012954|Ga0163111_11617378 | Not Available | 644 | Open in IMG/M |
| 3300012954|Ga0163111_12753113 | Not Available | 503 | Open in IMG/M |
| 3300016734|Ga0182092_1400717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 553 | Open in IMG/M |
| 3300016735|Ga0182074_1037730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia | 537 | Open in IMG/M |
| 3300017749|Ga0181392_1216252 | Not Available | 546 | Open in IMG/M |
| 3300017769|Ga0187221_1120129 | Not Available | 793 | Open in IMG/M |
| 3300017779|Ga0181395_1272198 | Not Available | 515 | Open in IMG/M |
| 3300017782|Ga0181380_1167605 | Not Available | 744 | Open in IMG/M |
| 3300017782|Ga0181380_1207629 | Not Available | 656 | Open in IMG/M |
| 3300017783|Ga0181379_1093715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1105 | Open in IMG/M |
| 3300017786|Ga0181424_10409149 | Not Available | 551 | Open in IMG/M |
| 3300017818|Ga0181565_10675269 | Not Available | 657 | Open in IMG/M |
| 3300017949|Ga0181584_10493709 | Not Available | 754 | Open in IMG/M |
| 3300017951|Ga0181577_10720604 | Not Available | 606 | Open in IMG/M |
| 3300017958|Ga0181582_10911208 | Not Available | 516 | Open in IMG/M |
| 3300017962|Ga0181581_10771070 | Not Available | 574 | Open in IMG/M |
| 3300018417|Ga0181558_10495792 | Not Available | 636 | Open in IMG/M |
| 3300018423|Ga0181593_10721518 | Not Available | 704 | Open in IMG/M |
| 3300018428|Ga0181568_10839146 | Not Available | 708 | Open in IMG/M |
| 3300020053|Ga0181595_10092224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1502 | Open in IMG/M |
| 3300020053|Ga0181595_10230156 | Not Available | 796 | Open in IMG/M |
| 3300020174|Ga0181603_10169752 | Not Available | 928 | Open in IMG/M |
| 3300020178|Ga0181599_1253831 | Not Available | 673 | Open in IMG/M |
| 3300020282|Ga0211667_1068371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 879 | Open in IMG/M |
| 3300020358|Ga0211689_1114954 | Not Available | 756 | Open in IMG/M |
| 3300020372|Ga0211683_10006502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4470 | Open in IMG/M |
| 3300020374|Ga0211477_10007740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 5515 | Open in IMG/M |
| 3300020381|Ga0211476_10054887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1599 | Open in IMG/M |
| 3300020385|Ga0211677_10040190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2197 | Open in IMG/M |
| 3300020385|Ga0211677_10157525 | Not Available | 960 | Open in IMG/M |
| 3300020385|Ga0211677_10219134 | Not Available | 783 | Open in IMG/M |
| 3300020388|Ga0211678_10207518 | Not Available | 820 | Open in IMG/M |
| 3300020391|Ga0211675_10038026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2376 | Open in IMG/M |
| 3300020391|Ga0211675_10098301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1345 | Open in IMG/M |
| 3300020392|Ga0211666_10012688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4175 | Open in IMG/M |
| 3300020404|Ga0211659_10014192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3962 | Open in IMG/M |
| 3300020432|Ga0211556_10446066 | Not Available | 573 | Open in IMG/M |
| 3300020438|Ga0211576_10416431 | Not Available | 686 | Open in IMG/M |
| 3300020438|Ga0211576_10496625 | Not Available | 616 | Open in IMG/M |
| 3300020440|Ga0211518_10065325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2024 | Open in IMG/M |
| 3300020450|Ga0211641_10161450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1129 | Open in IMG/M |
| 3300020463|Ga0211676_10051052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2934 | Open in IMG/M |
| 3300020463|Ga0211676_10598874 | Not Available | 566 | Open in IMG/M |
| 3300020465|Ga0211640_10134370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1413 | Open in IMG/M |
| 3300020467|Ga0211713_10208952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 940 | Open in IMG/M |
| 3300020469|Ga0211577_10001443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 23037 | Open in IMG/M |
| 3300021378|Ga0213861_10166090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1235 | Open in IMG/M |
| 3300021957|Ga0222717_10465024 | Not Available | 687 | Open in IMG/M |
| 3300021958|Ga0222718_10197819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1099 | Open in IMG/M |
| 3300021962|Ga0222713_10339363 | Not Available | 943 | Open in IMG/M |
| 3300021964|Ga0222719_10495735 | Not Available | 734 | Open in IMG/M |
| (restricted) 3300022902|Ga0233429_1042136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2222 | Open in IMG/M |
| 3300022905|Ga0255756_1085498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1507 | Open in IMG/M |
| 3300022923|Ga0255783_10172517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1012 | Open in IMG/M |
| 3300023110|Ga0255743_10257666 | Not Available | 922 | Open in IMG/M |
| 3300024180|Ga0228668_1043066 | Not Available | 919 | Open in IMG/M |
| 3300024237|Ga0228653_1083119 | Not Available | 697 | Open in IMG/M |
| (restricted) 3300024258|Ga0233440_1004323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 10068 | Open in IMG/M |
| (restricted) 3300024339|Ga0233445_1002453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 12307 | Open in IMG/M |
| 3300025869|Ga0209308_10043555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2433 | Open in IMG/M |
| 3300026093|Ga0208624_1080095 | Not Available | 715 | Open in IMG/M |
| 3300026270|Ga0207993_1020404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2089 | Open in IMG/M |
| 3300026483|Ga0228620_1049669 | Not Available | 953 | Open in IMG/M |
| 3300031510|Ga0308010_1167731 | Not Available | 810 | Open in IMG/M |
| 3300032032|Ga0315327_10417924 | Not Available | 838 | Open in IMG/M |
| 3300032073|Ga0315315_11269669 | Not Available | 648 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 16.98% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 16.35% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 12.58% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 10.69% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 8.18% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.40% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.77% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.77% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 3.14% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.52% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.52% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.52% |
| Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 2.52% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.89% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.89% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.26% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.26% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.63% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.63% |
| Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 0.63% |
| Volcanic Co2 Seep | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep | 0.63% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 0.63% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000158 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 54 02/08/11 100m | Environmental | Open in IMG/M |
| 3300000170 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 135m | Environmental | Open in IMG/M |
| 3300000223 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P4 10m | Environmental | Open in IMG/M |
| 3300000257 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_F_10_SI03_100 | Environmental | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
| 3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
| 3300001942 | Marine microbial communities from Polynesia - GS047 | Environmental | Open in IMG/M |
| 3300001952 | Marine microbial communities from Newport Harbor, Rhode Island, USA - GS008 | Environmental | Open in IMG/M |
| 3300001955 | Marine microbial communities from Gulf of Panama, Panama - GS021 | Environmental | Open in IMG/M |
| 3300001956 | Marine microbial communities from Rangirora Atoll, Polynesia Archipelagos - GS051 | Environmental | Open in IMG/M |
| 3300001957 | Marine microbial communities from Wolf Island, Equador - GS035 | Environmental | Open in IMG/M |
| 3300001959 | Mangrove swamp microbial communities from Isabella Island, Equador - GS032 | Environmental | Open in IMG/M |
| 3300001965 | Marine microbial communities from Coastal Floreana, Equador - GS028 | Environmental | Open in IMG/M |
| 3300001971 | Marine microbial communities from the Sargasso Sea - GS000c | Environmental | Open in IMG/M |
| 3300001974 | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 | Environmental | Open in IMG/M |
| 3300002033 | Marine microbial communities from the Sargasso Sea - GS000a &b | Environmental | Open in IMG/M |
| 3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
| 3300003474 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 4 | Environmental | Open in IMG/M |
| 3300003478 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA | Environmental | Open in IMG/M |
| 3300003498 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA | Environmental | Open in IMG/M |
| 3300003500 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_100m_DNA | Environmental | Open in IMG/M |
| 3300003584 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_120m_DNA | Environmental | Open in IMG/M |
| 3300003585 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_135m_DNA | Environmental | Open in IMG/M |
| 3300003587 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_150m_DNA | Environmental | Open in IMG/M |
| 3300003591 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_150m_DNA | Environmental | Open in IMG/M |
| 3300003595 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_200m_DNA | Environmental | Open in IMG/M |
| 3300003601 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_165m_DNA | Environmental | Open in IMG/M |
| 3300003618 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_165m_DNA | Environmental | Open in IMG/M |
| 3300003645 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 1 | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300005514 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 | Environmental | Open in IMG/M |
| 3300005521 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005838 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNA | Environmental | Open in IMG/M |
| 3300005960 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_A | Environmental | Open in IMG/M |
| 3300005971 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
| 3300006337 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0025m | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007041 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'control', water-ic | Environmental | Open in IMG/M |
| 3300007116 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, waterEBis3 | Environmental | Open in IMG/M |
| 3300007681 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 | Environmental | Open in IMG/M |
| 3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
| 3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
| 3300009052 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300016734 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016735 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071406BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020282 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556074-ERR599169) | Environmental | Open in IMG/M |
| 3300020358 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009) | Environmental | Open in IMG/M |
| 3300020372 | Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556133-ERR599090) | Environmental | Open in IMG/M |
| 3300020374 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) | Environmental | Open in IMG/M |
| 3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020391 | Marine microbial communities from Tara Oceans - TARA_B100000989 (ERX556130-ERR598967) | Environmental | Open in IMG/M |
| 3300020392 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020432 | Marine microbial communities from Tara Oceans - TARA_B100002052 (ERX556103-ERR599100) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020467 | Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022902 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_135_MG | Environmental | Open in IMG/M |
| 3300022905 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG | Environmental | Open in IMG/M |
| 3300022923 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG | Environmental | Open in IMG/M |
| 3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
| 3300024180 | Seawater microbial communities from Monterey Bay, California, United States - 82D | Environmental | Open in IMG/M |
| 3300024237 | Seawater microbial communities from Monterey Bay, California, United States - 65D | Environmental | Open in IMG/M |
| 3300024258 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_120_MG | Environmental | Open in IMG/M |
| 3300024339 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_100_MG | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300026093 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_DCM_ad_71m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026270 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 (SPAdes) | Environmental | Open in IMG/M |
| 3300026483 | Seawater microbial communities from Monterey Bay, California, United States - 23D | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SI54feb11_100mDRAFT_10170521 | 3300000158 | Marine | EHTGSIGNNERWKTPLGARLSRDDIVEKLKAILG* |
| SI36aug09_135mDRAFT_10027531 | 3300000170 | Marine | XTGSIGNNERWKTPLGARLSRDDIVEKLKAILGSSSGLVA* |
| LPjun09P410mDRAFT_10067554 | 3300000223 | Marine | GKGENVVRAHGSIGNNERWKTPLGARLSRDDNVEKLKAILGSSSGLVA* |
| LP_F_10_SI03_100DRAFT_10227984 | 3300000257 | Marine | SIGNNERWKTPLGARLSRDDIVEKLKAILGSSSGLVA* |
| JGI20152J14361_100054321 | 3300001344 | Pelagic Marine | KGENVVRAHGSIGNNERWKTPLGARLSRDDIVAKLKAVFG* |
| JGI20152J14361_100446643 | 3300001344 | Pelagic Marine | EHTGSIGNNERWKTPLGARLSRGDIVEKLKAVFG* |
| JGI20151J14362_101355081 | 3300001346 | Pelagic Marine | TGSIGNNERWKTPLGARLSRDDIVAKLKAILGSSSGLVA* |
| JGI20160J14292_100099321 | 3300001349 | Pelagic Marine | VRAHGSIGNNERWKTPLGARLSRDDIVEKLKAIFGSSSGLVA* |
| JGI20160J14292_100287001 | 3300001349 | Pelagic Marine | HTGSIGNNERWKTPLGARLSRDDIVAKLKAVFGSSSGLVA* |
| JGI20160J14292_100337595 | 3300001349 | Pelagic Marine | TGSIGNNERWKTPLGARLSRDDVVERLKAILGWSSGLVA* |
| JGI20160J14292_101261272 | 3300001349 | Pelagic Marine | GVVRAHGSIGNNERWKTPLGARLSRDDIFAKIKAVFG* |
| JGI20159J14440_100038511 | 3300001353 | Pelagic Marine | VVRAHRFYGNSERWKTPLGARLSRDDIVAKLKAILG |
| JGI20159J14440_100468441 | 3300001353 | Pelagic Marine | VRAHGSIGNNERWKTPLGARLSRDDIVEKLKAVFGSSSGLVA* |
| JGI20159J14440_101806551 | 3300001353 | Pelagic Marine | HTGSIGNNERWKTPLGARLSRDDIVAKLKAVLGSSSGLVA* |
| JGI20155J14468_101582521 | 3300001354 | Pelagic Marine | IGNNERWKTPLGARLSRDDIVAKLKAILGSSSGLVA* |
| JGI20155J14468_102480771 | 3300001354 | Pelagic Marine | VKRCGKSTGSIGNNERWKTPLGARLSRDDIVXKLKAVFG* |
| JGI20155J14468_102495141 | 3300001354 | Pelagic Marine | VKRCGKSTGSIGNNERWKTPLGARLSRDDIVKKLKAILG* |
| JGI11772J19994_10036965 | 3300001748 | Saline Water And Sediment | KGENVVRAHGSIGNNERWKTPLGARLSRDDIVAKLKAVLG* |
| GOS2262_10148613 | 3300001942 | Marine | VKGVVRAHGSIGNNERWKTPLGARLSRDDIVEKLKAIFG* |
| GOS2262_10254003 | 3300001942 | Marine | GVVRAHGSIGNNERWKTPLGARLSRDDIVEKLKAVLG* |
| GOS2224_10497443 | 3300001952 | Marine | VVRAHGSIGNNERWKTPLGARLSRDDIVAKLKAILGSSSGLVA* |
| GOS2237_10206001 | 3300001955 | Marine | VVEHTGSIGNNERWKTPLGARLSRDDIVEKLKAVLG* |
| GOS2266_10528682 | 3300001956 | Marine | KGENVVRAHGSIGNNERWKTPLGARLSRDDIVEKLKAIFGSSSGLVA* |
| GOS2250_10327511 | 3300001957 | Marine | VKGVVRAHGSIGNNERWKTPLGARLSRDDIVEKLKAILG* |
| GOS2250_10497312 | 3300001957 | Marine | EHTGSIGNNERWKTPLGARLSRDDIVAKLKAVLG* |
| GOS2247_10004251 | 3300001959 | Marine | VVRAHGSIGNNERWKTPLGAKLSRDNIVEKLKAVLG* |
| GOS2243_10115892 | 3300001965 | Marine | VVRAHGSIGNNERWKTPLGARLSRDDIVEKLKAVLG* |
| GOS2215_100328231 | 3300001971 | Marine | VVRAHGSIGNNERWKTPLRARLSRDDIVERLKAIFGWSSGLVA* |
| GOS2215_100749191 | 3300001971 | Marine | EHTGSIGNNERWKTPLRARLSRDDIVEKLKAVLG* |
| GOS2246_100320151 | 3300001974 | Marine | VVRAHGSIGNNERWKTPLGARLSRDDIVEKLKAILG* |
| GOS24894_101827122 | 3300002033 | Marine | ARVKGVVRAHGSIGNNERWKTPLGARLSRDDIVEKLKAFLG |
| GOS24894_105322703 | 3300002033 | Marine | RVKGVVRAHGSIGNNELWKTPLGARLSRDDTVEKLKAVLG |
| GOScombined01_1020746833 | 3300002040 | Marine | RVKGVVRAHGSIGNNELWKTPLGARLSRDDTVEKLKAVLG* |
| GOScombined01_1030030301 | 3300002040 | Marine | HTGSIGNNERWKTPLGARLSRDDKVEKLKAILGSSSGLVA* |
| GOScombined01_1047241232 | 3300002040 | Marine | VVRAHGSIGNNERWKTPLGARLSRDDTVAKLKAVFG* |
| GOScombined01_1057902394 | 3300002040 | Marine | KGVVRAHGSIGNNERWKTPLGARLSRDDIVEKLKAFLG* |
| NAP4_10079433 | 3300003474 | Estuarine | KGENVVRAHGSIGNNERWKTPLGARLSRGDIVEKLKAILG* |
| NAP4_10347321 | 3300003474 | Estuarine | TGSIGNNERWKTPLRARLSRDDIVAKLKAVLGWSSGLVA* |
| NAP4_11450161 | 3300003474 | Estuarine | GENVVRAHGSIGNNERWKTPLGARLSRDDIVAELKAILG* |
| JGI26238J51125_10030601 | 3300003478 | Marine | HTGSIGNNERWKTPLGARLSRDDIVEKLKAILGSSSGLVA* |
| JGI26239J51126_10019388 | 3300003498 | Marine | HGKGENVVRAHGSIGNNERWKTPLGARLSRDDNVEKLKAILGSSSGLVA* |
| JGI26242J51144_10180453 | 3300003500 | Marine | KGENVVRAHGSIGNNERWKTPLGARLSRDDIVEKLKAILG* |
| JGI26254J51713_10030536 | 3300003584 | Marine | GENVVRAHGSIGNNERWKTPLGARLSRDDNVEKLKAILGSSSGLVA* |
| JGI26254J51713_10684781 | 3300003584 | Marine | VVRAHGSIGNNERWKTPLGARLSRDDIVEKLKAILGSSSGLVA* |
| JGI26249J51723_10013437 | 3300003585 | Marine | GENVVRAHGSIGNNERWKTPLGARLSRDDIVEKLKAILGSSSGLVA* |
| JGI26256J51712_100076112 | 3300003587 | Marine | RVKGVVRAHGSIGNNERWKTPLGARLSRDDIVEKLKAILGSSSGLVA* |
| JGI26256J51712_10727381 | 3300003587 | Marine | GKGENVVRAHGSIGNNERWKTPLGARLSRDDIVEKLKAVFG* |
| JGI26250J51715_10064321 | 3300003591 | Marine | VKRCGKSTGSIGNNERWKTPLGARLSRDDIVEKLKAILG* |
| JGI26263J51726_10053265 | 3300003595 | Marine | KGENVVRAHGSIGNNERWKTPLGARLSRDDIVEKLKAILGSSSGLVA* |
| JGI26382J51730_10072561 | 3300003601 | Marine | VVRAHGSIGNNERWKTPLGARLSRDDNVEKLKAILGSSSGLVA* |
| JGI26381J51731_10166503 | 3300003618 | Marine | TGSIGNNERWKTPLGARLSRDDIVEKLKAILGSSSGLVA* |
| NAP1_10644741 | 3300003645 | Estuarine | GENVVRAHGSIGNNERWKTPLGARLSRDDTVAKLKAFLG* |
| Ga0066605_100455833 | 3300004279 | Marine | KGVVRAHGSIGNNERWKTPLGARLSRDDIVEKLKAILGSSSGLVA* |
| Ga0066849_102002711 | 3300005430 | Marine | HGKGENVVRAHGSIGNNERWKTPLGARLSRDDIVEKLKAILG* |
| Ga0066849_102102892 | 3300005430 | Marine | VRAHGSIGNNERWKTPLGARLSRDDIVEKLKAILGSSSGLVA* |
| Ga0066866_103230241 | 3300005514 | Marine | HGKGENVVRAHGSIGNNERWKTPLGARLSRDDIVEKLKAVLG* |
| Ga0066862_101274511 | 3300005521 | Marine | GVVRAHGSIGNNERWKTPLGARLSRDDIVEKLKAILG* |
| Ga0066862_102638652 | 3300005521 | Marine | SIGNNERWKTPLGARLSRDDIVEKLKAILGSSSGLVA*A* |
| Ga0066865_102639012 | 3300005523 | Marine | EHTGSIGNNERWKTPLGARLSRDDIVEKLKAIFGSSSGLVA*A* |
| Ga0074647_10233232 | 3300005611 | Saline Water And Sediment | EHTGSIGNNERWKTPLGARLSRDDIVAKLKAILG* |
| Ga0008649_100243211 | 3300005838 | Marine | KGVVRAHGSIGNNERWKTPLGARLSRGDIVEKLKAILG* |
| Ga0066364_101456732 | 3300005960 | Marine | EHTGSIGNNERWKTPLGARLSRGDIVEKLKAILG* |
| Ga0066370_102019342 | 3300005971 | Marine | GVVRAHGSIGNNERWKTPLGARLSRGDIVEKLKAILG* |
| Ga0075462_102485241 | 3300006027 | Aqueous | HGKGENVVRAHGSIGNNERWKTPLGARLSRDDIVAKLKAILG* |
| Ga0066836_100210255 | 3300006166 | Marine | GVVRAHGSIGNNERWKTPLGARLSRDDIVEKLKAILGSSSGLVA* |
| Ga0075446_100857012 | 3300006190 | Marine | GVVRAHGSIGNNERWKTPLGARLSRDDIVAKLKAVFG* |
| Ga0099675_10297544 | 3300006334 | Marine | VVRAHGSIGNNERWKTPLGAKLSRDDIVEKLKAIFGSSSGLVA* |
| Ga0099675_15683642 | 3300006334 | Marine | NERWKTPLGARLSRDDIVKKLKAIFGLSSGLVA*A* |
| Ga0068495_11625263 | 3300006337 | Marine | KGENVVRAHGSIGNNERWKTPLGARLSRDDIVEKQKAVLG* |
| Ga0075477_101709681 | 3300006869 | Aqueous | VVRAHGSTGNSERWKTPLGARLSRDDIVEKLKAILGSSSGLVA* |
| Ga0075444_101589421 | 3300006947 | Marine | KGVVRAHGSIGNNERWKTPLGARLSRDDIVAKLKAVFG* |
| Ga0101669_1305301 | 3300007041 | Volcanic Co2 Seep | VVRAHGSIGNNERWKTPLGARLSRDDIVEKLKAIFGSSSGLVA* |
| Ga0101667_11039782 | 3300007116 | Volcanic Co2 Seep Seawater | VRAHGSIGNNERWKTPLGARLSRDDIVEKLKAVFG* |
| Ga0102824_11171302 | 3300007681 | Estuarine | SIGNNERWKTPLGARLSRGDIVERLKAILGSSSGLVA* |
| Ga0102887_11337251 | 3300008961 | Estuarine | ERTGSIGNNERWKTPLGARLSRDDIVAKLKAVFG* |
| Ga0102911_11348732 | 3300009049 | Estuarine | IGNNERWKTPLGARLSRDDIVERLKAILGLSSGLVA* |
| Ga0102886_11251291 | 3300009052 | Estuarine | ERTGSIGNNERWKTPLGARLSRDDIVVKLKAVFG* |
| Ga0115550_10162221 | 3300009076 | Pelagic Marine | EHTGSIGNNERWKTPLGARLSRDDIVAKLKAVFG* |
| Ga0114994_107231902 | 3300009420 | Marine | IGNNERWKTPLGARLSRDDIVEKLKAILGSSSGLVA* |
| Ga0114998_102689931 | 3300009422 | Marine | EHTGSIGNNERWKTPLGARLSRDDTVVKLKAVFG* |
| Ga0115555_12407892 | 3300009476 | Pelagic Marine | HTGSIGNNERWKTPLGARLSRDDIVAKLKAILGSSSGLVA* |
| Ga0115555_12992631 | 3300009476 | Pelagic Marine | GNNERWKTPLGARLSRDDVVERLKAILGWSSGLVA* |
| Ga0115567_107325301 | 3300009508 | Pelagic Marine | EHTGSIGNNERWKTPLGARLSRDDIVEKLKAVFG* |
| Ga0115567_109555741 | 3300009508 | Pelagic Marine | EHTGSIGNNERWKTPLGARLSRDDIVAKLKAVLGSSSGLVA* |
| Ga0115001_109891361 | 3300009785 | Marine | ERTGSIGNNERWKTPLGARLSRGDIVAKLKAVFG* |
| Ga0129348_12844432 | 3300010296 | Freshwater To Marine Saline Gradient | NNERWKTPLGARLSRDDIVEKLKAILGSSSGLVA* |
| Ga0129345_12766521 | 3300010297 | Freshwater To Marine Saline Gradient | TGNSERWKTPLGARLSRDDIVEKLKAILGSSSGLVA* |
| Ga0129345_13519691 | 3300010297 | Freshwater To Marine Saline Gradient | TGSTGNSERWKTPLGARLSRDDIVEKLKAILGSSSGLVA* |
| Ga0160422_102328743 | 3300012919 | Seawater | EHTGSIGNNERWKTPLGARLSRGDIVEKLKAILGWSSGLVA* |
| Ga0163109_105572101 | 3300012936 | Surface Seawater | ERTGSIGNNERWKTPLGARLSRGDTVEKLKAILG* |
| Ga0163109_107290211 | 3300012936 | Surface Seawater | TGSIGNNERWKTPLGARLSRDDIVEKLKAILGWSSGLVA* |
| Ga0163111_103677021 | 3300012954 | Surface Seawater | EHTGSIGNNERWKTPLRARLSRDDIVEKLKAILG* |
| Ga0163111_112403391 | 3300012954 | Surface Seawater | GSIGNNERWKTPLGARLSRDDIVEKLKAILGWSSGLVA* |
| Ga0163111_116173782 | 3300012954 | Surface Seawater | EHTGSIGNNERWKTPLGARLSRDDIVEKLKAVLG* |
| Ga0163111_127531132 | 3300012954 | Surface Seawater | SIGNNERWKTPLGARLSRDDIVEKLKAILGWSSGLVA* |
| Ga0182092_14007171 | 3300016734 | Salt Marsh | HTGSIGNNERWKTPLGARLSRDDIVGKLKAILGQSSGLVA |
| Ga0182074_10377302 | 3300016735 | Salt Marsh | TGSTGNSERWKTPLGARLSRDDIVEKLKAILGLSSGLVA |
| Ga0181392_12162522 | 3300017749 | Seawater | EHTGSIGNNERWKTPLGARLSRDDIVEKLKAILGWSSGLVA |
| Ga0187221_11201291 | 3300017769 | Seawater | GSIGNNERWKTPLGARLSRDDIVEKLKAIFGSSSGLVA |
| Ga0181395_12721981 | 3300017779 | Seawater | VWEERTGSIGNNERWKTPLGARLSRDDIVEKLKVILG |
| Ga0181380_11676051 | 3300017782 | Seawater | EHTGSIGNNERWKTPLGARLSRGDIVEKLKAILGSSSGLVAXA |
| Ga0181380_12076291 | 3300017782 | Seawater | RWKTPLGARLSRDDIVVKLKAILGSSSGLVAXAQEXS |
| Ga0181379_10937153 | 3300017783 | Seawater | TGSIGNNERWKTPLGARLSRGDIVEKLKAILGLSSGLVA |
| Ga0181424_104091491 | 3300017786 | Seawater | SNNERWKTPLGARLSRDDNVEKLKAVLGSSSGLVA |
| Ga0181565_106752691 | 3300017818 | Salt Marsh | SIGNNERWKTPLGARLSRDDTVEKLKAILGSSSGLVA |
| Ga0181584_104937092 | 3300017949 | Salt Marsh | TPLGARLSRDDIVEKLKAILGSSSGLVAXAHEXSXV |
| Ga0181577_107206041 | 3300017951 | Salt Marsh | GNSERWKTPLGARLSRDDIVEKLKAILGLSSGLVA |
| Ga0181582_109112082 | 3300017958 | Salt Marsh | TGNSERWKTPLGARLSRDDIVEKLKAILGSSSGLVA |
| Ga0181581_107710702 | 3300017962 | Salt Marsh | KTPLGARLSRDDIVEKLKAILGSSSGLVAXAQKXFXV |
| Ga0181558_104957921 | 3300018417 | Salt Marsh | GSTGNSERWKTPLGARLSRDDIVEKLKAILGSSSGLVAXA |
| Ga0181593_107215182 | 3300018423 | Salt Marsh | GSIGNNERWKTPLGARLSRDDVIERLKAILGWSSGLVA |
| Ga0181568_108391461 | 3300018428 | Salt Marsh | IGNNERWKTPLGARLSRDDIVEKLKAIFGSSSGLVA |
| Ga0181595_100922243 | 3300020053 | Salt Marsh | TGSTGNSERWKTPLGARLSRDDIVKKLKAILGSSSGLVA |
| Ga0181595_102301561 | 3300020053 | Salt Marsh | GSIGNNERWKTPLGARLSRDDIVVKLKAVLGSLSGLVA |
| Ga0181603_101697522 | 3300020174 | Salt Marsh | HTGSTGNSERWKTPLGARLSRDDIVEKLKAILGSSSGLVA |
| Ga0181599_12538311 | 3300020178 | Salt Marsh | IGNNERWKTPLGARLSRDDIVEKLKAILGLSSGLVA |
| Ga0211667_10683711 | 3300020282 | Marine | IGNNERWKTPLRARLSRGDIVGILKAILGSSSGLVA |
| Ga0211689_11149541 | 3300020358 | Marine | HTGSIGNNERWKTPLGARLSRDDIVEKLKAILGSSSGLVA |
| Ga0211683_100065021 | 3300020372 | Marine | HTGSIGNNERWKTPLGARLSRDDIVEKLKAILGSSLGLVA |
| Ga0211477_100077407 | 3300020374 | Marine | GSIGNNERWKTPLGARLSRDDIVEKQKVILGSSSGLVAXA |
| Ga0211476_100548873 | 3300020381 | Marine | MARVKRCGSIGNNERWKTPLGARLSRDDIVEKQKVILGSSSGLVA |
| Ga0211677_100401901 | 3300020385 | Marine | GNNERWKTPLGARLSRDDIVEKLKAVLGSSSGLVA |
| Ga0211677_101575252 | 3300020385 | Marine | HTGSIGNNERWKTPLGARLSRDDIVVKLKAVLGSSSGLVA |
| Ga0211677_102191342 | 3300020385 | Marine | TGSIGNNERWKTPLGARLSRDDNVEKLKAILGSSSGLVA |
| Ga0211678_102075182 | 3300020388 | Marine | HTGSIGNNERWKTPLGARLSRGDIVKKLKAILGSSSGLVA |
| Ga0211675_100380261 | 3300020391 | Marine | HTGSIGNNERWKTPLGARLSRDDIVGKLKAILGSSSGLVA |
| Ga0211675_100983013 | 3300020391 | Marine | HTGSIGNNERWKTPLGARLSRDDIVVKLKAFLGWSSGLVA |
| Ga0211666_100126881 | 3300020392 | Marine | SIGNNERWKTPLGARLSRDDIVGKLKAIFGWSSGLVA |
| Ga0211659_100141926 | 3300020404 | Marine | GNNERWKTPLGARLSRDDIVEKLKAIFGSSSGLVA |
| Ga0211556_104460662 | 3300020432 | Marine | HTGSIGNNERWKTPLGARLSRDDIVEKLKAIFGSSSGLVAXA |
| Ga0211576_104164312 | 3300020438 | Marine | GNNERWKTPLGARLSRGDIVEKLKAILGLSSGLVA |
| Ga0211576_104966252 | 3300020438 | Marine | GNNERWKTPLGARLSRGDIVEKLKAILGSSSGLVA |
| Ga0211518_100653251 | 3300020440 | Marine | GSIGNNERWKTPLGARLSRDDIVEKLKAVLGLSSGLVA |
| Ga0211641_101614503 | 3300020450 | Marine | HTGSIGNNERWKTPLGARLSRDDIVGKLKAIFGWSSGLVA |
| Ga0211676_100510521 | 3300020463 | Marine | TGSIGNNERWKTPLGARLSRGDIVEKLKAILGSSSGLVA |
| Ga0211676_105988742 | 3300020463 | Marine | HTGSIGNNERWKTPLGARLSRDDIVAKLKAILGWSSGLVA |
| Ga0211640_101343703 | 3300020465 | Marine | GSIGNNERWKTPLGARLSRDDIVEKQKAILGSSSGLVA |
| Ga0211713_102089523 | 3300020467 | Marine | HTGSIGNNERWKTPLGARLSRDDIVKKLKAILGSSSGLVA |
| Ga0211577_1000144321 | 3300020469 | Marine | HTGSIGNNERWKTPLGARLSRDDIVCFKKLKAILG |
| Ga0213861_101660901 | 3300021378 | Seawater | GSTGNSERWKTPLGARLSRDDIVEKLKAILGSSSGLVA |
| Ga0222717_104650242 | 3300021957 | Estuarine Water | TGSIGNNERWKTPLGARLSRDDIVEKLKAILGLSSGLVA |
| Ga0222718_101978191 | 3300021958 | Estuarine Water | TGSIGNNERWKTPLGARLSRDDVIERLKAILGWSSGLVA |
| Ga0222713_103393632 | 3300021962 | Estuarine Water | GSIGNNERWKTPLGARLSRDDIVEKLKAILGSSSGLVA |
| Ga0222719_104957351 | 3300021964 | Estuarine Water | KTPLGARLSRDDIVEKLKAILGSSSGLVAXAHEXSXV |
| (restricted) Ga0233429_10421363 | 3300022902 | Seawater | SIGNNERWKTPLGARLSRDDNVEKLKAILGSSSGLVA |
| Ga0255756_10854981 | 3300022905 | Salt Marsh | SIGNNERWKTPLGARLSRDDIVEKLKAILGSSSGLVA |
| Ga0255783_101725171 | 3300022923 | Salt Marsh | TGSTGNSERWKTPLGARLSRDDIVEKLKAILGSSSGLVA |
| Ga0255743_102576662 | 3300023110 | Salt Marsh | GNSERWKTPLGARLSRDDIVEKLKAILGSSSGLVA |
| Ga0228668_10430661 | 3300024180 | Seawater | GNNERWKTPLGARLSRDDNVEKLKAILGSSSGLVA |
| Ga0228653_10831192 | 3300024237 | Seawater | NERWKTPLGARLSRGDIVEKLKAILGSSSGLVAXA |
| (restricted) Ga0233440_10043239 | 3300024258 | Seawater | TGSIGNNERWKTPLGARLSRDDIVEKLKAILGSSSGLVA |
| (restricted) Ga0233445_100245311 | 3300024339 | Seawater | EHTGSIGNNERWKTPLGARLSRDDIVEKLKAILGSSSGLVA |
| Ga0209308_100435551 | 3300025869 | Pelagic Marine | TGSIGNNERWKTPLGARLSRDDIVAKLKAILGSSSGLVA |
| Ga0208624_10800952 | 3300026093 | Marine | GNNERWKTPLGARLSRDDNVEKLKAIFGSSSGLVAXA |
| Ga0207993_10204044 | 3300026270 | Marine | TGSIGNNERWKTPLGARLSRDDNVEKLKAILGWSSGLVA |
| Ga0228620_10496692 | 3300026483 | Seawater | IGNNERWKTPLGARLSRDDVFERLKAILGWSSGLVA |
| Ga0308010_11677312 | 3300031510 | Marine | GNNERWKTPLGARLSRDDIVEKLKAVFGWSSGLVA |
| Ga0315327_104179242 | 3300032032 | Seawater | EHTGSIGNNERWKTPLGARLSRDDVVEKQKAILGWSSGLVA |
| Ga0315315_112696692 | 3300032073 | Seawater | GSIGNNERWKTPLGARLSRGDIVEKLKAILGSSSGLVA |
| ⦗Top⦘ |