NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F040197

Metagenome / Metatranscriptome Family F040197

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F040197
Family Type Metagenome / Metatranscriptome
Number of Sequences 162
Average Sequence Length 40 residues
Representative Sequence MDPAVAALDFAKAGAILANMIESYLAGGAPPSNPEGADHD
Number of Associated Samples 147
Number of Associated Scaffolds 162

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 83.95 %
% of genes near scaffold ends (potentially truncated) 96.91 %
% of genes from short scaffolds (< 2000 bps) 96.91 %
Associated GOLD sequencing projects 145
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.148 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(25.926 % of family members)
Environment Ontology (ENVO) Unclassified
(26.543 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.062 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.29%    β-sheet: 0.00%    Coil/Unstructured: 64.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 162 Family Scaffolds
PF00078RVT_1 5.56
PF13408Zn_ribbon_recom 1.23
PF13518HTH_28 0.62
PF08388GIIM 0.62
PF00685Sulfotransfer_1 0.62


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.15 %
UnclassifiedrootN/A1.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459009|GA8DASG02GYH1INot Available516Open in IMG/M
3300000518|MB_CA_OM3_M2DRAFT_100257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis816Open in IMG/M
3300000733|JGI12408J11912_1011390All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis676Open in IMG/M
3300000955|JGI1027J12803_101496637All Organisms → cellular organisms → Bacteria → Proteobacteria900Open in IMG/M
3300001084|JGI12648J13191_1017677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis687Open in IMG/M
3300002915|JGI25387J43893_1048878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB23595Open in IMG/M
3300003505|JGIcombinedJ51221_10198056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis815Open in IMG/M
3300004152|Ga0062386_101542982All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300004629|Ga0008092_11174163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis899Open in IMG/M
3300004633|Ga0066395_10949048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium523Open in IMG/M
3300005172|Ga0066683_10392730All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis858Open in IMG/M
3300005332|Ga0066388_108668707All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005363|Ga0008090_13107300All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium503Open in IMG/M
3300005535|Ga0070684_101511111All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300005591|Ga0070761_10275863Not Available1008Open in IMG/M
3300005618|Ga0068864_101104128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis789Open in IMG/M
3300005764|Ga0066903_102344393Not Available1031Open in IMG/M
3300005983|Ga0081540_1008570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales7131Open in IMG/M
3300006028|Ga0070717_11305131All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300006047|Ga0075024_100226730All Organisms → cellular organisms → Bacteria → Proteobacteria886Open in IMG/M
3300006102|Ga0075015_100263446All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales937Open in IMG/M
3300006102|Ga0075015_100999210All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300006176|Ga0070765_100730420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales935Open in IMG/M
3300006354|Ga0075021_10357502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales911Open in IMG/M
3300006572|Ga0074051_11599083All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300006640|Ga0075527_10082997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis878Open in IMG/M
3300006904|Ga0075424_101493103All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis717Open in IMG/M
3300007076|Ga0075435_100674662All Organisms → cellular organisms → Bacteria → Proteobacteria898Open in IMG/M
3300007788|Ga0099795_10456506All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium589Open in IMG/M
3300009839|Ga0116223_10460687All Organisms → cellular organisms → Bacteria → Proteobacteria743Open in IMG/M
3300010046|Ga0126384_11869780All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300010358|Ga0126370_12212092All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300010359|Ga0126376_12386829All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB23576Open in IMG/M
3300010360|Ga0126372_10702425All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300010360|Ga0126372_10924503All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300010361|Ga0126378_10866392All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300010361|Ga0126378_11201003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis856Open in IMG/M
3300010366|Ga0126379_11174529All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300010366|Ga0126379_11466239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis788Open in IMG/M
3300010366|Ga0126379_13668683All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300010401|Ga0134121_12580416All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300011106|Ga0151489_1681144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB23513Open in IMG/M
3300011269|Ga0137392_10607902All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300011270|Ga0137391_11210829All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300012171|Ga0137342_1098796All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300012177|Ga0153943_1061871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis786Open in IMG/M
3300012204|Ga0137374_10567601All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300012683|Ga0137398_10404009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales930Open in IMG/M
3300012917|Ga0137395_10469729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales904Open in IMG/M
3300012930|Ga0137407_10628058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1009Open in IMG/M
3300012989|Ga0164305_12055560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB23523Open in IMG/M
3300013296|Ga0157374_10492820All Organisms → cellular organisms → Bacteria1229Open in IMG/M
3300013296|Ga0157374_11620130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis671Open in IMG/M
3300014153|Ga0181527_1145234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1045Open in IMG/M
3300014168|Ga0181534_10157603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1167Open in IMG/M
3300014874|Ga0180084_1046975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales851Open in IMG/M
3300015374|Ga0132255_104595571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB23585Open in IMG/M
3300016341|Ga0182035_10056432All Organisms → cellular organisms → Bacteria2693Open in IMG/M
3300016387|Ga0182040_11964651All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300016445|Ga0182038_11506473All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300017932|Ga0187814_10283691All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300017946|Ga0187879_10502572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales672Open in IMG/M
3300017955|Ga0187817_10249507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1131Open in IMG/M
3300017970|Ga0187783_10412356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales981Open in IMG/M
3300017970|Ga0187783_10420381All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300018006|Ga0187804_10205508All Organisms → cellular organisms → Bacteria → Proteobacteria842Open in IMG/M
3300018007|Ga0187805_10421009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB23621Open in IMG/M
3300018058|Ga0187766_10275652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1083Open in IMG/M
3300018073|Ga0184624_10505918All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300018090|Ga0187770_10862447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales726Open in IMG/M
3300020582|Ga0210395_10642961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales795Open in IMG/M
3300021088|Ga0210404_10840354All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300021178|Ga0210408_10060264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2964Open in IMG/M
3300021178|Ga0210408_11318538All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB23547Open in IMG/M
3300021181|Ga0210388_10305540All Organisms → cellular organisms → Bacteria → Proteobacteria1398Open in IMG/M
3300021358|Ga0213873_10290682All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300021388|Ga0213875_10275542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales794Open in IMG/M
3300021420|Ga0210394_11373060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB23601Open in IMG/M
3300021432|Ga0210384_10690803All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300021510|Ga0222621_1068072All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300021559|Ga0210409_10729391All Organisms → cellular organisms → Bacteria → Proteobacteria862Open in IMG/M
3300021861|Ga0213853_10856169All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300025134|Ga0207416_1092469All Organisms → cellular organisms → Bacteria → Proteobacteria1110Open in IMG/M
3300025922|Ga0207646_10561607All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300026345|Ga0257148_1005622All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300026356|Ga0257150_1020288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales931Open in IMG/M
3300026490|Ga0257153_1046100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales895Open in IMG/M
3300026515|Ga0257158_1024594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1031Open in IMG/M
3300026551|Ga0209648_10046611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei3732Open in IMG/M
3300026741|Ga0207510_102312All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300026819|Ga0207765_109859All Organisms → cellular organisms → Bacteria → Proteobacteria788Open in IMG/M
3300026887|Ga0207805_1013914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium844Open in IMG/M
3300026887|Ga0207805_1031155All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300027035|Ga0207776_1031991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium664Open in IMG/M
3300027061|Ga0209729_1029314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales681Open in IMG/M
3300027063|Ga0207762_1033087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium783Open in IMG/M
3300027371|Ga0209418_1040887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales818Open in IMG/M
3300027565|Ga0209219_1111433All Organisms → cellular organisms → Bacteria → Proteobacteria671Open in IMG/M
3300027629|Ga0209422_1101275All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300027635|Ga0209625_1054547All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300027654|Ga0209799_1012743All Organisms → cellular organisms → Bacteria1815Open in IMG/M
3300027879|Ga0209169_10689045All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300027910|Ga0209583_10269397All Organisms → cellular organisms → Bacteria → Proteobacteria760Open in IMG/M
3300027911|Ga0209698_10795616All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis715Open in IMG/M
3300027915|Ga0209069_10936893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB23527Open in IMG/M
3300028792|Ga0307504_10072517All Organisms → cellular organisms → Bacteria → Proteobacteria1038Open in IMG/M
3300028792|Ga0307504_10255223All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300028802|Ga0307503_10321501All Organisms → cellular organisms → Bacteria → Proteobacteria783Open in IMG/M
3300028906|Ga0308309_11797181All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300028909|Ga0302200_10492844All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300029908|Ga0311341_10446123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales743Open in IMG/M
3300029922|Ga0311363_11037281All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales714Open in IMG/M
3300029997|Ga0302302_1300385All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300030399|Ga0311353_10175433All Organisms → cellular organisms → Bacteria2029Open in IMG/M
3300030946|Ga0075379_10455111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales726Open in IMG/M
3300031027|Ga0302308_10397322All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300031471|Ga0272439_1185375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales973Open in IMG/M
3300031474|Ga0170818_111230911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales704Open in IMG/M
3300031543|Ga0318516_10303529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales922Open in IMG/M
3300031544|Ga0318534_10306550All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300031572|Ga0318515_10300642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales860Open in IMG/M
3300031620|Ga0315552_1242041All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300031679|Ga0318561_10613647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium599Open in IMG/M
3300031681|Ga0318572_10471705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis747Open in IMG/M
3300031681|Ga0318572_10685316All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300031715|Ga0307476_11370099All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300031718|Ga0307474_10821736All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales735Open in IMG/M
3300031754|Ga0307475_10555619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales921Open in IMG/M
3300031777|Ga0318543_10342058All Organisms → cellular organisms → Bacteria → Proteobacteria670Open in IMG/M
3300031778|Ga0318498_10421671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB23592Open in IMG/M
3300031779|Ga0318566_10229069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales922Open in IMG/M
3300031793|Ga0318548_10381043All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300031795|Ga0318557_10223923All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300031799|Ga0318565_10451201All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300031823|Ga0307478_11352380All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300031832|Ga0318499_10163280All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300031859|Ga0318527_10507273All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300031897|Ga0318520_10653525All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300031941|Ga0310912_10736356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales763Open in IMG/M
3300031941|Ga0310912_10890937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis685Open in IMG/M
3300031945|Ga0310913_10364758All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1023Open in IMG/M
3300031945|Ga0310913_10451853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales912Open in IMG/M
3300031945|Ga0310913_10712704All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis709Open in IMG/M
3300031946|Ga0310910_11453960All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300031954|Ga0306926_11087176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales946Open in IMG/M
3300031954|Ga0306926_12073371All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300032041|Ga0318549_10302651All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300032044|Ga0318558_10381751All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales700Open in IMG/M
3300032055|Ga0318575_10210512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales977Open in IMG/M
3300032066|Ga0318514_10305741All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis841Open in IMG/M
3300032067|Ga0318524_10716059All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300032089|Ga0318525_10410699All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300032091|Ga0318577_10367523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales688Open in IMG/M
3300032094|Ga0318540_10239595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales876Open in IMG/M
3300032180|Ga0307471_101264657All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300032205|Ga0307472_101541619All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300032954|Ga0335083_11333038All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300032955|Ga0335076_11783925All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300033755|Ga0371489_0481567All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium553Open in IMG/M
3300034197|Ga0370508_0068053All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300034354|Ga0364943_0447870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium503Open in IMG/M
3300034691|Ga0370488_227529All Organisms → cellular organisms → Bacteria537Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.17%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.17%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.94%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.32%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.32%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.09%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.47%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.47%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.47%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.85%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.23%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.23%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.23%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.23%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.23%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.23%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.23%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.23%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.23%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil1.23%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.62%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.62%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.62%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment0.62%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.62%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.62%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.62%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.62%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.62%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.62%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.62%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.62%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.62%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.62%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.62%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock0.62%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.62%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.62%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.62%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.62%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.62%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459009Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cmEnvironmentalOpen in IMG/M
3300000518Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2EnvironmentalOpen in IMG/M
3300000733Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001084Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1EnvironmentalOpen in IMG/M
3300002915Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cmEnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004629Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006640Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11BEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012171Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2EnvironmentalOpen in IMG/M
3300012177Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ027 MetaGHost-AssociatedOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014874Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10DEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021358Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3Host-AssociatedOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025134Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026345Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-AEnvironmentalOpen in IMG/M
3300026356Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-AEnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026741Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO21-C (SPAdes)EnvironmentalOpen in IMG/M
3300026819Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 59 (SPAdes)EnvironmentalOpen in IMG/M
3300026887Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 49 (SPAdes)EnvironmentalOpen in IMG/M
3300027035Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes)EnvironmentalOpen in IMG/M
3300027061Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027063Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes)EnvironmentalOpen in IMG/M
3300027371Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300028909Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1EnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029997Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030946Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031471Rock endolithic microbial communities from Victoria Land, Antarctica - Knobhead sudEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031620Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-70EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300034197Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02S_18EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M
3300034691Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F47_026883802170459009Grass SoilMDPAVATLDFAKAGAILANMIESFLSAGAPLFEPEEADDDNEDCRT
MB_CA_OM3_M2DRAFT_10025713300000518Forest SoilMDPAVAGLDFAKAGIVLANMIESYLAGGAPPSNPEG
JGI12408J11912_101139033300000733Tropical Forest SoilMDPALVAFDFAEAGVIIANMIESYLAAGAPPFDPE
JGI1027J12803_10149663733300000955SoilMEQALHPAIAALDFAKAGAILANMIESYLAAGAPPFDPEGPDDDAIE
JGI12648J13191_101767713300001084Forest SoilMDPAVATLDLAKAGAIIADMIESYLAGGAPPSNPELP
JGI25387J43893_104887813300002915Grasslands SoilMDPAVAALDIAKAGVILANMIESYLAGGAPPSNPEGAEHDDLQD
JGIcombinedJ51221_1019805613300003505Forest SoilMDPAVATLDFAKAGAIIANMIESYLAAGAPPFNAEGADHAESEDC
Ga0062386_10154298223300004152Bog Forest SoilMDPALAALDFAKAGAILADMIASHLAAGALPFDPEGPDDHDLEDRR
Ga0008092_1117416313300004629Tropical Rainforest SoilMDPAVANLDFAAAGAILANMIEAYLAGGALPSNAEGADHDDLEDC
Ga0066395_1094904823300004633Tropical Forest SoilMDPAVATFDFAKAGAIIADMIESYLAGGAPPSNPEGADHD
Ga0066683_1039273033300005172SoilMDPAVANLDFAAAGAILANMIEAYLAGGALPSNAEGADHD
Ga0066388_10866870723300005332Tropical Forest SoilMDPTVAALNLTKAAAIIANMIESYLAGGAPLPNREGADHDEFEDGRSP
Ga0008090_1310730013300005363Tropical Rainforest SoilMDPVVATLDLAKVAAIIADMIESYLAGGAPLSNPEGADHDDLQDCRST
Ga0070684_10151111113300005535Corn RhizosphereMDPALAALDFAKAGAILADMVVSYLAAGASPSDPERASEHDPE
Ga0070761_1027586313300005591SoilMASALHPAIAALDFAKAGAIIANMIESYLAAGVPP
Ga0068864_10110412833300005618Switchgrass RhizosphereMDPALIGFDLAQAGAIVADMIISYLAAGAPPLDCEEPND
Ga0066903_10234439343300005764Tropical Forest SoilMDPAVAALDLAKAGAILADMVESFLAAGTTPQLPEGADH
Ga0081540_100857073300005983Tabebuia Heterophylla RhizosphereMDPALVAFDFAKAGAILADMIVSYLAAGAPPFDPEEPDD
Ga0070717_1130513113300006028Corn, Switchgrass And Miscanthus RhizosphereMDPAVAALDFAKAGAIIANMIESYLAAGATPLNAEGAEHAE
Ga0075024_10022673043300006047WatershedsMDQAVATLDLAKAGAIIADMIESFLAGGAPPSNPE
Ga0075015_10026344643300006102WatershedsMDPALVAFDFAEAGVIIANMIESYLAAGAPPFDPEGPD
Ga0075015_10099921023300006102WatershedsMDPALVAFDFAKAGAILADMVESYLAAGAPPFDPEGPD
Ga0070765_10073042013300006176SoilMDPAVAAFDFAKAGAIVANMIESYLAAGALPPNPEGA
Ga0075021_1035750243300006354WatershedsMDQAVATLDLAKAGAIIADMIESFLAGGAPPSNPEGADHDD
Ga0074051_1159908313300006572SoilMDPAVAALDFAKAGAIIANMIESYLAGGTTLPDPEGADHDSLED
Ga0075527_1008299733300006640Arctic Peat SoilMDPALVDFDFAKAGAILADMVASYLAAGAPPFNLEGSDD
Ga0075424_10149310313300006904Populus RhizosphereMDPAVAALDLTKAGAIIASMIESYLAAGVTPPNAEGTEHAEFENSRA
Ga0075435_10067466213300007076Populus RhizosphereMDPAVAALDFAKAGAILANMIESYLAGGAPPSNPEGADHD
Ga0099795_1045650633300007788Vadose Zone SoilMEQALHPAIAALDFAKAGAILANMIESYLAAGAPPFDPEGP
Ga0116223_1046068733300009839Peatlands SoilMDPAVAALDIAKAGAILANMIESYLAGGAPPSNPEGADH
Ga0126384_1186978013300010046Tropical Forest SoilMDPALIGLDTAKAGAIVADMIVSYLAAGAPPFDPEEPNDNNIQNCR
Ga0126370_1221209223300010358Tropical Forest SoilMDLAVAALDLTKAGAIIANMIESYLAGGAPLPNMEGADHDEFE
Ga0126376_1238682923300010359Tropical Forest SoilMDPAVAALDFVKAGAILANMIESYLAAGASPFNAEGA
Ga0126372_1070242513300010360Tropical Forest SoilMDPAVATLDFAKAGAIIADMIESYLAGGAPPSNPEGADHD
Ga0126372_1092450323300010360Tropical Forest SoilMDPAVATLDFAEAGAIIANMIEPYLAAGAPPFDAEGAGHA
Ga0126378_1086639223300010361Tropical Forest SoilMEPAVATLDFAEAGAITANMIESYLAAGAPPFNAEGADHAESEDC
Ga0126378_1120100313300010361Tropical Forest SoilMDLAVAALDLTKAGAIIANMIESYLAGGAPLPNMEGADHDEFEDGRSPS
Ga0126379_1117452923300010366Tropical Forest SoilMDPALIALDFAKAGAVVADMIVSYLAAGAPPLDPEAPND
Ga0126379_1146623913300010366Tropical Forest SoilMDPAIATFDFAKAGAIIADMIESYLAGGAPPSNPEGADHDD
Ga0126379_1366868313300010366Tropical Forest SoilMDPAVAALDFAKAGAIIANMIESYLAAGATPLNAEGAE
Ga0134121_1258041623300010401Terrestrial SoilMDPALAALDFTKAGAILADMVVSFLAAGTPPSDPEGTDDHDHQDCR
Ga0151489_168114423300011106SoilMDPAVAALDIAKAGVILANMIESYLAGGAPPSNPEGAEHDDLQDR
Ga0137392_1060790243300011269Vadose Zone SoilMDPAVAAFDFAKAGAIVANMIESYLAAGALPPNPEGADHVE
Ga0137391_1121082923300011270Vadose Zone SoilMEPTLHSAVSVLDFAKAGAILADMIDSYLAAGAPPFDSEARDADV
Ga0137342_109879613300012171SoilMDPALAALDFAKAGAILAEMVVSCLAAGAPPSDPEGPDDHD
Ga0153943_106187133300012177Attine Ant Fungus GardensMDPALITLDFAKAGAIVADMIVSYLAAAELAPEEPNE
Ga0137374_1056760133300012204Vadose Zone SoilMDPAVANLDFAAAGAILANMIEAYLAGGALPSNAEGAD
Ga0137398_1040400913300012683Vadose Zone SoilMDPAVAALDFAKAGAIIANMIESYLAAGATPLNAE
Ga0137395_1046972913300012917Vadose Zone SoilMDPAVAGLDFAKAGIVLANMIESYLAGGAPPSNPE
Ga0137407_1062805833300012930Vadose Zone SoilMDPAVAGLDFAKAGIVLANMIESYLAGGAPPSKPEGAVHDKPQ
Ga0164305_1205556013300012989SoilMDPAVAALDIAKAGVILANMIESYLAGGAPPSNPEGAEYDDLQDRRS
Ga0157374_1049282013300013296Miscanthus RhizosphereMDPALAALDFAKAGAILADMVVSYLAAGASPSDPERASEHD
Ga0157374_1162013033300013296Miscanthus RhizosphereMDPALIGFDLAQAGAIVADMIISYLAAGAPPLDCEEP
Ga0181527_114523443300014153BogMDAALVAFDFTKAGAVLADMIASYLAAGAPPFDPEGP
Ga0181534_1015760323300014168BogMDPALVDFDFAKAGAILADMVASYLAAGAPPFNLEGVR*
Ga0180084_104697513300014874SoilMDPALAVLDFAKAGAILADMVVSCLAAGAPPSDPEGPD
Ga0132255_10459557123300015374Arabidopsis RhizosphereMDPAVAALDFAKAGAILANMIESYLAGCAPPSNPEGADHDDLQ
Ga0182035_1005643263300016341SoilMDPAVAALDLTNAGAIIANMIESYLAGGAPLPNMEGADH
Ga0182040_1196465123300016387SoilMDPALIAFDLAKAGAIVADMVVSYLAAGAPPFDTEQ
Ga0182038_1150647313300016445SoilVDPALASLDFAKAGAILADMVVSYLAAGAPPLHSEERDDHD
Ga0187814_1028369133300017932Freshwater SedimentMDPAVAALDLTKAAAIIANMIESYLAGGAPLPNIEGADLDEFEDG
Ga0187879_1050257213300017946PeatlandMAPALIAFDFAKAGAIVADMIASYLAAGAPPFDLEGPDDNEFE
Ga0187817_1024950713300017955Freshwater SedimentMDPAVAALDLTKAAAIIANMIESYLAGGAPLPNIEGAD
Ga0187783_1041235633300017970Tropical PeatlandMDPAVAALDLTKAGTIIANMIESYLAGGAPLPNMEGADHDEF
Ga0187783_1042038143300017970Tropical PeatlandMDSAVATLDFAKAGAIIANMIESYLAAGAPPFNAEGADHAESE
Ga0187804_1020550833300018006Freshwater SedimentMEPAVATFDFAKAGAIIADMIESYLAGGAPPSNPEGADHD
Ga0187805_1042100913300018007Freshwater SedimentMEPAVATFDFAKAGAIIADMIESYLAGGAPPSNPEGADHDD
Ga0187766_1027565243300018058Tropical PeatlandMDPAVAALDLTKAGAIIANMIESYLAGGAPLPNMEG
Ga0184624_1050591823300018073Groundwater SedimentMDPAVATLDFAKAGAIIANMIESYLAAGAPPFDAEGADHAEP
Ga0187770_1086244733300018090Tropical PeatlandMDPAVATFDLAKAGAIIADMIESFLAGGAPPSNPEGADHDDLG
Ga0210395_1064296113300020582SoilMDPALAALDFAKAGAILADMIASRLAAGALPFDPEGHDDHDL
Ga0210404_1084035423300021088SoilMDPAVAALDFAKAGAIIANMIEAYLAAGATPLNAEGAEHAECQD
Ga0210408_1006026433300021178SoilMDPAVAALDIAKAGAILANMIESYLAGGAPPSNPEGADHDDLQDSR
Ga0210408_1131853813300021178SoilMDPAVAGLDFAKAGIVLANMIESYLAGGAPPSNSEGAVH
Ga0210388_1030554013300021181SoilMDPAVAALDIAKAGAILANMIESYLAGGAPPSDPEG
Ga0213873_1029068223300021358RhizosphereMDPAVAAFDFAKAGVIVANMIESYLAAGALPSNPEG
Ga0213875_1027554213300021388Plant RootsMDPALVALDFAKAGAILADMVVSCLTAGVSPPNQERDDDHDGVQDRR
Ga0210394_1137306013300021420SoilMDPAVAALDIAKAGAILANMIESYLAGGAPPSNPEGADHDDLQDS
Ga0210384_1069080313300021432SoilMDPALVAFDFAKAGAILADMIVSYLAAGAPPFDAA
Ga0222621_106807213300021510Groundwater SedimentMDPAVAALDFAKAGAIIANMIESYLAAGATPLNAEG
Ga0210409_1072939133300021559SoilMDPAVAGLDFAKAGIVLANMIESYLAGGAPPSNSE
Ga0213853_1085616933300021861WatershedsMDPAVAALDFAKAGAILANMIESYLAAGASLSELE
Ga0207416_109246913300025134Iron-Sulfur Acid SpringMDPAVAALDIAKAGAILANMIESYLAGGAPPSNPEG
Ga0207646_1056160743300025922Corn, Switchgrass And Miscanthus RhizosphereMDPAVAALDFAEAGAIIANMIDSYLAAGAPPPDVEGPD
Ga0257148_100562213300026345SoilMDPAVATLDFAKAGAIIADMIESYLAGGAPPSNPE
Ga0257150_102028813300026356SoilMDPAVAGLDFAKAGIVLANMIESYLAGGAPPSNPEGAVHDK
Ga0257153_104610033300026490SoilMDPAVAALDFVKAGAILANMIESYLAGGAPPSDAEGADHDDLQNCRS
Ga0257158_102459443300026515SoilMDPAVAGLDFAKAGIVLANMIESYLAGGVPPSNPEGAVHDKP
Ga0209648_1004661173300026551Grasslands SoilMDPAVAALDIAKAGVILANMIESYLAGGAPPSNPEGAEH
Ga0207510_10231233300026741SoilMDPAVAALDFAKAGAIIANMIESYLAAGATPLNAEGAEHAERED
Ga0207765_10985913300026819Tropical Forest SoilMDPAVAALDFTKAGVILANMVESYLAGGAPPFNPEGAE
Ga0207805_101391433300026887Tropical Forest SoilMDPAVEALNFAEAGAIIANMIDSYLAAGAPPPDVEGPDHDQSQD
Ga0207805_103115513300026887Tropical Forest SoilMDPAVAALDLTKAAAIIANMIESYLAGGASLPNMEGADHDEFE
Ga0207776_103199113300027035Tropical Forest SoilMDPAVATLDFAKAGAIIADMIESYLAGGAPPSNPEGADHDDLQDCRS
Ga0209729_102931413300027061Forest SoilMDPALVAFDFAKAGAVLADMIVSYLAAGAPPLDPE
Ga0207762_103308713300027063Tropical Forest SoilMDPAVEALNFAEAGAIIANMIDSYLAAGAPPPDVEGP
Ga0209418_104088713300027371Forest SoilMDPAVANLDFAAAGAILANMIEAYLAGGALPSNAK
Ga0209219_111143333300027565Forest SoilMDPAVAALDLAKAGAIIADMIESYLAGGAPPSNPEGADH
Ga0209422_110127513300027629Forest SoilMDPAVATLNFAQAGAIIANMIESYLAAGAPPLNEE
Ga0209625_105454743300027635Forest SoilMDPAVAALDLTKAGAIIASMIESYLAAGATPPNAEGADHAEF
Ga0209799_101274313300027654Tropical Forest SoilMDPAVAALDFAKAGAVLADMVESFLAAGAVPALPR
Ga0209169_1068904523300027879SoilMDPALVALDFAKAGAIVADMVVSYLAAGAPSLNPEAPN
Ga0209583_1026939713300027910WatershedsMDPAVAALDFAKAGAILANMIESYLAGGAPPSSNPVG
Ga0209698_1079561613300027911WatershedsMDPALAALDFAKAGAILADMVVSYLTAGASPSDPE
Ga0209069_1093689323300027915WatershedsMDPAVATLDLAKAGAIIADMVESFLAGGAPPSNPEGADHD
Ga0307504_1007251713300028792SoilMDPAVAALDIAKAGVILANMIESYLAGGAPPSNPEGAEYDDLQD
Ga0307504_1025522313300028792SoilMDPALAALDFAKAGAILADMVASCLAAGALPFDPEGPDDHDLKD
Ga0307503_1032150133300028802SoilMDPAVATLDFVKAGAILANMIESYLAGGAAPTNTE
Ga0308309_1179718113300028906SoilMDPALAALDFAKAGAILADMVASCLAAGALPLDPEGPDDH
Ga0302200_1049284413300028909BogMDPALAAFDIAKAGAILADMVIAFLDAGTSPPDPEEPPDDHDGQD
Ga0311341_1044612313300029908BogMDPALVAFDFTKAGAILADMVESYLAAGAPPFDPEGADDN
Ga0311363_1103728133300029922FenMDPALVNFDFAKAGAILADMVASYLAAGAPPFNPEGADD
Ga0302302_130038523300029997PalsaMDPALVNFDFAKAGAILADMVASYLAAGAPPFNPEG
Ga0311353_1017543343300030399PalsaMDPAVATLDLAKAGAIIADMIESYLAGGAPSNPEG
Ga0075379_1045511133300030946SoilMDPAVAALDIAKAGAILANMIESYLAGGAPPSNPEGADHDDL
Ga0302308_1039732233300031027PalsaMDPALVDFDFAKAGAILADMVASYLAAGAPPFNPQ
Ga0272439_118537513300031471RockVEPALVVFDLAKAGAILADMVVSYLAAGASPSDPEGADDHDDVQDRR
Ga0170818_11123091133300031474Forest SoilMDPALAALDFTKAGAILADMVVSFLAAGTPPSDPEGTDEHDHQNR
Ga0318516_1030352913300031543SoilMDPAVAAFDFAKAGVIVANMIESYLAAGALPSNPEGAN
Ga0318534_1030655013300031544SoilMDPALAALDFAKAGAILADMVASCLAAGALPFDPEGPNDHD
Ga0318515_1030064213300031572SoilMDPAVAAFDFAKAGVIVANMIESYLAAGALPPNPEG
Ga0315552_124204113300031620Salt Marsh SedimentMDPALAALDFAKAGAILADMVVSYLAAGAPPSDPEG
Ga0318561_1061364723300031679SoilMDPAVAAPDFAKAGAIIANMIESYLAAGAPPFNAEGADHAAESEDCRS
Ga0318572_1047170533300031681SoilVDPALASLDFAKAGAILADMVVSYLAAGAPPLHPE
Ga0318572_1068531623300031681SoilMDPAVAALDFAKAGVIVANMIESYLAAGALPPNPEGADHVEHQD
Ga0307476_1137009923300031715Hardwood Forest SoilMDPALVDFDFAKAGAILADMVASYLAAGAPPFNPEGADDDEL
Ga0307474_1082173613300031718Hardwood Forest SoilMDPAIAALDFVKAGAIIANMIESYLAAGAPPLNAEGAD
Ga0307475_1055561913300031754Hardwood Forest SoilMDPAVAGLDFAKAGIVLANMIESYLAGGAPVWPKN
Ga0318543_1034205813300031777SoilMDPAVATLDLAKAGAIIADMIESYLAGGAPSSNPEGADHDDL
Ga0318498_1042167133300031778SoilMDPAVAALDLTKAGAIIANMIESYLAGGAPLPNME
Ga0318566_1022906913300031779SoilLDPALASLDFAKAGAILADMVVSYLAAGAPPLHSEERDDH
Ga0318548_1038104313300031793SoilMDPALIALDFAKAGAVVADMIVSYLAAGAPPLDPEAPNDPNVQD
Ga0318557_1022392333300031795SoilMDPALIALDFAKAGAVVADMIVSYLAAGAPPLDLEA
Ga0318565_1045120133300031799SoilMDPAVAALDFAKAGAIIANMIESYLAAGALPFNAEGA
Ga0307478_1135238013300031823Hardwood Forest SoilMDPAVAALDFAKAGAIIANMIESYLAAGATPLNAEGAEHAEREDCR
Ga0318499_1016328013300031832SoilMDPAVAALDFAKAGAIVANMIEAYLAAGATPLNAGAD
Ga0318527_1050727323300031859SoilMDPAVAAFDFAKAGVIVANMIESYLAAGALPSNPEGADHVEHQD
Ga0318520_1065352513300031897SoilMDPAVAALDLTKAAAIIANMIESYLAGGAPLPNMEGAD
Ga0310912_1073635613300031941SoilMDPAVATLDLAKAGAIIADMIESFLAGGAPPSNPEGADHDDLQDCRS
Ga0310912_1089093733300031941SoilVDPALASLDFAKAGAILADMVVSYLAAGAPPLHPEERDDHDV
Ga0310913_1036475813300031945SoilMDPTLIAFDFAKAGAIVADMIVSYLAAGAPPLDPEQPNDPDV
Ga0310913_1045185313300031945SoilMDPAVAALDLAKAGAIIANMIESYLAGGGPLPNMKGGD
Ga0310913_1071270413300031945SoilVDPALASLDFAKAGAILADMVVSYLAAGAPPLHPEERDDHD
Ga0310910_1145396023300031946SoilMDPAVAALDFGKAGAIIANMIESYLAAGALPFNAEGADH
Ga0306926_1108717643300031954SoilVDPALASLDFAKAGAILADMVVSYLAAGAPPLHPEERDDH
Ga0306926_1207337113300031954SoilMDPAVATLDFAEAGAIIANMIESYLAAGAPPFNAEG
Ga0318549_1030265133300032041SoilMDPAVAAFDFAKAGVIVANMIESYLAAGAPPPNPEGAHHVEHQ
Ga0318558_1038175133300032044SoilMDPAVAALDLTKAGAIIANMIESYLAGGAPLPNIEGADHD
Ga0318575_1021051233300032055SoilMDPAVAALDLTKAAAIIANMIESYLAGGAPLPNREGADHDEFED
Ga0318514_1030574113300032066SoilVDPALASLDFAKAGAILADMVVSYLAAGAPPLHPEERDDHDVQ
Ga0318524_1071605913300032067SoilMDPAVAALDLTKAAAIIANMIESYLAGGAPLPNMEGADHDEFEDDRS
Ga0318525_1041069923300032089SoilMDPAVAALDLTKAGAIIANMIESYLAGGAPLPNREGADHD
Ga0318577_1036752333300032091SoilMDPALAALDFAKAGAILADMVASCLAAGALPLDPEGPD
Ga0318540_1023959513300032094SoilMDPALAALDFAKAGAILADMVASCLAAGALPFDPEGPNDHDLKDR
Ga0307471_10126465733300032180Hardwood Forest SoilMDPALAALDFTQAGAILADMVVCFLAAGDPPYDPEGTDDHDLQ
Ga0307472_10154161913300032205Hardwood Forest SoilLDPALASLDFAKAGAILADMVVSYLAAGAPPLHSEE
Ga0335083_1133303813300032954SoilMDPAVAALDFAKAGAIIANMIESYLAAGASPFNAEGADHAEPEDCRSS
Ga0335076_1178392523300032955SoilMDPAVATLDFAKAGAIVANMIESYLAAGALPPNPEGADHVE
Ga0371489_0481567_448_5523300033755Peat SoilMDSAVASLDFAKAGAIIANMIESYLAAGAPPLEPE
Ga0370508_0068053_1_1233300034197Untreated Peat SoilMDPAVATLDFAKAGAIIANMIESYLAAGAPPFDAEGADHAE
Ga0364943_0447870_2_1213300034354SedimentMDPAVATLDLAKAGAIIADMIESYLAGGALPSNPEGDDHD
Ga0370488_227529_397_5373300034691Untreated Peat SoilMDPALAALDIAKLGAILADMIICRLDAGVVPAPEGPPDDQDHRPAPV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.