NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F039456

Metagenome Family F039456

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039456
Family Type Metagenome
Number of Sequences 163
Average Sequence Length 89 residues
Representative Sequence MHCGNTTFAYSNEFNDYMKVDGAESEDIFDYLFDIRAGKFLSEEGKKYLLELFEEYDPEHLNQINEDFDEYLDNDDLENIIGDEGVQNLNNDD
Number of Associated Samples 9
Number of Associated Scaffolds 163

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 45.52 %
% of genes near scaffold ends (potentially truncated) 37.42 %
% of genes from short scaffolds (< 2000 bps) 82.21 %
Associated GOLD sequencing projects 6
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (74.233 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave
(80.368 % of family members)
Environment Ontology (ENVO) Unclassified
(99.387 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(100.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.63%    β-sheet: 0.00%    Coil/Unstructured: 55.37%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.23 %
UnclassifiedrootN/A25.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006020|Ga0058704_10076681All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1739Open in IMG/M
3300006020|Ga0058704_10108587All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1483Open in IMG/M
3300006020|Ga0058704_10116234All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1438Open in IMG/M
3300006020|Ga0058704_10119266All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1421Open in IMG/M
3300006020|Ga0058704_10135698All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1338Open in IMG/M
3300006020|Ga0058704_10143741All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1303Open in IMG/M
3300006020|Ga0058704_10155102All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1256Open in IMG/M
3300006020|Ga0058704_10164270All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1224Open in IMG/M
3300006020|Ga0058704_10168705All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1209Open in IMG/M
3300006020|Ga0058704_10196797All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1124Open in IMG/M
3300006020|Ga0058704_10212831All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1083Open in IMG/M
3300006020|Ga0058704_10264131All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha976Open in IMG/M
3300006020|Ga0058704_10273331All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha960Open in IMG/M
3300006020|Ga0058704_10281119All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha947Open in IMG/M
3300006020|Ga0058704_10282603All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha944Open in IMG/M
3300006020|Ga0058704_10290730All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha931Open in IMG/M
3300006020|Ga0058704_10292567All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha929Open in IMG/M
3300006020|Ga0058704_10349411All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha851Open in IMG/M
3300006020|Ga0058704_10352726Not Available847Open in IMG/M
3300006020|Ga0058704_10357899All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha841Open in IMG/M
3300006020|Ga0058704_10388980All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha807Open in IMG/M
3300006020|Ga0058704_10389619All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha806Open in IMG/M
3300006020|Ga0058704_10393700All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha802Open in IMG/M
3300006020|Ga0058704_10412001All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha784Open in IMG/M
3300006020|Ga0058704_10444039Not Available755Open in IMG/M
3300006020|Ga0058704_10445325All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha754Open in IMG/M
3300006020|Ga0058704_10446110All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha753Open in IMG/M
3300006020|Ga0058704_10452396All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha748Open in IMG/M
3300006020|Ga0058704_10481524All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha725Open in IMG/M
3300006020|Ga0058704_10541349All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha683Open in IMG/M
3300006020|Ga0058704_10541778All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha682Open in IMG/M
3300006020|Ga0058704_10624589All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha634Open in IMG/M
3300006020|Ga0058704_10655858All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha619Open in IMG/M
3300006020|Ga0058704_10655996All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha618Open in IMG/M
3300006020|Ga0058704_10660155All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha616Open in IMG/M
3300006020|Ga0058704_10661457All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha616Open in IMG/M
3300006020|Ga0058704_10695891Not Available600Open in IMG/M
3300006020|Ga0058704_10702707All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha597Open in IMG/M
3300006020|Ga0058704_10704559All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha596Open in IMG/M
3300006020|Ga0058704_10707264All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha595Open in IMG/M
3300006020|Ga0058704_10714102All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha592Open in IMG/M
3300006020|Ga0058704_10732919Not Available584Open in IMG/M
3300006020|Ga0058704_10733087All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha584Open in IMG/M
3300006020|Ga0058704_10744774All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha579Open in IMG/M
3300006020|Ga0058704_10745415All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha579Open in IMG/M
3300006020|Ga0058704_10750003All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha577Open in IMG/M
3300006020|Ga0058704_10777646All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha566Open in IMG/M
3300006020|Ga0058704_10778366All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha566Open in IMG/M
3300006020|Ga0058704_10861754Not Available536Open in IMG/M
3300006020|Ga0058704_10865840All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha535Open in IMG/M
3300006020|Ga0058704_10872452All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha532Open in IMG/M
3300006020|Ga0058704_10878214All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha531Open in IMG/M
3300006020|Ga0058704_10887810All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha527Open in IMG/M
3300006020|Ga0058704_10951516All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha509Open in IMG/M
3300006020|Ga0058704_10961487All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha506Open in IMG/M
3300009040|Ga0058703_1118953All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha870Open in IMG/M
3300027628|Ga0209463_1067286All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha963Open in IMG/M
3300027750|Ga0209461_10052484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha833Open in IMG/M
3300027809|Ga0209574_10135120All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha738Open in IMG/M
3300027809|Ga0209574_10147066All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha715Open in IMG/M
3300027809|Ga0209574_10173256All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha673Open in IMG/M
3300027809|Ga0209574_10176491All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha669Open in IMG/M
3300027809|Ga0209574_10198312All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha640Open in IMG/M
3300027809|Ga0209574_10225112Not Available611Open in IMG/M
3300027809|Ga0209574_10227442Not Available608Open in IMG/M
3300027809|Ga0209574_10233130All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha603Open in IMG/M
3300027809|Ga0209574_10348315Not Available517Open in IMG/M
3300027809|Ga0209574_10350275All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha516Open in IMG/M
3300027809|Ga0209574_10364988All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha507Open in IMG/M
3300030497|Ga0268252_1150342All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha596Open in IMG/M
3300030497|Ga0268252_1187200All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha515Open in IMG/M
3300030501|Ga0268244_10050057All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1731Open in IMG/M
3300030501|Ga0268244_10092161All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1351Open in IMG/M
3300030501|Ga0268244_10096561All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1325Open in IMG/M
3300030501|Ga0268244_10100131All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1306Open in IMG/M
3300030501|Ga0268244_10118157All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1219Open in IMG/M
3300030501|Ga0268244_10141453All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1132Open in IMG/M
3300030501|Ga0268244_10151893All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1099Open in IMG/M
3300030501|Ga0268244_10157273All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1083Open in IMG/M
3300030501|Ga0268244_10165712All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1059Open in IMG/M
3300030501|Ga0268244_10176837All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1030Open in IMG/M
3300030501|Ga0268244_10182857All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1016Open in IMG/M
3300030501|Ga0268244_10197844All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha982Open in IMG/M
3300030501|Ga0268244_10207668All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha962Open in IMG/M
3300030501|Ga0268244_10209628All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha958Open in IMG/M
3300030501|Ga0268244_10211165All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha955Open in IMG/M
3300030501|Ga0268244_10217436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha943Open in IMG/M
3300030501|Ga0268244_10222918All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha933Open in IMG/M
3300030501|Ga0268244_10239112All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha905Open in IMG/M
3300030501|Ga0268244_10267758All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha862Open in IMG/M
3300030501|Ga0268244_10282154All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha842Open in IMG/M
3300030501|Ga0268244_10330730All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha785Open in IMG/M
3300030501|Ga0268244_10334790All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha781Open in IMG/M
3300030501|Ga0268244_10338408All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha777Open in IMG/M
3300030501|Ga0268244_10350402All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha765Open in IMG/M
3300030501|Ga0268244_10398545All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha722Open in IMG/M
3300030501|Ga0268244_10406640All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha716Open in IMG/M
3300030501|Ga0268244_10435098All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha694Open in IMG/M
3300030501|Ga0268244_10445471All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha687Open in IMG/M
3300030501|Ga0268244_10449885All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha684Open in IMG/M
3300030501|Ga0268244_10451350Not Available683Open in IMG/M
3300030501|Ga0268244_10456524All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha679Open in IMG/M
3300030501|Ga0268244_10456831All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha679Open in IMG/M
3300030501|Ga0268244_10458067All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha678Open in IMG/M
3300030501|Ga0268244_10533546All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha633Open in IMG/M
3300030501|Ga0268244_10535432All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha632Open in IMG/M
3300030501|Ga0268244_10541898All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha628Open in IMG/M
3300030501|Ga0268244_10549127All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha624Open in IMG/M
3300030501|Ga0268244_10562710All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha617Open in IMG/M
3300030501|Ga0268244_10563484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha617Open in IMG/M
3300030501|Ga0268244_10568797All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha614Open in IMG/M
3300030501|Ga0268244_10575620All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha611Open in IMG/M
3300030501|Ga0268244_10591115Not Available603Open in IMG/M
3300030501|Ga0268244_10597631Not Available600Open in IMG/M
3300030501|Ga0268244_10604383All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha597Open in IMG/M
3300030501|Ga0268244_10701877All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha557Open in IMG/M
3300030501|Ga0268244_10728037All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha547Open in IMG/M
3300030501|Ga0268244_10740345All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha543Open in IMG/M
3300030501|Ga0268244_10767186All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha534Open in IMG/M
3300030501|Ga0268244_10775107Not Available531Open in IMG/M
3300030501|Ga0268244_10776569Not Available531Open in IMG/M
3300030501|Ga0268244_10816440All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha518Open in IMG/M
3300030501|Ga0268244_10872484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha502Open in IMG/M
3300030501|Ga0268244_10880308All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha500Open in IMG/M
3300030514|Ga0268253_10121158All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha782Open in IMG/M
3300030514|Ga0268253_10158855All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha707Open in IMG/M
3300030514|Ga0268253_10165709All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha696Open in IMG/M
3300030514|Ga0268253_10176460All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha680Open in IMG/M
3300030514|Ga0268253_10176781All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha679Open in IMG/M
3300030514|Ga0268253_10197876All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha651Open in IMG/M
3300030514|Ga0268253_10199665All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha649Open in IMG/M
3300030514|Ga0268253_10220553All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha625Open in IMG/M
3300030514|Ga0268253_10374307All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha510Open in IMG/M
3300030514|Ga0268253_10376773All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha509Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave80.37%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave19.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.61%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006020Agave microbial communities from Guanajuato, Mexico - Mg.Sf.eHost-AssociatedOpen in IMG/M
3300009040Agave microbial communities from Guanajuato, Mexico - Mg.Ma.eHost-AssociatedOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300027628Agave microbial communities from Guanajuato, Mexico - Mg.Sf.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027750Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027809Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300030497Agave microbial communities from Guanajuato, Mexico - Mg.Sf.rz (v2)Host-AssociatedOpen in IMG/M
3300030501Agave microbial communities from Guanajuato, Mexico - Mg.Sf.e (v2)Host-AssociatedOpen in IMG/M
3300030514Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0058704_1005897613300006020AgaveLARAIGFFNIYHQCWTLIEKGKTLMHCGNTTFAYSNEFNDYMKVDGAESEDIFYYLFDIGAGKFLSKEGKKYLLELFQEYDPEHLNEINEDFDEYPDNDDLEDIIGDEGMQNLYNDD*
Ga0058704_1007668113300006020AgaveMKVE*AVSEDIFDYLFDVGVGKFLSEKGKKYLLELSEKEDPEHLQFDEDFDNYPGNDGVEDIIEDEGIQNLNNDD*
Ga0058704_1010858713300006020AgaveMHCENTTFSYSDGFKDYMKVDGGESKDIFDYLFDVGAEKFLSEEGKKYLLKLFEEYDQEHLNQIDEDFDDYLDNDCLKNIIRDECMQNLNNGD*
Ga0058704_1011623413300006020AgaveMWALIEQGKTLMHCGNTTFAYNNEFKDYMKVDRVVSEDIFDYLFDVGVGKFLSETRKKISP*IEE*DLEHLKQLDEDFHDYLDNDGHEDIIGDKGIQNLNNDD*
Ga0058704_1011926643300006020AgaveMHYENTTFTYDSEFKDYMKVDRVESRDIFNYLFDVGAEKFLSEKGKKYLLEIFEEWDPEHLKQIDEDFDDYPDSEGLEDIFRDEGM*
Ga0058704_1013569813300006020AgaveDYMKVDGAESEDIFYYLFDVGAEKFLSEKGKKYLLELFKEWDPQHLKQIDEGSYDYLDNDGLKDIIGDKGKQNLNNDD*
Ga0058704_1014374123300006020AgaveMHCGNTVLAYDNEFKDYMKVDGVVSGDILDYLFDVGAEKFLSKKGKKYLLELLEEWNSEHLKQLEDFDDYPEKDDLKNIIRDEGM*
Ga0058704_1015510233300006020AgaveMLGLN*KTKILMHCGNTTFAYSNEFNNYMKVDVAESEDIFDYLFDIGAGKFLSEE*KKYLLDLFEKYDPEHLNEINEDFDEYPDNDGLEDIIGDEGI*
Ga0058704_1016427013300006020AgaveMKMEGAESEDIFDSLFDVGVEKFLLEKYLLEFLEEYDSKHLNQIDEDFDDHPDNDGLKNIIRDKGMQNLNNDN*
Ga0058704_1016870523300006020AgaveMHCGNTAFAYSNEFNDYIKVDGAESEDIFDYLFDIGAGKFLSEEEKKYLLELFEEYDLEHLNQINEDFDEYPYNDGLEDN*
Ga0058704_1017199733300006020AgaveVHIVTDPALTRAIGFFNIYHQCWALIEKGKTLMHCGNTTFAYSNKFKDYMEVDGVESKNIFDYLFDVGAGKFLLEEGKKYILELFEEYDPQHLNQIDEDFDDYPDNDGLENIIGDEGIQNLNNDD*
Ga0058704_1019679723300006020AgaveMHCENTTFTYDNEFKEFMKVEGAISEDIFYYLFDVGAEKFLSKKEKIYLLELFEE*DPKHLKQIDEDFDDYLDNDGLENIIGDGGM*
Ga0058704_1021283123300006020AgaveMHCGNTTFACDNEIKDYMKVEGAESEDIFNYLFDVGARTFLSEKGKKYLLELFEEYDSEHLNQIDEDFDNYLDNEGLKNIIGDEGMQNLNNDD*
Ga0058704_1024718013300006020AgaveLARAIGFFNIYHKCWALIEKGKTLMHCGNTTFAYSNESNDYMEVDGAESEDIFDYLFDIGAGKFLSEKEKKYLLELFEEYDPEHLNEINDDFDEYPDNEGLEDIIGDEGMQNLNNND*
Ga0058704_1026413113300006020AgaveYSNEFKDYMKVDGAKSADIFYYLFDFGVGKFLSEEGKKYLLELFEEWDPGQPKQINEDFDDYPDNDGLEDVIGDEGMQNLNNDD*
Ga0058704_1027333123300006020AgaveMHCGNTTFAYSNEFKDYMKMDGAESEDIFDYLFDVEAEKFLSENGKKYFLELFEEYDPEHLNQIDEDIDDYPGNDSVKKIIGDEEMQNLNNDD*
Ga0058704_1028111913300006020AgaveMYHQFWALIEQGKILMHCRNTTFTYNNEFKDYMKMDGAVSKDIFDYVFDVRAGKFLSEKEKKYLLELFEEWDPKHLKQLDEEYDDYRDYDGLEDIIGDERIHNLNNDD*
Ga0058704_1028260313300006020AgaveCGNTTFAYSNEFNDYMKVDGAESEDTFDYLFDIGAGKFLSEEGKKYLIELFKEYDPEYFNQISKDFDDYPNNDGLEDIIGDEGMQNLSNDD*
Ga0058704_1029073023300006020AgaveTTFAYSNEFNDYMKVDDAESEDIFDYLFDIGAGKFLSEEGKKYLLQLFEEYDPEHLKEINEDLNEYPDNDDLEDIIGDEGM*
Ga0058704_1029256713300006020AgaveMHCGNTTFAYSNELNDYMKVDGAESKDIFDYLFDIGAGKFFSEEGKKYLLELFEEYDPEHLNEINEDFDEYPDNDNLEDIIGEEGMQNLYNDD*
Ga0058704_1034941123300006020AgaveMHCENTTFAYSNEFNDYMKIDGVESEDIFDYLFDIGAGKFLSEEGKNYLLELFQEYDLEHLNEINEDFDEYPDNDDLEDIIGDEG
Ga0058704_1035272613300006020AgaveMHSGNTTFAHNNEFNDYIKVDGAESEDIFDYHFDIGAEKFLSEE*KKYLLELFEEYDPEYLNQINE
Ga0058704_1035789913300006020AgaveLTRKTLIHYGNTTFAYDNEVKDYMKAEGAESEDIFDYLFDVGAEKFLSEKEKKYLLELFEKYNPEHLNQIDKDFDDLKNIIGDEGMQNLNNDD*
Ga0058704_1038898023300006020AgaveLIEKEKTLLHCGNTTFASSNEFNDYMKMDDAESEDIFEYLFDIGAGKFLSEEGKKYLLELFEEYDPEHLNQINEDFDEYPDNDDLENIIGDEGMQNINNDD*
Ga0058704_1038961923300006020AgaveMKVEGAVSEDIFDYVFDVEAEKFLSEKGKKHLLKLFEDWDLEHLKQIDEDFDDYLDNDDLKNIIGYEGMQNLNKDDQSCHH*
Ga0058704_1039370013300006020AgaveMYCEKTTFAYNNEFKDYMMVEGAVPEDIFDYLFDIGAKKFLSEKEKKYFLELFEKWDPEYLQLNESFDHPDNDGLKDIIGDEGIQNHNNDY*
Ga0058704_1041200123300006020AgaveMHYGNITFAYDNEFKEYMKVEGATSEDVFDYIFEVGGGKFLSET*KKYLLKLFEK*DLEHLQLNEDFHNYPDNDGLEDIIGDGGMQNLNNDD*
Ga0058704_1041200613300006020AgaveVHLVTDPALARAIGFFNIYHQCWALIEQGKMLMYCGNTTFADGNEFRDYMKVEGPVSEDILNYLFDVGAEKFLSEKEKKYLVELFEKWDPEHLQLDESFDDYADNNGRENIIGDEGM*
Ga0058704_1044403913300006020AgaveMFGINRTRKNINAL*NTTFAYDNEFKDYMKVDGAV*EDIIDCLFDVGA*KYLSETEKKYLLELFEEWDPEHLKQIDEYFDDYSDNDGLKDIIGDEGMRNLNNDD*
Ga0058704_1044532523300006020AgaveMHCGNTTFAYSNEFKDHMKVDGAESEDIFDHLFDVGVGKFLSENEKKYLLELFEEWDPEHLKQINEDFDDYLDNDGLEDIIGEKGMQNLNNDD*
Ga0058704_1044611023300006020AgaveMKVEGAVSKDIFDYLFDIGAGKFLLEKEKKYLLELFEK*DPKHLQFVESFNDYPDNGGLKDIIGHEGMQNLNNND*
Ga0058704_1045239623300006020AgaveMKVDGAVSGDIFDYLFDFGAGKFLLEKWTNYLLELFEEWDPEHLKQIDEDFNDYLDNDGLEDIIGDEKMQN
Ga0058704_1045854723300006020AgaveHIVTDPALARAVGFFNIYHQCWALIEKGKTLMHCGNTTFAYSNEFKDYMKVDGAESEDIFDYLFDVGAGKFLSKNGKKYILELFEEYDPKHLNQINKYFDDYPDNDDLEDIIGDEGMQNLNNDD*
Ga0058704_1048152423300006020AgaveMYCRNTTFTYSSEFKYYMTVDGAESEDIFCYRFDVGAGKFLSEEGKKYLLVIFEEYDPEHLNQINEDFDDYLDNDGLEDIIRDEGMQNLNNDN*
Ga0058704_1054134923300006020AgaveMKVEGVVSEDIFNYFFDVEAETFLSEKEKKYLLELFEEWDPEHLKQFDEDSNDYPDNHGLEDIIRDEGMQNLNNDD*
Ga0058704_1054177833300006020AgaveMHYRNITFAYSNEFNNYIKVDGAKSEDIFDYLFDIGAEKFLSEEGKRYLFELFEEYDPEHLNQINEDFDEYPDNDDL
Ga0058704_1059513813300006020AgaveQNWIHGDPVHIVTDPALARAIGFFNIYHQCWALIEKEETLMHCGNTTFAYSNEFNDYIKMDGAESEDIFDYLFDVGAGKYLSQEGKKYLLELFEEYDPEHLNQINEDFDEYPDNDDLENIIGDEGMQNLNNDD*
Ga0058704_1062458913300006020AgaveMHCGNTTFAYSNEFNDYMKVDGAESEDIFDNLFDVGAGKFLSQEGKKYLLELFEEYDPEHLNQINEDFDE
Ga0058704_1065585813300006020AgaveMHCGNTTFAYSNEFNDYIKVDGVKSEDILDYLFDIGAEKFLSEEGKKYLLELFEDYDPEHLSQINEDFDDYLDNDGLKNIIGDE
Ga0058704_1065599613300006020AgaveMHCENTIFTYSNEFNDYMKVDGAESKDIFDYLFDIGVGKFLSEEGKKYLLELFEEYDPEHLNQINEDFDEYPDNDG
Ga0058704_1066015523300006020AgaveGNTTFAYSNEFKDYMKVDGVELEDIFDYLFDVGARKFLSEEGRKYLLELFEEYDPEHLNQIDEYFDYYPDNNGLKNIIRNEGTQNLNNDD*
Ga0058704_1066145713300006020AgaveDIFDYLFDVGAEKFLSKRRKKYLLELLERWDLEHLKQLDEEFDGYPTNDGLEDIIGDKEMHNLNNND*
Ga0058704_1066557723300006020AgaveMKVEGAVSEDIFDYLFDIGAEKFLLVKGKQYLLELCEKRDPEHLKQFDEDFNDYLDNDGLEDII*
Ga0058704_1069589123300006020AgaveFKEYMKMEGAVSEDIFNYLFDVRDEKFLSKKGKKYLLELFEKMDLEHLKQLDEDFDDYPSNDDLEDIIVEEGIQNLNNDD*
Ga0058704_1070270723300006020AgaveMHCGNTTFAYSNEFNDYMKVDGVESEDIFDYLFDIGAEKFLLGEGKKYLLELFKEYDPKHLNQINKDFDDYLDNDSLEDIIGD
Ga0058704_1070455913300006020AgaveMHCGNTTLACDNEFKYYMKVEGAVSEYIFYYLFDVGAEKFLSEKGKKYIFELFEERDPEYHKQIDEDFDDYPDN
Ga0058704_1070726413300006020AgaveLALIEQEKTLTYCGNTTFAYGNEFKEYMKVEGVVSEDIFDYPFDVGVGKFLSAKAKKYLLELFEKYDPKHLKQLDEDFDNYPNNDGLEDIIRDEGMQNLNNND*
Ga0058704_1071410213300006020AgaveMHCGDTTFACDNEFKDYMNVDGVVSKDIFHYLFDVGVGKFLSKKGKKYLLELFKEWDPEHLRQLNEEFDNCPDNDGLEDIIKDEGM*
Ga0058704_1071610313300006020AgaveYDNELKEYMKVEEVLSEDIFDHLFDVGVGKFLSEKGKKELLGLFEKWDIQHLQLDEDFDDYPDNDCLKNIIRDEGMQNFNNNN*
Ga0058704_1073291923300006020AgaveMLGIDWKKKMLMHCRNTTFAYSNEFKDYRQVDGTESEDIFDYLVDVGGGKFLSENGKKYLLELFEKYDLEHINQINEDFDDYPNNDSLEDIIRDECMQNLNNDD*
Ga0058704_1073308713300006020AgaveIYCGNTTFTYDNEFKEYMKVEGVVSEDIFDYPFDVGAGKFLSKKGKKYVFELFEEWEPEDLKQIDEHFDDHPDNDDLEYIIGDEGMQNLNNDD*
Ga0058704_1074477423300006020AgaveMTVEGAVSEDIFDYLFDVGAEKFLSEIGKKYLLELFEKWDQEHLRLDEDFDDYPDNVGLEDIIGDEGIQNFNNDD*
Ga0058704_1074541513300006020AgaveMLALIEKGKTLMHCGNTIFAYSNEFNDYMKLNGAESEVIFDYLFDIGAEKFLLEEGKKYLLELFEEYDPEHLNQINEDF
Ga0058704_1075000323300006020AgaveMHCGNTTFTYNNEFKDYMKLDGAASEDIFDYLFDIGAEKFLSKEEKKYLIELFEEHDPKLLNQINEDFDDYPDNDGLEDIIGDKGV*
Ga0058704_1075512813300006020AgaveTLSRAIGFFNIYHQCWALIERGKTLIHCGNTTFAYDNEIKDYIKVEGAESEDIFDYLFDVGAGKFLSEKEKKYLLELFEEYDSEHLNQIDEDFDNYPDNDGLKNIIGDEGI*
Ga0058704_1077764613300006020AgaveMKVEGTVSEDIFDDLFDVGAGKFLLEKREKHLLELFEKWNPEHLQLGEDFDNYPDNDNLENIIGDEGMQNLNNDDQS
Ga0058704_1077836623300006020AgaveMNCRNTTFAYSNEFNGYMKVDGAESEDIFDYLFDVGAGKYLSEEGKKYLLELFEEYDPEHLNQINEDFD
Ga0058704_1085071713300006020AgaveFFNIYHQCWVLIEKEKTLMYCGNTTFTYSNEFKDRMKVDSVESEDIFDYLFDVGVGQFLSKEGKKYLLELFEEYDPEDFNQIDEEFDDYPNNDGMKNTIGDEGMQNLNNND*
Ga0058704_1086175423300006020AgaveTTFAYSNEFNDYMKVDGAELEDIFDYLFNVGVEKFLSEEGKNYLLELFEEYDPEHLNQIDEDFDDYPDNDGLENIIGDECMQNLNNDG*
Ga0058704_1086584013300006020AgaveYMKVE*AVSEDIFDYLFYVGVEKFLSEKGKKYLLELFEEWNLEHLKQIDEDFDNYPDNDGLEDISGDKGMQNLNNDD*
Ga0058704_1087245223300006020AgaveKGDGAESEDIFDYLFDIGAGKFLSEDGKKYLLELFEEYDPKHLNQINEDFDEYPDNDDLKKIIGDEGMQNLNNDD*
Ga0058704_1087821413300006020AgaveMLGIDRKRKNVNALWKTIFACSNEFKDYMKVDGAESKDIFDYLFDGGAEKFFSEEGKKYLLELFEEYDREHLNQIDEDFDDYPDNNGLKNIIGDEGMQNLNNDH*
Ga0058704_1088781013300006020AgaveVENTTSAYSNEFNDYMKVDGTELEDIFDYLFDVGAEKFLSENRKKYLLELFEECDPEHLNQISEDFDDYLDNDGMEDIIRDEGM*
Ga0058704_1095151623300006020AgaveMHYGNTTCAYSNEFNDYMKMDDAESEDIFDYLFDIGAGKFLSEEGKKYLLKLFEEYDPEHLNQINEDFDEY
Ga0058704_1096148723300006020AgaveMHWENTTFAYDNEFKDYVKVDGVVLEGIFNYLFNVGARKFLSEKGKKYLLKLFEE*DPEHLKQIDEDFDDYLDND
Ga0058704_1098381413300006020AgaveDGAESEDIFDYLFDVGTGKFLSENEKKNLLELFEEWDPEHLKQIDEDFNDYPDNNNLKNTIGEEGMQNLNNDD*
Ga0058703_111895323300009040AgaveENTTFAYSNEFKDYIKVDRAESEDIFYYLFDVGAEKFLSEEGKKYLLELFEEYDPEHLNQINEEFDEYLNNDGLEDNWR*
Ga0182001_1016624213300014488SoilVTDPILARAIGFFNLYHKCWALIEKGKTLMHCGNATFAYSNEFNDYMKVDGAESEDIFDYLFDIGVGKFLSEERKKYLLELFEEYDPEHLNQINEDFDEYPDNNGLKNIIGDECMQNLNNDD*
Ga0209463_106728623300027628AgaveMHCGNTTFAYSNEFNDYMKVDGAESEDIFDYLFDIRAGKFLSEEGKKYLLELFEEYDPEHLNQINEDFDEYLDNDDLENIIGDEGVQNLNNDD
Ga0209461_1005248413300027750AgaveAYDVEFKDYMKIDGAMLEDILDYLFDVGAGKFLSEKGKKYLLELFEEWDPEHLKQINEDFDDYPDNDGLEDIIGEEGMQNLNNDN
Ga0209574_1013512013300027809AgaveMKVEETLSEDIFDYLFYVGVGKFLSAKGKNYLLELFEKXDLDHLKQLDEDFDDYPDNDGLEDIIEDEGM
Ga0209574_1014706613300027809AgaveMHCRNTTFAYSNEFKDYMKVDRAESEDIFDYLFDIGAEKFLSEEGRKYLNELFEECDPEHPNQINEDFDDYPDNDVWKI
Ga0209574_1016449013300027809AgaveMYYENTTFAYDNEFKEYTKVEGVVSKDIFDYLFDVGAGKFLSEKENKYLLDLFEKWDPEYLQLDEDFDNYPNNDGLKNIIED
Ga0209574_1017325633300027809AgaveMHCGNTIFAYSNEFNDYMKLNGAESEVIFDYLFDIGAEKFLLEEGKKYLLELFEEYDPEHLNQINEDFEEYLDNDSLEDIIGN
Ga0209574_1017649123300027809AgaveLIEKEKILIHCGDTTFAYSNELNDYMKVGGAESKDIFDYLFDIRAEKFLSEEGKKYLLELFEEYDLEHLNQINEDFNEYPDNDDLKNIIGDEGMQNLNDDD
Ga0209574_1019831213300027809AgaveKKTLMHCGNTIFTYDNEFKDYMKVEGAVSEDIFDYLFNVGARKSLSEKGKKYLLELFEEXDPEHLKQINEDFDDYPNNEDVENIIGDEGIQNLNNND
Ga0209574_1022511223300027809AgaveENTTFAYNSEFKDYMKVDVAKSEDTFDCLFDVGAEKFLSENRKKYLFELFEEYDPEHFNQINEDFHNYPEMTVWNI
Ga0209574_1022744213300027809AgaveLALIEKEKTLIHCGNTTFAYSNEFNDYMKVDGVESEDIFDCLFDIGVEKFLSEEGKKYLLELFEEYDPEYLNQINEDFDEYPDIDGLKDIIGDESMQNLNNND
Ga0209574_1023313013300027809AgaveMKVDEAVSEDIFDYLFNIGAEKFLSKKGKKYLLELFEEXGPEHLKQIDEDFDDYLDNDGLENIIGDGGM
Ga0209574_1031128123300027809AgaveVHIVTNPTLSRAIGFFNIYHQCWVLIERGKILMHCENTTFAYDNEFKDYMKVEGIVSEDIFDYLFDVGVSKFLSEIRKKYLLELFEEYDTEHLNQIDKDFDDYPDNDSLKNVTRDEGTQ
Ga0209574_1034831513300027809AgaveVLKDIFDYFFDVRVGKFLSEKEKKYLLELFKKCDLEHLKQLDDDLDNYPDNDGLEEIIEDEGTHNLNNND
Ga0209574_1035027513300027809AgaveYSNEFNDYMKVDGTESEDIFDYLFDVGARKYLSQERKKYLFELFEEYDPEHLNQINEDFDEYPDNDGPENIIGDEGVQNLNNDD
Ga0209574_1036498813300027809AgaveMHCGNTTFTYSKECNDYMKEEGVESEDIFDYLFDIGVRKFLSEEGKKYLFELFEEYDPEHLNEINDDFDEYPDNEGLKDIIGDEGMQNLNNDDYLVIIKISKKVVPL
Ga0209574_1036596013300027809AgaveDPALARAIGFFNIYHKCWALIEKGKTLMHYRNTTFAYSNEFNDYMKVDGAESEDIFDYFLDIRAGKFLSEEGKKYLLELFEKYDPEHLNEINDDFDEYPDNEGLEDIIGDEGMQNLNNDD
Ga0268252_115034213300030497AgaveDKYMKIDRAVSEDIYDYLFDMGAGKFLSKKEKKYLLELFEEWDPEYFKQLDEDFDEYPDNEDLADIIGDEGIQNLNNDD
Ga0268252_118720013300030497AgaveMRCENTIFVHSNVFDDYIKVDSAESEDIFDYLFDIGAGKFLSEEGKKYLLKLFEEYDPEHLNQINEDFDEYPDNDGLENIIGDEGMQNLNNDD
Ga0268252_119402213300030497AgaveMAIEFFNIYHQCWALIEKEKTLMHCGNTTFAYSNEFNDYMKVDGTESEDIFDYLFDIGAGKFLSEEGKKYLLELFEEYDPEHLNQINEDFDEYPDNDGLENIIGDEGMQNLNNDN
Ga0268244_1005005713300030501AgaveMKVEXAVSEDIFDYLFDVGVGKFLSEKGKKYLLELSEKEDPEHLQFDEDFDNYPGNDGVEDIIEDEGIQNLNNDD
Ga0268244_1007847423300030501AgaveMKVEGAVSEDVFDYLFDIGARKFLSRKEKKYLHELFEKXDPTHPQLDEDFDDYPDKDELEEIIGEEGMQNLNNDD
Ga0268244_1009216123300030501AgaveMHCGNTNFAYSNKFKDYMKVDCAESEDIFDYLFDIGVGKFLSEEEKKYLLELFEEYDPKHLNQIDKDFDDYPNNDDLKNIIGNEGMQNLNNDDWSCHL
Ga0268244_1009656113300030501AgaveMKVEGVVSEDIFNYFFDVEAETFLSEKEKKYLLELFEEWDPEHLKQFDEDSNDYPDNHGLEDIIRDEGMQNLNNDD
Ga0268244_1010013113300030501AgaveMHCENTTFSYSDGFKDYMKVDGGESKDIFDYLFDVGAEKFLSEEGKKYLLKLFEEYDQEHLNQIDEDFDDYLDNDCLKNIIRDECMQNLNNGD
Ga0268244_1011815713300030501AgaveFKDYMKVEXAVSEDIFDYLFYVGVEKFLSEKGKKYLLELFEEWNLEHLKQIDEDFDNYPDNDGLEDISGDKGMQNLNNDD
Ga0268244_1014145313300030501AgaveMHCGNTVLAYDNEFKDYMKVDGVVSGDILDYLFDVGAEKFLSKKGKKYLLELLEEWNSEHLKQLEDFDDYPEKDDLKNIIRDEGM
Ga0268244_1015189333300030501AgaveLIEKEKTLMYCRNTTFTYSSEFKYYMTVDGAESEDIFCYRFDVGAGKFLSEEGKKYLLVIFEEYDPEHLNQINEDFDDYLDNDGLEDIIRDEGMQNLNNDN
Ga0268244_1015727323300030501AgaveMHCGNTTFACDNEIKDYMKVEGAESEDIFNYLFDVGARTFLSEKGKKYLLELFEEYDSEHLNQIDEDFDNYLDNEGLKNIIGDEGMQNLNNDD
Ga0268244_1016571213300030501AgaveMHCGNTTFAYSNELNDYMKVDGAESKDIFDYLFDIGAGKFFSEEGKKYLLELFEEYDPEHLNEINEDFDEYPDNDNLEDIIGEEGMQNLYNDD
Ga0268244_1017683723300030501AgaveMHCENTTFTYDNEFKEFMKVEGAISEDIFYYLFDVGAEKFLSKKEKIYLLELFEEXDPKHLKQIDEDFDDYLDNDGLENIIGDGGM
Ga0268244_1018285723300030501AgaveMKVDGAESEDIFDYLFDIGAEKFLSEEEEKYFLELFEEYDSEHLNQINEYFDDYLDNNGLENIIGDEVMQNLNNDD
Ga0268244_1019784423300030501AgaveMHCGNTTFAYSNEFKDYMKMDGAESEDIFDYLFDVEAEKFLSENGKKYFLELFEEYDPEHLNQIDEDIDDYPGNDSVKKIIGDEEMQNLNNDD
Ga0268244_1020766813300030501AgaveMYHQFWALIEQGKILMHCRNTTFTYNNEFKDYMKMDGAVSKDIFDYVFDVRAGKFLSEKEKKYLLELFEEWDPKHLKQLDEEYDDYRDYDGLEDIIGDERIHNLNNDD
Ga0268244_1020962813300030501AgaveMKVDGAESEDIFNYLFDVGDEKFLSENRKKHLLELFEEWNPKHLNQINEDFDDYPDNDGLEDIIGDEGMQNLNNDD
Ga0268244_1021116523300030501AgaveMHYENTTFTYDSEFKDYMKVDRVESRDIFNYLFDVGAEKFLSEKGKKYLLEIFEEWDPEHLKQIDEDFDDYPDSEGLEDIFRDEGM
Ga0268244_1021743623300030501AgaveMHCGNTTFAYSNEFNDYMKMDGAESEDIFDYLFDIGAEKFLSKEGKKYLLELFEEYDPEHLNQINEDFD
Ga0268244_1022291813300030501AgaveMKMEGAESEDIFDSLFDVGVEKFLLEKYLLEFLEEYDSKHLNQIDEDFDDHPDNDGLKNIIRDKGMQNLNNDN
Ga0268244_1023911213300030501AgaveTLMHCRNTTFAYSNEFKDYMKVDGAESEDIFYYLFDVGAEKFLSEKGKKYLLELFKEWDPQHLKQIDEGSYDYLDNDGLKDIIGDKGKQNLNNDD
Ga0268244_1026775813300030501AgaveMHCGDTTFAYINEFKDYMKVDGAESEDIFAYFFDVGVEKFLSENGKNYLLELFEEYDPEHLNQINEDFDYHPDNNGLEDIIGDEGM
Ga0268244_1028215413300030501AgaveMKVEGAVSEDIFDYVFDVEAEKFLSEKGKKHLLKLFEDWDLEHLKQIDEDFDDYLDNDDLKNIIGYEGMQNLNKDDQSCHH
Ga0268244_1028991313300030501AgaveVHIVTDPALARAIGFFNIYHQCWALIEKGKTLMHCGNTTFAYSNEFNDYMKVDGAESEDIFDYLFDVGAGKFLSQEGKKYLLELFEEYDPEHLNQINEDFDEYPDNDLENIIGDEGMQNLNNDD
Ga0268244_1033073013300030501AgaveMHCGNTTFVYSNEFNDYMKVDGAESEDIFDYLFHIGAGKFLSEEGKKYLLELFEEYDPQHLNQINEDFDEYLDNDGLEDIIGDEG
Ga0268244_1033479023300030501AgaveMHCGNTTFAYSNEFKDYMKVDGAESEDIFDYLFDMGADKFLSEEGKKYLLELFEEYDPEHLNQIDEGFVDYLDNDGLENIIGDEGMQNLNNDD
Ga0268244_1033840813300030501AgaveMHCGNTTFAYSNEFNDYMKVDGAESKDIFDYLFDIRAGKFLSEEEKKYLIELFEKYDPEHLSEINEDFDKYLDNDDLEDIIGDEGMQNLYNDD
Ga0268244_1035040223300030501AgaveMKVEGAESEDIFDYLFDVGAEKFLSEKEKKYLLELFEKYNPEHLNQIDKDFDDLKNIIGDEGMQNLNNDD
Ga0268244_1039854513300030501AgaveMHCGNTTLACDNEFKYYMKVEGAVSEYIFYYLFDVGAEKFLSEKGKKYIFELFEERDPEYHKQIDEDFDDYPDNDGLEDIIGDEGIRNLNNDN
Ga0268244_1040664023300030501AgaveCWALIEKGKTLMHCGNTTFAYSNEFNDYMKVDGAESEDILDYLFDVGAEKFLSQEGKKYLIELFEKYDPEHLNQINEDFDEYPDNDGLENIIGDEGM
Ga0268244_1043509813300030501AgaveVYSNEFNDYMKVDGAESEDIFDYLFHIGARKFLSEEGKKYRIELLEEYDLEHLNQINEDFDEYPDNYSLEDIIGDEGMQNLNNDD
Ga0268244_1044547123300030501AgaveMHCENTIFTYSNEFNDYMKVDGAESKDIFDYLFDIGVGKFLSEEGKKYLLELFEEYDPEHLNQINEDFD
Ga0268244_1044988513300030501AgaveCWALIEKGKTLMHCGNTTFAYSNKFKDYMEVDGVESKNIFDYLFDVGAGKFLLEEGKKYILELFEEYDPQHLNQIDEDFDDYPDNDGLENIIGDEGIQNLNNDD
Ga0268244_1045132713300030501AgaveFNEHMKTGEASSKDVFYYLFDVGVGKFLSEKGKKYLLELFEKWDPEYLQLDEDFDNYPDTDRLEYIIGEEGMQNLNNDD
Ga0268244_1045135013300030501AgaveLMHCGNTIFSYSNEFNDYMKVDGAESEDIFDYLFDIRTEKFLSKEEKKYLLELFEEYDPERLNQINEDFDKYPDNDGLENIIEDKGM
Ga0268244_1045498823300030501AgaveVHIVTDPALVRTIRFFNIYHQCWALIEKGKTLMHCENTTFAYSNEFNDYMKVDGTESKYIFDYIFDIGAEKFLSEEGKKYLLELFEEYDPERLNQINEDFDEYPDDDHLEDIIGGKGMQNFNNDD
Ga0268244_1045652413300030501AgaveMHCGNTTFAYSNEFKDHMKVDGAESEDIFDHLFDVGVGKFLSENEKKYLLELFEEWDPEHLKQINEDFDDYLDNDGLEDIIGEKGMQNLNNDD
Ga0268244_1045683123300030501AgaveMHCGNTTFAYSNEFNDYMKVDCVESKDIFDYLFDIGAEKFLSEEGKKCLIELFEEYDPEHLNQIDEDFDDYPDNDGLENIIGNEGMQNLNNDD
Ga0268244_1045806713300030501AgaveALIEKGKTLMHCGNTTFAYSNEFNDYMKVDGAESEDIFDYLFDVGVGKFLSQEGKKYLLELFEEYDPEYLNEINEDFDEYPDNDGLEDIIGDEGMQNLYNDD
Ga0268244_1053354613300030501AgaveMHYGNTTFAYSNEFKDYMKVDGVESEDIFDYLFDVGAGKFLSENGKKYLLELFGEWDPEHLKQINEDFDDYADNDGLKNIIGDEGMPNLNNDG
Ga0268244_1053543213300030501AgaveVYDNKEYMKVEGAISENIFDYLLDVEAGKFLSEKEKKYLLELFEKWGPEHLQLGENSDDYSSNDGLKIIGDESMQNLNNDD
Ga0268244_1054189813300030501AgaveCWALIENEKTLMHCGNTTFAYSNEFNDYMKVDGAESEDIFDYLFDIGAEKFLSEEGKKYLFELFEEYDPEHLNQINEDFDEYLDNDGLEDIIGDEGI
Ga0268244_1054912713300030501AgaveMHCGNTAFAYSNEFNDYMKVDGAKSEDIFYYLFDIGAEKFLSDEGKKYLFELFDEYDPEHLNQINEDYDEYLDNDGLEDIIRDEGMQNLNNDD
Ga0268244_1055336513300030501AgaveMFENPVCLVTDPALSRAIGNFNIYHQCWALIEQEKTLMHCENTNFAYDNEFKDYMKVEGGVSKDIFDYLFDVGAEKFLSEKEKKYLLELFEEXDLEHLKQIDEDFNDYPDNDGLKNIIGD
Ga0268244_1056271023300030501AgaveYSNEFEDYIKVDGTELEDIFDYLFDVGAEKFLSENRKKYLLELFEECDPEHLNQISEDFDDYLDNDGMEDIIRDEGM
Ga0268244_1056348413300030501AgaveMKVEGAVSKDIFDYLFDIGAGKFLLEKEKKYLLELFEKXDPKHLQFVESFNDYPDNGGLKDIIGHEGMQNLNNND
Ga0268244_1056879723300030501AgaveFNDYMKVDGAESEDIFNYLFDIGVEKFLSEKEKKYLLELFEEYDPEHLNEINDDFDEYPDNEGLEDIIGDEGMQNLNNND
Ga0268244_1057562013300030501AgaveMKVDGAESEDIFDYLFDVGAGKFLSEERKKYLLELFEEYDPEHLNQINEDFDEYPDNDSLEDIIGDEGIQNLNNDDQSCHY
Ga0268244_1059111523300030501AgaveTIFAYSNEFNDYIKVDGAESKNILDYLFDIGVRKFFSEEGKKYLLELYEEYDPEHLNQINEDFDDYPDNDSLQDIIGDEGMQNLNNDD
Ga0268244_1059763113300030501AgaveFKEYMKMEGAVSEDIFNYLFDVRDEKFLSKKGKKYLLELFEKMDLEHLKQLDEDFDDYPSNDDLEDIIVEEGIQNLNNDD
Ga0268244_1060438313300030501AgaveMKVEGTVSEDIFDDLFDVGAGKFLLEKREKHLLELFEKWNPEHLQLGEDFDNYPDNDNLENIIGDEGMQNLNNDDQSC
Ga0268244_1064730123300030501AgaveMKVEGAVSEDVFDYLIDVGVGKFLSEKETKYVLELFEKXDPEHLQLDEGFNDYPDNDGLKTIIGDEGIQNLNNVD
Ga0268244_1067731713300030501AgaveDLVHIVTDPALARAIGFFNIYHQRWALIEKGKTLMRCGNTTFAYSNEFNDYMKVDGAETDDIFDYLFDVGARKFLSEEGKKYLLELFEEYDPEYLNQINEDFDEYPDNDGLEDIIGEESMQTLNNDD
Ga0268244_1069707913300030501AgaveALARVIGFFNIYYQCLALIEQEKTLTYCGNTTFAYGNEFKEYMKVEGVVSEDIFDYPFDVGVGKFLSAKAKKYLLELFEKYDPKHLKQLDEDFDNYPNNDGLEDIIRDEGMQNLNNND
Ga0268244_1070187713300030501AgaveMHCGNTTFTYSNEFNNYMKVDDAESEDIFDYLFDIGGEKFLSEEXKKYLLELFEEYNPEHLNQINEDFDEYPDNDDLKDIIGDEGMQNVNNDD
Ga0268244_1072485913300030501AgaveMHCGNTTFAYSNEFNDYMKVDDAESEDIFYYLFDIGAEKFLSKEXKKYLLELLEEHDPE
Ga0268244_1072803713300030501AgaveSNEFNDCMKVDGAELEDIFDYLFDIGAEKFLSEEGKKYLFELFEEHNPEYLNQINADFDKYPDNDGLKDIIENEGMQNLNNDD
Ga0268244_1074034523300030501AgaveMHCGNTTFAYSNEFNDHMKVDGAESEDIFDCLFDIAAEKFLSQEGKKYFLELFEEYDPEYLNQINEDFDEYLDND
Ga0268244_1075944313300030501AgaveVHIAADPALARAIGFFNIYHQCWALIEKGKTLMHGGNTTFTYSNEFNDYMKVDSAESEDIFDYLFDIGAGKFLSEEGKKYLFELFKEYDLEHLNXINENFDEYPDNDGLDDIIGDEGMQNLNNDD
Ga0268244_1076718613300030501AgaveMHCGNTTFAYSNEFNDYIKVDGVKSEDILDYLFDIGAEKFLSEEGKKYLLELFEDYDPEHLSQINEDFDDY
Ga0268244_1077510723300030501AgaveMKVDRAELEDIFDYLFDIGDGKFLSEVGKKYLLDLFEEYDSEHLNQINEDFDDYLDNDGLKNIIGDEGMQNLNNDD
Ga0268244_1077656923300030501AgaveLLMHYGNSTFAYSNEFNDYMKEDGVELEDILNYLFDIEAEKFLSEEEKKYLLELFEEYELEHLNQINEDFDDYPDNNGLKNVIGDEGMQNLSNDD
Ga0268244_1081644023300030501AgaveNVEGAESKDIFDYLFDVGARKFLSEKGKKYLLELFEEYDPEHLNQIDEDFDDYPDNDGLENIIGDEGIQNLNNDD
Ga0268244_1081980113300030501AgaveALARAIGFFNIYHKCWALIEKGKILMHCGNTTFAYSNEFNDYMKVDDAESEDIFDYLFDIGAGKFLSEEGKKYLLQLFEEYDPEHLKEINEDLNEYPDNDDLEDIIGDEGM
Ga0268244_1087248413300030501AgaveMHCGNTTFAYSNEFKEYMKVKGAVSEDIFDFRFDVGVRKFLSERGKKYLLELFEKWDPEYLQLDEDFDDYIEKDGLKNIIGDEGIQNLN
Ga0268244_1088030813300030501AgaveLIEKEKTLLHCGNTTFASSNEFNDYMKMDDAESEDIFEYLFDIGAGKFLSEEGKKYLLELFEEYDPEHLNQINEDFDEYPDNDGLKYIIGDEGMQNLNNDD
Ga0268253_1012115823300030514AgaveVHCGNTTFTYDSDFKDYMKVEGAVSEDSFDYLFDIGIGKFLLEKEKKYLIELFEEWDPEHLKELDEDFDDYPDNDGLEDIIGDEGMQNLNNNN
Ga0268253_1015885523300030514AgaveMHCENTTFAYDNEFKDYMKVEGIVSEDIFDYLFDVGVSKFLSEIRKKYLLELFEEYDTEHLNQIDKDFDDYPDNDSLKNVTRDEGTQ
Ga0268253_1016570923300030514AgaveMHCGNTSFAYSKEFNDYMKVDDAESEDIFDYLFDIGVRQFLSEEEKNYLLELFEEYDPEHLDQINEDFDDYPDNGGLKNIIGDEGMQNLNNDD
Ga0268253_1017646013300030514AgaveMHCGNTTFAYDNEFKDHMKVEVVVSEDIFDYLFEVRAEKFLSEKTKKYLLELFEEYDPEHLNQIDEEFDDYPNNDGLENIIEDEG
Ga0268253_1017678113300030514AgaveMHYGNTTFAYSNEFKDYMKVDGVESEDIFDYLFDVGVGKFLLENGKKYLLELFGEWDPEHLKQINEDFDDYADN
Ga0268253_1019787613300030514AgaveMHCGNTIFAYSNEFNDCMKVDGAESEDIFDYLFDIGTEKFLSEEGLELFEEYDPEHLNQINEDFDDYPDNDRLEDI
Ga0268253_1019966523300030514AgaveMHCGNTTFVYSNEFNDYMKVDVAESKDIFDYLFHIGARKFLSEEGKKYRIELLEEYDLEHLNQINEDFDEYPDNYSLEDIIGDEGMQNLNNDD
Ga0268253_1020393813300030514AgaveRAFGFFNIYHQCLALIEKKKTLMHCGNTTFTYSNEFNDYIKVDGAESEDIFDYLFDIGAGKFLSEEEKKYLLELFEEYDLEHLNQINEDFDEYLDNDGLQDIIGDEGM
Ga0268253_1022055313300030514AgaveMHCRNTTFAYSNEFNDYMKMDGAESEDIFDYLFDIGAEKFLSKEGKKYLLELFEEYDPEHLNQINEDFDDYPE
Ga0268253_1032984623300030514AgaveMHCGNTTFTYDDEFKEYMKVEGAISEDIFDYFFDDGAGKFLSEKEKKYLLELFKKWDPEHLQLNKDFDDYLDNNSLQNINGDEGMKNLNNDDCLVIIKTF
Ga0268253_1037430713300030514AgaveMHCGNTTFAYNNEFKDYMKVEGAELKDIFDYLFDVGAEKFLLEKGKKYLLELFEEGDPEYLKQIDEDFDDYPDNNSLEDIIGDEGMQNLNNDD
Ga0268253_1037677313300030514AgaveMHCGNTTFAYSNEFNDYMKVDGAESEDIFDHLFDIRAEKFLSEEGKKYLLELFEEYDPEHLSQINEYFHEYPDNDGLEDIIGDESMQNLNNDD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.