| Basic Information | |
|---|---|
| Family ID | F038944 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 164 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MRSRTSHAAKSGVGEHTARESESAQQCATGKSAWRAPT |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 164 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.39 % |
| % of genes from short scaffolds (< 2000 bps) | 99.39 % |
| Associated GOLD sequencing projects | 131 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.659 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (39.024 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.561 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.488 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 164 Family Scaffolds |
|---|---|---|
| PF01478 | Peptidase_A24 | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.66 % |
| All Organisms | root | All Organisms | 46.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300009582|Ga0115601_1118033 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 801 | Open in IMG/M |
| 3300010115|Ga0127495_1116645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 796 | Open in IMG/M |
| 3300011037|Ga0138588_106662 | Not Available | 669 | Open in IMG/M |
| 3300011041|Ga0138591_143248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 798 | Open in IMG/M |
| 3300011053|Ga0138531_126681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 577 | Open in IMG/M |
| 3300011061|Ga0138534_1000785 | Not Available | 791 | Open in IMG/M |
| 3300011068|Ga0138599_1120115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 622 | Open in IMG/M |
| 3300011071|Ga0138595_1085162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 678 | Open in IMG/M |
| 3300011076|Ga0138574_1019410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 622 | Open in IMG/M |
| 3300011076|Ga0138574_1117840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 620 | Open in IMG/M |
| 3300011082|Ga0138526_1214347 | Not Available | 768 | Open in IMG/M |
| 3300011085|Ga0138581_1096785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 814 | Open in IMG/M |
| 3300011089|Ga0138573_1079849 | Not Available | 675 | Open in IMG/M |
| 3300011090|Ga0138579_1036452 | Not Available | 573 | Open in IMG/M |
| 3300011109|Ga0138539_1117353 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 815 | Open in IMG/M |
| 3300011333|Ga0127502_10952628 | Not Available | 803 | Open in IMG/M |
| 3300012388|Ga0134031_1093201 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 796 | Open in IMG/M |
| 3300012391|Ga0134035_1330597 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 804 | Open in IMG/M |
| 3300012411|Ga0153880_1044294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 775 | Open in IMG/M |
| 3300012411|Ga0153880_1083090 | Not Available | 811 | Open in IMG/M |
| 3300012690|Ga0157575_163707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 809 | Open in IMG/M |
| 3300012692|Ga0157571_1092000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 823 | Open in IMG/M |
| 3300012699|Ga0157593_1078196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 827 | Open in IMG/M |
| 3300012743|Ga0157567_101528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 824 | Open in IMG/M |
| 3300012749|Ga0157566_1140695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 811 | Open in IMG/M |
| 3300012763|Ga0138289_1145177 | Not Available | 533 | Open in IMG/M |
| 3300014161|Ga0181529_10408720 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 733 | Open in IMG/M |
| 3300016680|Ga0180046_135164 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 800 | Open in IMG/M |
| 3300016687|Ga0180047_1090468 | Not Available | 807 | Open in IMG/M |
| 3300016698|Ga0181503_1009396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 765 | Open in IMG/M |
| 3300016700|Ga0181513_1302918 | Not Available | 758 | Open in IMG/M |
| 3300016702|Ga0181511_1310321 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
| 3300016705|Ga0181507_1295745 | Not Available | 805 | Open in IMG/M |
| 3300016728|Ga0181500_1392468 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 807 | Open in IMG/M |
| 3300016730|Ga0181515_1197495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 779 | Open in IMG/M |
| 3300019155|Ga0184568_102072 | Not Available | 558 | Open in IMG/M |
| 3300019155|Ga0184568_103857 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 646 | Open in IMG/M |
| 3300019155|Ga0184568_115366 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 772 | Open in IMG/M |
| 3300019157|Ga0184573_104749 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
| 3300019157|Ga0184573_109314 | Not Available | 636 | Open in IMG/M |
| 3300019158|Ga0184580_102700 | Not Available | 801 | Open in IMG/M |
| 3300019159|Ga0184574_100577 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
| 3300019162|Ga0184597_123706 | Not Available | 797 | Open in IMG/M |
| 3300019163|Ga0184581_115964 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 640 | Open in IMG/M |
| 3300019165|Ga0184589_109125 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 676 | Open in IMG/M |
| 3300019166|Ga0184595_116103 | Not Available | 575 | Open in IMG/M |
| 3300019168|Ga0184569_103580 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 815 | Open in IMG/M |
| 3300019170|Ga0184570_106133 | Not Available | 807 | Open in IMG/M |
| 3300019171|Ga0184572_111954 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 718 | Open in IMG/M |
| 3300019177|Ga0184592_110412 | Not Available | 633 | Open in IMG/M |
| 3300019180|Ga0184578_100286 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 804 | Open in IMG/M |
| 3300019181|Ga0184594_100568 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 799 | Open in IMG/M |
| 3300019182|Ga0184598_133087 | Not Available | 804 | Open in IMG/M |
| 3300019184|Ga0184590_123282 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
| 3300019185|Ga0184587_102294 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 574 | Open in IMG/M |
| 3300019186|Ga0184588_127865 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 796 | Open in IMG/M |
| 3300019240|Ga0181510_1283330 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 863 | Open in IMG/M |
| 3300019240|Ga0181510_1303783 | All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium CG06_land_8_20_14_3_00_38_11 | 1469 | Open in IMG/M |
| 3300019242|Ga0181502_1115746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 818 | Open in IMG/M |
| 3300019242|Ga0181502_1240652 | Not Available | 820 | Open in IMG/M |
| 3300019242|Ga0181502_1302934 | Not Available | 798 | Open in IMG/M |
| 3300019242|Ga0181502_1479140 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 831 | Open in IMG/M |
| 3300019251|Ga0187795_1070728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 685 | Open in IMG/M |
| 3300019251|Ga0187795_1282732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 616 | Open in IMG/M |
| 3300019251|Ga0187795_1428455 | Not Available | 525 | Open in IMG/M |
| 3300019256|Ga0181508_1040249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 811 | Open in IMG/M |
| 3300019256|Ga0181508_1090507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 761 | Open in IMG/M |
| 3300019256|Ga0181508_1239679 | Not Available | 800 | Open in IMG/M |
| 3300019256|Ga0181508_1248388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 586 | Open in IMG/M |
| 3300019258|Ga0181504_1551703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 641 | Open in IMG/M |
| 3300019260|Ga0181506_1419721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 804 | Open in IMG/M |
| 3300019265|Ga0187792_1234337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 593 | Open in IMG/M |
| 3300019284|Ga0187797_1579755 | Not Available | 789 | Open in IMG/M |
| 3300021855|Ga0213854_1112872 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 635 | Open in IMG/M |
| 3300022185|Ga0079039_1087647 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 621 | Open in IMG/M |
| 3300022499|Ga0242641_1010724 | Not Available | 815 | Open in IMG/M |
| 3300022499|Ga0242641_1021717 | Not Available | 656 | Open in IMG/M |
| 3300022500|Ga0242643_106202 | Not Available | 792 | Open in IMG/M |
| 3300022503|Ga0242650_1006138 | Not Available | 810 | Open in IMG/M |
| 3300022503|Ga0242650_1006594 | Not Available | 793 | Open in IMG/M |
| 3300022503|Ga0242650_1008303 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 736 | Open in IMG/M |
| 3300022505|Ga0242647_1011143 | Not Available | 807 | Open in IMG/M |
| 3300022506|Ga0242648_1022642 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 818 | Open in IMG/M |
| 3300022507|Ga0222729_1036749 | Not Available | 640 | Open in IMG/M |
| 3300022508|Ga0222728_1034350 | Not Available | 799 | Open in IMG/M |
| 3300022510|Ga0242652_1015186 | Not Available | 779 | Open in IMG/M |
| 3300022510|Ga0242652_1020485 | Not Available | 707 | Open in IMG/M |
| 3300022511|Ga0242651_1012129 | Not Available | 819 | Open in IMG/M |
| 3300022522|Ga0242659_1042346 | Not Available | 782 | Open in IMG/M |
| 3300022523|Ga0242663_1036372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 818 | Open in IMG/M |
| 3300022527|Ga0242664_1040457 | Not Available | 819 | Open in IMG/M |
| 3300022527|Ga0242664_1045095 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 789 | Open in IMG/M |
| 3300022527|Ga0242664_1049845 | Not Available | 762 | Open in IMG/M |
| 3300022528|Ga0242669_1031528 | Not Available | 831 | Open in IMG/M |
| 3300022528|Ga0242669_1081386 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 601 | Open in IMG/M |
| 3300022531|Ga0242660_1205206 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 544 | Open in IMG/M |
| 3300022533|Ga0242662_10100118 | Not Available | 825 | Open in IMG/M |
| 3300022533|Ga0242662_10102213 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 819 | Open in IMG/M |
| 3300022709|Ga0222756_1021449 | Not Available | 831 | Open in IMG/M |
| 3300022709|Ga0222756_1023197 | Not Available | 810 | Open in IMG/M |
| 3300022713|Ga0242677_1021184 | Not Available | 805 | Open in IMG/M |
| 3300022715|Ga0242678_1012933 | Not Available | 922 | Open in IMG/M |
| 3300022715|Ga0242678_1020554 | Not Available | 800 | Open in IMG/M |
| 3300022716|Ga0242673_1032787 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
| 3300022717|Ga0242661_1047093 | Not Available | 795 | Open in IMG/M |
| 3300022720|Ga0242672_1031456 | Not Available | 806 | Open in IMG/M |
| 3300022721|Ga0242666_1047738 | Not Available | 895 | Open in IMG/M |
| 3300022724|Ga0242665_10066303 | Not Available | 1000 | Open in IMG/M |
| 3300023537|Ga0247541_100561 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 920 | Open in IMG/M |
| 3300023552|Ga0247551_101403 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 810 | Open in IMG/M |
| 3300023558|Ga0247526_110283 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
| 3300023564|Ga0247515_113737 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 802 | Open in IMG/M |
| 3300023675|Ga0247533_101792 | Not Available | 802 | Open in IMG/M |
| 3300023688|Ga0247522_111841 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 760 | Open in IMG/M |
| 3300023689|Ga0247517_111284 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 828 | Open in IMG/M |
| 3300029992|Ga0302276_10444580 | Not Available | 524 | Open in IMG/M |
| 3300030528|Ga0210277_10897206 | Not Available | 579 | Open in IMG/M |
| 3300030548|Ga0210252_10026747 | Not Available | 816 | Open in IMG/M |
| 3300030549|Ga0210257_10477116 | Not Available | 532 | Open in IMG/M |
| 3300030630|Ga0210282_10021318 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 1093 | Open in IMG/M |
| 3300030646|Ga0302316_10227364 | Not Available | 762 | Open in IMG/M |
| 3300030743|Ga0265461_10993500 | Not Available | 828 | Open in IMG/M |
| 3300030761|Ga0265722_101650 | Not Available | 798 | Open in IMG/M |
| 3300030761|Ga0265722_101731 | Not Available | 786 | Open in IMG/M |
| 3300030762|Ga0265775_108168 | Not Available | 634 | Open in IMG/M |
| 3300030806|Ga0265731_101105 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 807 | Open in IMG/M |
| 3300030806|Ga0265731_101132 | Not Available | 801 | Open in IMG/M |
| 3300030811|Ga0265735_101953 | Not Available | 807 | Open in IMG/M |
| 3300030812|Ga0265734_101611 | Not Available | 830 | Open in IMG/M |
| 3300030812|Ga0265734_101851 | Not Available | 800 | Open in IMG/M |
| 3300030816|Ga0265729_103635 | Not Available | 565 | Open in IMG/M |
| 3300030824|Ga0265726_101502 | Not Available | 823 | Open in IMG/M |
| 3300030824|Ga0265726_107255 | Not Available | 503 | Open in IMG/M |
| 3300030832|Ga0265752_102123 | Not Available | 814 | Open in IMG/M |
| 3300030834|Ga0265738_101622 | Not Available | 818 | Open in IMG/M |
| 3300030834|Ga0265738_102435 | Not Available | 718 | Open in IMG/M |
| 3300030876|Ga0265730_101075 | Not Available | 801 | Open in IMG/M |
| 3300030887|Ga0265733_102171 | Not Available | 684 | Open in IMG/M |
| 3300030889|Ga0265761_104499 | Not Available | 710 | Open in IMG/M |
| 3300030913|Ga0265759_102659 | Not Available | 805 | Open in IMG/M |
| 3300030941|Ga0265737_103545 | Not Available | 810 | Open in IMG/M |
| 3300030977|Ga0265721_1004897 | Not Available | 682 | Open in IMG/M |
| 3300031010|Ga0265771_1010043 | Not Available | 689 | Open in IMG/M |
| 3300031011|Ga0265774_104402 | Not Available | 586 | Open in IMG/M |
| 3300031042|Ga0265749_101048 | Not Available | 810 | Open in IMG/M |
| 3300031042|Ga0265749_103913 | Not Available | 554 | Open in IMG/M |
| 3300031057|Ga0170834_111255415 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 713 | Open in IMG/M |
| 3300031090|Ga0265760_10134072 | Not Available | 803 | Open in IMG/M |
| 3300031231|Ga0170824_124752158 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 841 | Open in IMG/M |
| 3300031469|Ga0170819_11234438 | Not Available | 736 | Open in IMG/M |
| 3300031590|Ga0307483_1010343 | Not Available | 812 | Open in IMG/M |
| 3300031667|Ga0310111_137400 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 549 | Open in IMG/M |
| 3300031677|Ga0307480_1005246 | Not Available | 801 | Open in IMG/M |
| 3300031678|Ga0310114_112854 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 800 | Open in IMG/M |
| 3300031808|Ga0316037_105480 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
| 3300031815|Ga0316045_115171 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
| 3300031828|Ga0316043_118697 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
| 3300031866|Ga0316049_118180 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 557 | Open in IMG/M |
| 3300031891|Ga0316039_104844 | Not Available | 827 | Open in IMG/M |
| 3300031891|Ga0316039_105346 | Not Available | 800 | Open in IMG/M |
| 3300032027|Ga0247536_104291 | Not Available | 618 | Open in IMG/M |
| 3300032072|Ga0326631_101617 | Not Available | 1097 | Open in IMG/M |
| 3300032072|Ga0326631_104312 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 39.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.17% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 10.98% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.27% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 3.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.22% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.22% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.61% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.61% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.61% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.61% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.61% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.61% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.61% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300009582 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010115 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011037 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 80 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011041 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 17 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011053 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 9 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011061 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 12 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011068 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011071 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011076 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011082 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011085 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011089 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011109 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 18 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012388 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012411 | Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012690 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES078 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012692 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES073 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012699 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES110 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012743 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES067 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012749 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES066 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012763 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300016680 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES103 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016687 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES104 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016698 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016700 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016705 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016728 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019155 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019157 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019158 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019159 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019162 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019163 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019165 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSA1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019166 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019168 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019170 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019171 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019177 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZI1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019180 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019181 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZI3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019184 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSA2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019185 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019186 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019242 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019251 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019256 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019265 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021286 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022185 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022500 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022503 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022505 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022511 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023537 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023552 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023558 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023564 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023675 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023688 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023689 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029992 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300030528 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030548 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030549 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030630 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO115SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030761 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030806 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030811 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030812 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030816 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030824 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030832 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030834 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030876 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030887 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030913 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030941 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030977 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031011 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031042 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031677 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031678 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031808 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031815 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031828 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031866 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031891 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032027 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032072 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0115601_11180332 | 3300009582 | Wetland | MRPIPLLAAVSSVGEHTAREQRESAQCVRTGKSAWRAPT |
| Ga0127495_11166451 | 3300010115 | Grasslands Soil | MRPRAAHAALSGVGEHTARESERAQCVPMGKSAWR |
| Ga0138588_1066621 | 3300011037 | Peatlands Soil | MRSKSSHAAGSSVGEHTARESESAQQCATGKSAWRAPTPNF |
| Ga0138591_1432481 | 3300011041 | Peatlands Soil | MRSKSSHAAGSSVGEHTARESESAQQCATGKSAWR |
| Ga0138531_1266811 | 3300011053 | Peatlands Soil | MRSKSSHAAGSSVGEHTARESESAQQCATGKSAWRAP |
| Ga0138534_10007851 | 3300011061 | Peatlands Soil | MRSRTSLAAESGVGEHMARESESAQRCAMGKSVWRA |
| Ga0138599_11201151 | 3300011068 | Peatlands Soil | MRSKSSHAAGSSVGEHTARESESAQQCATGKSAWRAPTP |
| Ga0138595_10851621 | 3300011071 | Peatlands Soil | MRSRTSLAAESGVGEHMARESESAQLCATGKSAWRTPT |
| Ga0138574_10194101 | 3300011076 | Peatlands Soil | MRSKTSHAAGSSVGEHTARESESAQQCATGKSAWRAPTP |
| Ga0138574_11178401 | 3300011076 | Peatlands Soil | MRSKSSHAAGSSVGEHTARESESAQQCATGKSAWRAPT |
| Ga0138526_12143471 | 3300011082 | Peatlands Soil | MRSRTSLAAESGVGEHMARESESAQRCAMGKSVWRAPT |
| Ga0138581_10967851 | 3300011085 | Peatlands Soil | MRSRTSHAAESSVGEHTARESESAQQCATGKSAWRAPTP |
| Ga0138573_10798491 | 3300011089 | Peatlands Soil | MRSRTSHAAKSGVGEHTARESESAQQCATGKSAWRAPT |
| Ga0138579_10364521 | 3300011090 | Peatlands Soil | MRSRTSLAAESGVGEHMARESESAQRCATGKSAWRAP |
| Ga0138539_11173531 | 3300011109 | Peatlands Soil | MRSRTSLAAESGVGEHMARESESAQRCAMGKSAWRTPTP |
| Ga0127502_109526281 | 3300011333 | Soil | MRPRHPLAAESGVGEHTARESEGAKQCATGRSARRT |
| Ga0134031_10932011 | 3300012388 | Grasslands Soil | MRSTASLAAKSGVGEHTARESEAPNSVPPGKSAWRT |
| Ga0134035_13305971 | 3300012391 | Grasslands Soil | MRPKSAHAALSGVGEHTARESERAQCVPTGKSAWRAPT |
| Ga0153880_10442941 | 3300012411 | Freshwater Sediment | MRSITSHAAKSGVGEHKARESESAQRCATGKSAWRAPT |
| Ga0153880_10830901 | 3300012411 | Freshwater Sediment | MRSRTSHAAKSGVGEHRARESESAQHCAQGKSAWRAPTP |
| Ga0157575_1637071 | 3300012690 | Freshwater | MRSRTSHAAKSGVGEHRARESESAQRCATGKSAWRAPT |
| Ga0157571_10920001 | 3300012692 | Freshwater | MRSRTSHAAKSGVGEHRARESESAQRCATGKSAWRAPTPKFGP |
| Ga0157593_10781961 | 3300012699 | Freshwater | MRSRTSHAAKSGVGEHRARESESAQRCATGKSAWRAPTPKFGPG |
| Ga0157567_1015281 | 3300012743 | Freshwater | MRSRTSHAAKSGVGEHRARESESAQHCAQGKSAWRAPTPKFGPG |
| Ga0157566_11406951 | 3300012749 | Freshwater | MRSRTSHAAKSGVGEHRARESESAQRCATGKSAWRAPTP |
| Ga0138289_11451772 | 3300012763 | Freshwater Lake | MRLKPSHAAKSGVGEHTARESESAQCVRKGKSAWRAPTP |
| Ga0181529_104087201 | 3300014161 | Bog | MRSRSSHAAKSGVGEHMARESESAQRCATGKSAWRAPTPKFGPGTA |
| Ga0180046_1351641 | 3300016680 | Freshwater | MRSRTSHAAKSGVGEHRARESESAQRCATGKSAWR |
| Ga0180047_10904681 | 3300016687 | Freshwater | MRSKTSHAAKSGVGEHTARESDSAQCVPMGKSAWRAPTP |
| Ga0181503_10093961 | 3300016698 | Peatland | MRSRTSHAAKSGVGEHTARESESAQCVPMGKSAWRAP |
| Ga0181513_13029181 | 3300016700 | Peatland | MRSKTSHAAKSGVGEYTARESETAQCVPMGKIAWRA |
| Ga0181511_13103211 | 3300016702 | Peatland | MRSRPSHAAKSGVGEHTARESESAKQYATGKSVWRAP |
| Ga0181507_12957451 | 3300016705 | Peatland | MRSKTSHAAESSVGEHTARESESAQQCAPGKSAWRAP |
| Ga0181500_13924681 | 3300016728 | Peatland | MRSKTSHAAESSVGEHTARESESAQRCATGKSAWRA |
| Ga0181515_11974952 | 3300016730 | Peatland | MRSTTSLAAESGVGEHMARESERAQRCAMGKSAWR |
| Ga0184568_1020721 | 3300019155 | Soil | MRSRSSHAAKSGVGEHRARESESAQRCAKGKSAWRAPTP |
| Ga0184568_1038571 | 3300019155 | Soil | MRSRTSHAAKSGVGEHRARESESAQRCAKGKSAWRAPT |
| Ga0184568_1153661 | 3300019155 | Soil | MRSRTSHAARSGVGEHRARESESAQHCAQGKSAWRAP |
| Ga0184573_1047491 | 3300019157 | Soil | MRSRPSHAAKSGVGEHTARESESAQQYAPGKSVWRAP |
| Ga0184573_1093141 | 3300019157 | Soil | MRSRSSHAAKSGVGEHRARESESAQRCAKGKSAWRAPT |
| Ga0184580_1027001 | 3300019158 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTP |
| Ga0184574_1005771 | 3300019159 | Soil | MRSRTSHAAKSGVGEHRARESESAQRCAKGKSAWRAPTP |
| Ga0184597_1237062 | 3300019162 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPMGKSAWRA |
| Ga0184581_1159641 | 3300019163 | Soil | MRSRTSHAAKSGVGEHRARESESAQRCAKGKSAWRA |
| Ga0184589_1091251 | 3300019165 | Soil | MRSISSHAARSGVGEHRARESESAQRCAKGKSAWRAPT |
| Ga0184595_1161031 | 3300019166 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPMGKSAWRAP |
| Ga0184569_1035801 | 3300019168 | Soil | MRSRPSHAAKSGVGEHTARESESAQQYAPGKSVWRAPTP |
| Ga0184570_1061331 | 3300019170 | Soil | MRSITSHAAESSVGKHTARESESAQCCVTGKSAWRAPT |
| Ga0184572_1119541 | 3300019171 | Soil | MRSRTSHAAKSGVGEHRARESESAQRCAKGKSAWR |
| Ga0184592_1104121 | 3300019177 | Soil | MRSRSSHAAKSGVGEHRARESESAQRCAKGKSAWRAP |
| Ga0184578_1002861 | 3300019180 | Soil | MRSRTSHAAKSGVGEHRARESESAQRCAKGKSAWRAP |
| Ga0184594_1005681 | 3300019181 | Soil | MRSTTSHAAKSGVGEHTARESESAQQYAPGKSVWRAP |
| Ga0184598_1330872 | 3300019182 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPT |
| Ga0184590_1232821 | 3300019184 | Soil | MRSISSHAARSGVGEHRARESESAQRCAKGKSAWRAPTP |
| Ga0184587_1022941 | 3300019185 | Soil | MRSRTSHAAKSGVGEHTARESESAQCVRPGKSAWRAP |
| Ga0184588_1278651 | 3300019186 | Soil | MRSISSHAARSGVGEHRARESESAQRCAKGKSAWR |
| Ga0181510_12833302 | 3300019240 | Peatland | MRSRTSHAAKSGVGEHRARESESAQHCAKGKSAWRAP |
| Ga0181510_13037833 | 3300019240 | Peatland | MRSTTSHAARSGVGEHTARESEGAKRCATGKSAWRAPTP |
| Ga0181502_11157461 | 3300019242 | Peatland | MRSKTSHAAESSVGEHTARESESAQRCAKGKSAWRAPTP |
| Ga0181502_12406521 | 3300019242 | Peatland | MRSKTSHAAKSGVGEHTARESESAQRVPMGKSAWRAPTPKNKSPNCK |
| Ga0181502_13029342 | 3300019242 | Peatland | MRSRTSHAAKSGVGEHRARESESAQRFATGKSAWR |
| Ga0181502_14791402 | 3300019242 | Peatland | MRSRSSHAAKSGVGEHMARESESAQRCATGKSAWRAPTPKFGP |
| Ga0187795_10707281 | 3300019251 | Peatland | MRSTTSLAAESGVGEHMARESESAQQCATGKSAWRTPT |
| Ga0187795_12827321 | 3300019251 | Peatland | MRSITSHAAKSGVGEHMARESESAKRCAMGKSAWRTPTP |
| Ga0187795_14284551 | 3300019251 | Peatland | MRSTTSLAAKSGVGEHMARESESAQRCAKGKSAWRTPTPKFGPG |
| Ga0181508_10402491 | 3300019256 | Peatland | MRSKTSHAAESSVGEHTARESESAQRCAKGKSAWRAPTPNL |
| Ga0181508_10905071 | 3300019256 | Peatland | MRSRTSLAAESGVGEHMARESERAQRCAMGKSAWRTP |
| Ga0181508_12396792 | 3300019256 | Peatland | MRSKTSHAAKSGVGEHTARESESAQRMPQGKSAWRAP |
| Ga0181508_12483881 | 3300019256 | Peatland | MRSTTSHAAESGVGEHTARESESAQCVPMGKSAWRAPT |
| Ga0181504_15517031 | 3300019258 | Peatland | MRSRTSLAAESGVGEHMARESERAQRCAMGKSAWRT |
| Ga0181506_14197212 | 3300019260 | Peatland | MRSRTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPT |
| Ga0187792_12343371 | 3300019265 | Peatland | MRSTTSLAAKSGVGEHMARESESAKRCAMGKSAWRTPT |
| Ga0187797_15797551 | 3300019284 | Peatland | MRSTSSPAAESGVGEHTARESECAQCMRPGKSVWRAPTPKCLA |
| Ga0179583_10428271 | 3300021286 | Vadose Zone Soil | MRSKSSPAARSSVGEFAARESESAQRKHPGKRAWRTPTPNSA |
| Ga0213854_11128721 | 3300021855 | Watersheds | MRSRTSHAAKSGVGEHRARESESAQRCAKGKSAWRAPP |
| Ga0079039_10876471 | 3300022185 | Freshwater Wetlands | MRPIPLLAAVSSVGEHTAREQRESAQCVRTGKSAWRAPTPEFGP |
| Ga0242641_10107241 | 3300022499 | Soil | MRSRTSHAAESSVGEQTARESESAQQFAPGKSVWRAPTP |
| Ga0242641_10217171 | 3300022499 | Soil | MRSKTSHAAKSGVGEHTARESESAQQCVPGKSAWRAPTP |
| Ga0242643_1062022 | 3300022500 | Soil | MRSKTSHAAKSGVGEHTARESESAQRMPQGKSAWRA |
| Ga0242650_10061381 | 3300022503 | Soil | MRSRTSHAAESGVGEHTARESESAQQCVPGKSAWRAPT |
| Ga0242650_10065942 | 3300022503 | Soil | MRSKTSHAAKSGVGEHTARESESAQRMPQGKSVWRT |
| Ga0242650_10083031 | 3300022503 | Soil | MRSRSSHAAKSGVGEHRARESESAQRCAKGKSAWRA |
| Ga0242647_10111431 | 3300022505 | Soil | MRSRTSHAAESSVGEQTARESESAQQFAPGKSVWRAPT |
| Ga0242648_10226421 | 3300022506 | Soil | MRSRTSHAAKSGVGERRARESESAQRCAKGKSAWRA |
| Ga0222729_10367491 | 3300022507 | Soil | MRSKTSHAAKSGVGEHTARESESAQRMPQGKSVWRTP |
| Ga0222728_10343502 | 3300022508 | Soil | MRSKTSHAAKSGVGEHTARESESAQQCVPGKSAWRAP |
| Ga0242652_10151862 | 3300022510 | Soil | MRSKTSHAAKSGVGEHTARESESAQQCVPGKSAWRAPTPNFG |
| Ga0242652_10204851 | 3300022510 | Soil | MRSKTSHAAKSGVGEHTARESESAQRMPQGKSVWR |
| Ga0242651_10121291 | 3300022511 | Soil | MRSKTSHAAKSGVGEHTARESESAQRMPQGKSAWRAPTPILTP |
| Ga0242659_10423461 | 3300022522 | Soil | MRSRTSHAAKSGVGEHTARESESAQQCVPGKSAWRAPT |
| Ga0242663_10363721 | 3300022523 | Soil | MRPRAAHAALSGVGEYTARESERAQCMPMGKSVWRAPTPKFG |
| Ga0242664_10404572 | 3300022527 | Soil | MRSKTSHAAKSGVGEHTARESESAQRMPQGKSVWRTPTPILTP |
| Ga0242664_10450951 | 3300022527 | Soil | MRSRSSHAAESGVGEHRARESESAQRCAKGKSAWR |
| Ga0242664_10498451 | 3300022527 | Soil | MRSRTSHAAKSGVGEHTARESESAQCVPNGKSAWRAPTP |
| Ga0242669_10315281 | 3300022528 | Soil | MRSKTSHAAKSGVGEHTARESESAQRMPQGKSVWRTPTPI |
| Ga0242669_10813861 | 3300022528 | Soil | MRSRSSHAAKSGVGEHTVRESESAQRCAKGKSAWRAPT |
| Ga0242660_12052061 | 3300022531 | Soil | MRSRSSHAAESGVGEHRARESESAQRCAKGKSAWRAP |
| Ga0242662_101001182 | 3300022533 | Soil | MRSKTSHAAKSGVGEHTARESESAQQCVPGKSAWRAPTPNFGP |
| Ga0242662_101022131 | 3300022533 | Soil | MRSKSSHAAKSGVGEPVARESECAQYRREGKSAWRAPTPNLAP |
| Ga0222756_10214492 | 3300022709 | Soil | MRSKTSHAAKSGVGEHTARESESAQRMPQGKSVWRTPTP |
| Ga0222756_10231972 | 3300022709 | Soil | MRSRTSHAAKSGVGEHTARESESAQCVPKGKSAWRAPTP |
| Ga0242677_10211841 | 3300022713 | Soil | MRSRTSHAAKSGVGEHTARESESAQQCVPGKSACRAP |
| Ga0242678_10129332 | 3300022715 | Soil | MRSRTSHAAKSGVGEHTARESESAQQCVPGKSAWRAP |
| Ga0242678_10205541 | 3300022715 | Soil | MRSRTSHAAKSGVGEHTARESESAQCVPKGKSAWRAP |
| Ga0242673_10327871 | 3300022716 | Soil | MRTRTAHAEKSGVGEHMARESESAQHCAKGKSAWRAP |
| Ga0242661_10470932 | 3300022717 | Soil | MRSKTSHAAKSGVGEHTARESESAQRMPQGKSAWRAPT |
| Ga0242672_10314561 | 3300022720 | Soil | MRPETTHAALSGVGEQTARESESAQQFAPGKSVWRAP |
| Ga0242666_10477381 | 3300022721 | Soil | MRARTSHAAESSVGEQTARESESAQQFAPGKSVWRAPTP |
| Ga0242665_100663031 | 3300022724 | Soil | MRSTTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPT |
| Ga0247541_1005611 | 3300023537 | Soil | MRSISSHAARSGVGEHRARESESAQRCAKGKSAWRAP |
| Ga0247551_1014031 | 3300023552 | Soil | MRSRPSHAAKSCVGEHTARESESAQRYAPGKSVWRAP |
| Ga0247526_1102832 | 3300023558 | Soil | MRSRPSHAAKSGVGEHTARESESAQRYAPGKSVWRAP |
| Ga0247515_1137371 | 3300023564 | Soil | MRSRTSHAANSGVGEHRARESESAQRCAKGKSAWRA |
| Ga0247533_1017921 | 3300023675 | Soil | MRSRSSHAAKSGVGEHRARESESAQHCAKGKSAWRAP |
| Ga0247522_1118411 | 3300023688 | Soil | MRSKTSHAAKSGVGEHKARESESAQCVPMGKSAWRAPTP |
| Ga0247517_1112841 | 3300023689 | Soil | MRSRPSHAAKSGVGEHTARESESAQQYAPGKSVWRAPTPPAMRS |
| Ga0302276_104445801 | 3300029992 | Bog | MRSRTSHAAESGVGEHTARESESAKRCATGKSAWRAPTPKFGLGAA |
| Ga0210277_108972061 | 3300030528 | Soil | MRSRTSHAAKSGVGEHRARESESAQRCAKGKSAWRAPTPK |
| Ga0210252_100267471 | 3300030548 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTPE |
| Ga0210257_104771161 | 3300030549 | Soil | MRSTTSHAARSGVGEHTARESEGAKRCATGKSAWRAPTPK |
| Ga0210282_100213182 | 3300030630 | Soil | MRSRTSHAAESGVGEHTARESESAQRCATGKSAWRAPTPKREQ |
| Ga0302316_102273641 | 3300030646 | Palsa | MRSKTSHAAKSGVGEHTARESESAQRMPQGKSAWRAPTPI |
| Ga0265461_109935001 | 3300030743 | Soil | MRLITSHAARSGVGEHTARESEGAKRCATGKSAWRAPTPKFGPGT |
| Ga0265722_1016501 | 3300030761 | Soil | MRSITSHAAESSVGKHTARESESAQCCVTGKSAWR |
| Ga0265722_1017311 | 3300030761 | Soil | MRSKTSHAAKSGVGEHTARESESAQRMPLGKSAWRAPTPILTP |
| Ga0265775_1081681 | 3300030762 | Soil | MRSRTSHAAKSGVGEHRARESESAQHCAKGKSAWRAPT |
| Ga0265731_1011051 | 3300030806 | Soil | MRSRPSHAAKSGVGEHTARESESAQQYAPGKSVWRAPT |
| Ga0265731_1011322 | 3300030806 | Soil | MRSITSHAAESSVGKHTARESESAQCCVTGKSAWRAP |
| Ga0265735_1019531 | 3300030811 | Soil | MRSKTSHAAKSGVGEHTARESESAQRMPQGKSAWRAPTP |
| Ga0265734_1016112 | 3300030812 | Soil | MRSITSHAAESSVGKHTARESESAQCCVTGKSAWRAPTPKLMPR |
| Ga0265734_1018511 | 3300030812 | Soil | MRSRTSHAAKSGVGEHRARESESAQRCAQGKSAWR |
| Ga0265729_1036351 | 3300030816 | Soil | MRSRTSHAAKSGVGEHKARESESAQCVPMGKSAWRAPT |
| Ga0265726_1015022 | 3300030824 | Soil | MRSITSHAAESSVGKHTARESESAQCCVTGKSAWRAPTPKLMP |
| Ga0265726_1072551 | 3300030824 | Soil | MRSITWHAARSSVGEHTARESESAQCCVTGKSAWRAPT |
| Ga0265752_1021232 | 3300030832 | Soil | MRSITSHAAESSVGKHTARESESAQCCVTGKSAWRAPTP |
| Ga0265738_1016221 | 3300030834 | Soil | MRSITSHAAESSVGKHTARESESAQCCVTGKSAWRAPTPK |
| Ga0265738_1024351 | 3300030834 | Soil | MRSKTSHAAKSGVGEDTARESESAQCVPSGKSAWRAPTP |
| Ga0265730_1010751 | 3300030876 | Soil | MRSITSHAAESSVGKHTARESESAQCCVTGKSAWRA |
| Ga0265733_1021711 | 3300030887 | Soil | MRSRTSHAAKSGVGEHKARESESAQRCAKGKSAWRA |
| Ga0265761_1044991 | 3300030889 | Soil | MRSKTSHAAKSGVGEHTARESESAQRMPQGKSAWRAPS |
| Ga0265759_1026591 | 3300030913 | Soil | MRSTTSHAARSGVGEHTARESEGAKRCATGKSAWRA |
| Ga0265737_1035451 | 3300030941 | Soil | MRSRTSHAAKSGVGEHRARESESAQRCAQGKSAWRAPTP |
| Ga0265721_10048971 | 3300030977 | Soil | MRSITWHAARSSVGEHTARESESAQCCVTGKSAWRAP |
| Ga0265771_10100431 | 3300031010 | Soil | MRSKTSHAAKSGVGEHTARESESAQRMPQGKSAWRAPSP |
| Ga0265774_1044021 | 3300031011 | Soil | MRSRTSHAAKSGVGEHTARESESAQCVPMGKSAWREPTP |
| Ga0265749_1010482 | 3300031042 | Soil | MRSTTSHAARSGVGEHTARESEGAKRCATGKSAWRAP |
| Ga0265749_1039131 | 3300031042 | Soil | MRSRTSHAAKSGVGEHRARESESAQRCAKGKSAWRAPTPKF |
| Ga0170834_1112554151 | 3300031057 | Forest Soil | MRSRSSHAAKSGVGEHRARESESAQRCAKGKSAWRAPTPKFGPG |
| Ga0265760_101340722 | 3300031090 | Soil | MRSKTSHAAKRGVGEHTARESESAQCVPMGKSAWRAP |
| Ga0170824_1247521581 | 3300031231 | Forest Soil | MRSIPSHAAKSGVGEHTARESESAQRMPQGKSAWRAPTPIENTGQKNGK |
| Ga0170819_112344381 | 3300031469 | Forest Soil | MRSKTSHAAKSGVGEHTARESESAQRMPQGKSEWRAPT |
| Ga0307483_10103432 | 3300031590 | Hardwood Forest Soil | MRSRTSHAAESGVGEHTARESESAQQCVPGKSAWRAPTP |
| Ga0310111_1374001 | 3300031667 | Soil | MRSRTSHAAKSGVGEHRARESESAQHCAKGKSAWRAPTP |
| Ga0307480_10052461 | 3300031677 | Hardwood Forest Soil | MRLKTSLAAKSGVGEFAARESESAQRKRLGKRAWRTPTPTLAR |
| Ga0310114_1128541 | 3300031678 | Soil | MRSRTSHAAKSGVGEHTARESESAQCVPMGKSAWR |
| Ga0316037_1054801 | 3300031808 | Soil | MRSRPSHAAKSGVGEHTARESESAQQYAPGKSVWRA |
| Ga0316045_1151711 | 3300031815 | Soil | MRSISSHAARSGVGEHRARESESAQRCAKGKSAWRA |
| Ga0316043_1186971 | 3300031828 | Soil | MRSRPSHAAKSGVGEHTARESESAQQYAPGKSVWR |
| Ga0316049_1181801 | 3300031866 | Soil | MRSRTSHAAKSGVGEHKARESESAQHCATGKSAWRAP |
| Ga0316039_1048441 | 3300031891 | Soil | MRSRSSHAAKSGVGEHRARESESAQRCAKGKSAWRAPTPKFGP |
| Ga0316039_1053461 | 3300031891 | Soil | MRSRTSHAAKSGVGEHRARESESAQRCAQGKSAWRAPT |
| Ga0247536_1042911 | 3300032027 | Soil | MRSKTSHAAKSGVGEHTARESESAQCVPMGKSAWRAPTPEFGPGT |
| Ga0326631_1016171 | 3300032072 | Soil | MRSRPSHAAKSGVGEHTARESESAQQYAPGKSVWRAPTPKFG |
| Ga0326631_1043121 | 3300032072 | Soil | MRSRTSHAAKSGVGEHKARESESAQHCATGKSAWRAPT |
| ⦗Top⦘ |