NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F038735

Metagenome / Metatranscriptome Family F038735

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F038735
Family Type Metagenome / Metatranscriptome
Number of Sequences 165
Average Sequence Length 36 residues
Representative Sequence MKWFINSMLGYWILLLAISLGAAAVIYEIWLKGRV
Number of Associated Samples 95
Number of Associated Scaffolds 165

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 94.44 %
% of genes near scaffold ends (potentially truncated) 5.45 %
% of genes from short scaffolds (< 2000 bps) 73.94 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.970 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(18.182 % of family members)
Environment Ontology (ENVO) Unclassified
(30.909 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(32.727 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.38%    β-sheet: 0.00%    Coil/Unstructured: 47.62%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 165 Family Scaffolds
PF01925TauE 40.00
PF01326PPDK_N 3.03
PF00072Response_reg 2.42
PF07396Porin_O_P 1.21
PF00939Na_sulph_symp 0.61
PF13662Toprim_4 0.61
PF01455HupF_HypC 0.61
PF05016ParE_toxin 0.61
PF02954HTH_8 0.61
PF02769AIRS_C 0.61
PF10082BBP2_2 0.61
PF02518HATPase_c 0.61
PF00512HisKA 0.61
PF01075Glyco_transf_9 0.61

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 165 Family Scaffolds
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 40.00
COG0574Phosphoenolpyruvate synthase/pyruvate phosphate dikinaseCarbohydrate transport and metabolism [G] 3.03
COG3746Phosphate-selective porinInorganic ion transport and metabolism [P] 1.21
COG0298Hydrogenase maturation factor HybG, HypC/HupF familyPosttranslational modification, protein turnover, chaperones [O] 0.61
COG0471Di- and tricarboxylate antiporterCarbohydrate transport and metabolism [G] 0.61
COG0859ADP-heptose:LPS heptosyltransferaseCell wall/membrane/envelope biogenesis [M] 0.61
COG1055Na+/H+ antiporter NhaD or related arsenite permeaseInorganic ion transport and metabolism [P] 0.61

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.97 %
UnclassifiedrootN/A3.03 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000231|TB_LI09_4DRAFT_10107490All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300000231|TB_LI09_4DRAFT_10229339All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300001213|JGIcombinedJ13530_100224566All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2637Open in IMG/M
3300001213|JGIcombinedJ13530_102487805All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300001213|JGIcombinedJ13530_105137602All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300001213|JGIcombinedJ13530_105285483All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300001213|JGIcombinedJ13530_105468564All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300001213|JGIcombinedJ13530_106147778All Organisms → cellular organisms → Bacteria2226Open in IMG/M
3300001213|JGIcombinedJ13530_106188320All Organisms → cellular organisms → Bacteria1409Open in IMG/M
3300001213|JGIcombinedJ13530_106841574All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300001213|JGIcombinedJ13530_106942146All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300001213|JGIcombinedJ13530_108149998All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300002492|JGI24188J35168_1004569All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans6462Open in IMG/M
3300003432|JGI20214J51088_10170885All Organisms → cellular organisms → Bacteria1532Open in IMG/M
3300003859|Ga0031653_10060809All Organisms → cellular organisms → Bacteria → Proteobacteria1008Open in IMG/M
3300004155|Ga0066600_10118101All Organisms → cellular organisms → Bacteria → Proteobacteria1060Open in IMG/M
3300005839|Ga0068707_1005362All Organisms → cellular organisms → Bacteria8734Open in IMG/M
3300006224|Ga0079037_100199685All Organisms → cellular organisms → Bacteria1794Open in IMG/M
3300006224|Ga0079037_100221036All Organisms → cellular organisms → Bacteria1714Open in IMG/M
3300006224|Ga0079037_100266824All Organisms → cellular organisms → Bacteria1573Open in IMG/M
3300006224|Ga0079037_100288770All Organisms → cellular organisms → Bacteria1516Open in IMG/M
3300006224|Ga0079037_100688527All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300006930|Ga0079303_10243308All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300006945|Ga0073933_1076089All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300007351|Ga0104751_1002875All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria25535Open in IMG/M
3300009009|Ga0105105_10025818All Organisms → cellular organisms → Bacteria2505Open in IMG/M
3300009037|Ga0105093_10503336All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300009053|Ga0105095_10383640All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300009081|Ga0105098_10458020All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300009082|Ga0105099_10360460All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300009085|Ga0105103_10287393All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300009091|Ga0102851_10586483All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300009091|Ga0102851_11025572All Organisms → cellular organisms → Bacteria → Proteobacteria899Open in IMG/M
3300009091|Ga0102851_11305481All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300009091|Ga0102851_11863352All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300009091|Ga0102851_13009851All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300009131|Ga0115027_10586069All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300009146|Ga0105091_10593700All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300009179|Ga0115028_10535794All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300009179|Ga0115028_10777209All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300009506|Ga0118657_10055967All Organisms → cellular organisms → Bacteria9000Open in IMG/M
3300010284|Ga0129301_1004099All Organisms → cellular organisms → Bacteria5540Open in IMG/M
3300010339|Ga0074046_10096711All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1908Open in IMG/M
3300010938|Ga0137716_10035297All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5794Open in IMG/M
3300011340|Ga0151652_11766931All Organisms → cellular organisms → Bacteria1329Open in IMG/M
3300011340|Ga0151652_13590815All Organisms → cellular organisms → Bacteria1334Open in IMG/M
3300011408|Ga0137460_1031715All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300012204|Ga0137374_11038552All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300012411|Ga0153880_1081274All Organisms → cellular organisms → Bacteria1441Open in IMG/M
3300013315|Ga0173609_10526868All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300014324|Ga0075352_1168577All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300014502|Ga0182021_12124757All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300014839|Ga0182027_10676804All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300017944|Ga0187786_10148598All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300017947|Ga0187785_10268108All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300017966|Ga0187776_10071601All Organisms → cellular organisms → Bacteria2010Open in IMG/M
3300017974|Ga0187777_10260113All Organisms → cellular organisms → Bacteria1179Open in IMG/M
3300017999|Ga0187767_10052553Not Available1014Open in IMG/M
3300018064|Ga0187773_10990819All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300018088|Ga0187771_10228481All Organisms → cellular organisms → Bacteria1548Open in IMG/M
3300019252|Ga0172286_1419184All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300020074|Ga0194113_10613217All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300021269|Ga0210356_106090All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300022548|Ga0212092_1014323All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5416Open in IMG/M
3300022554|Ga0212093_1001531All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria63970Open in IMG/M
3300022593|Ga0236338_1007294All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans2668Open in IMG/M
3300022650|Ga0236339_1132605All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans2425Open in IMG/M
(restricted) 3300024054|Ga0233425_10000140All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria183332Open in IMG/M
(restricted) 3300024054|Ga0233425_10004040All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria25343Open in IMG/M
(restricted) 3300024054|Ga0233425_10015274All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans8015Open in IMG/M
(restricted) 3300024054|Ga0233425_10023554All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans5442Open in IMG/M
(restricted) 3300024054|Ga0233425_10051769All Organisms → cellular organisms → Bacteria → Proteobacteria2819Open in IMG/M
3300024056|Ga0124853_1146030All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300024056|Ga0124853_1421771All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans2056Open in IMG/M
3300025107|Ga0208863_1047362All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300025111|Ga0208968_1064359All Organisms → cellular organisms → Bacteria1156Open in IMG/M
3300025152|Ga0208373_1043757All Organisms → cellular organisms → Bacteria2142Open in IMG/M
3300027721|Ga0209492_1231611All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300027740|Ga0214474_1213888All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300027792|Ga0209287_10120664All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300027811|Ga0256868_10072667All Organisms → cellular organisms → Bacteria1554Open in IMG/M
3300027841|Ga0209262_10130118All Organisms → cellular organisms → Bacteria → Proteobacteria1198Open in IMG/M
3300027863|Ga0207433_10670811All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300027871|Ga0209397_10043905All Organisms → cellular organisms → Bacteria1622Open in IMG/M
3300027885|Ga0209450_10011203All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4837Open in IMG/M
3300027887|Ga0208980_10058698All Organisms → cellular organisms → Bacteria2242Open in IMG/M
3300027887|Ga0208980_10115570All Organisms → cellular organisms → Bacteria1574Open in IMG/M
3300027887|Ga0208980_10126757All Organisms → cellular organisms → Bacteria1498Open in IMG/M
3300027887|Ga0208980_10178392All Organisms → cellular organisms → Bacteria1243Open in IMG/M
3300027887|Ga0208980_10407757All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300027887|Ga0208980_10492037All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300027896|Ga0209777_10199873All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans1608Open in IMG/M
3300027897|Ga0209254_10003680All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria13983Open in IMG/M
3300027897|Ga0209254_10335842All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300027897|Ga0209254_10828447All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300027900|Ga0209253_10013352All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria7009Open in IMG/M
3300027900|Ga0209253_10121942All Organisms → cellular organisms → Bacteria2126Open in IMG/M
3300027900|Ga0209253_10517356All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300027900|Ga0209253_11024775All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300027902|Ga0209048_10074704All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans2674Open in IMG/M
3300027902|Ga0209048_10118352All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans2015Open in IMG/M
3300028032|Ga0265296_1004598All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria11909Open in IMG/M
3300028032|Ga0265296_1150709All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300029327|Ga0243509_105438All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans4155Open in IMG/M
3300030613|Ga0299915_10833637All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300030613|Ga0299915_10868935All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300031463|Ga0272448_1010357All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans9392Open in IMG/M
3300031564|Ga0318573_10410387All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300031727|Ga0316576_11034935All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300031834|Ga0315290_10029163All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans4354Open in IMG/M
3300031834|Ga0315290_10426441All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1161Open in IMG/M
3300031834|Ga0315290_11495355All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300031873|Ga0315297_10042781All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3396Open in IMG/M
3300031873|Ga0315297_10045323All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans3306Open in IMG/M
3300031997|Ga0315278_10041966All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4456Open in IMG/M
3300031997|Ga0315278_10343021All Organisms → cellular organisms → Bacteria → Proteobacteria1544Open in IMG/M
3300031997|Ga0315278_10810556All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300032156|Ga0315295_12004875All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300032163|Ga0315281_10330391All Organisms → cellular organisms → Bacteria1658Open in IMG/M
3300032163|Ga0315281_10778800All Organisms → cellular organisms → Bacteria989Open in IMG/M
3300032164|Ga0315283_11863043All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300032173|Ga0315268_10001789All Organisms → cellular organisms → Bacteria24701Open in IMG/M
3300032173|Ga0315268_10679478All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300032173|Ga0315268_10948283All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300032173|Ga0315268_11093767All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300032173|Ga0315268_11102125All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300032173|Ga0315268_11333964All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300032173|Ga0315268_12135390All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300032173|Ga0315268_12785745All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300032342|Ga0315286_10302139All Organisms → cellular organisms → Bacteria1694Open in IMG/M
3300032342|Ga0315286_10343879All Organisms → cellular organisms → Bacteria1574Open in IMG/M
3300032342|Ga0315286_11000754All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300032342|Ga0315286_11552505All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300032401|Ga0315275_10430558All Organisms → cellular organisms → Bacteria1479Open in IMG/M
3300032401|Ga0315275_12210488All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300032516|Ga0315273_10503352All Organisms → cellular organisms → Bacteria1621Open in IMG/M
3300032516|Ga0315273_10543816All Organisms → cellular organisms → Bacteria1549Open in IMG/M
3300032516|Ga0315273_12166820All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300032516|Ga0315273_13209756All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300032893|Ga0335069_11855844All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300033406|Ga0316604_10134890All Organisms → cellular organisms → Bacteria1314Open in IMG/M
3300033406|Ga0316604_10554435All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300033408|Ga0316605_10737194All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300033408|Ga0316605_11734941All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300033416|Ga0316622_100185613All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans2203Open in IMG/M
3300033416|Ga0316622_101259545All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300033416|Ga0316622_102000921All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300033416|Ga0316622_102643627All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300033416|Ga0316622_102676336Not Available573Open in IMG/M
3300033419|Ga0316601_101924149All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300033482|Ga0316627_100974566All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300033482|Ga0316627_101027664All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300033483|Ga0316629_10394048All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300033485|Ga0316626_10004404All Organisms → cellular organisms → Bacteria7205Open in IMG/M
3300033486|Ga0316624_10378992All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300033489|Ga0299912_10084470All Organisms → cellular organisms → Bacteria2782Open in IMG/M
3300033489|Ga0299912_10574279All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300033489|Ga0299912_11277458All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300033513|Ga0316628_102959506All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300033521|Ga0316616_100123246All Organisms → cellular organisms → Bacteria → Proteobacteria2368Open in IMG/M
3300033521|Ga0316616_102645712All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300033557|Ga0316617_100180608All Organisms → cellular organisms → Bacteria1649Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment18.18%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil12.12%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland10.91%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment7.27%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands7.27%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment6.06%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.24%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland3.03%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil2.42%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.82%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.21%
WetlandEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland1.21%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater1.21%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater1.21%
Hot Spring Microbial MatEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Microbial Mats → Hot Spring Microbial Mat1.21%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment1.21%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.21%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.21%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.61%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.61%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.61%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment0.61%
Hot SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring0.61%
Anoxygenic And Chlorotrophic Microbial MatEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat0.61%
Anoxygenic And ChlorotrophicEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic0.61%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.61%
Hot Spring Fe-Si SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment0.61%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.61%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.61%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.61%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.61%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.61%
Deep Subsurface AquiferEnvironmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Deep Subsurface Aquifer0.61%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.61%
SedimentEngineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment0.61%
Anaerobic Digester DigestateEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate0.61%
Anode BiofilmEngineered → Industrial Production → Engineered Product → Bioanode → Unclassified → Anode Biofilm0.61%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000231Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4EnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300002492Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant NP 2012EnvironmentalOpen in IMG/M
3300003432Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300003859Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BREnvironmentalOpen in IMG/M
3300004155Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11EnvironmentalOpen in IMG/M
3300005839Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP NP MetaGEnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300006945Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC16 2012 metaGEnvironmentalOpen in IMG/M
3300007351Combined Assembly of Gp0115775, Gp0115815EnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300010284Hot spring microbial mat communities from California, USA to study Microbial Dark Matter (Phase II) - Cone Pool mat layer H metaGEnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010938Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117EnvironmentalOpen in IMG/M
3300011340Combined Assembly of Wetland MetatranscriptomesEnvironmentalOpen in IMG/M
3300011408Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT723_2EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012411Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013315Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA - 1BEngineeredOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019252Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300021269Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.499 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022548Cone Pool_combined assemblyEnvironmentalOpen in IMG/M
3300022554Dewar_combined assemblyEnvironmentalOpen in IMG/M
3300022593Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W2EnvironmentalOpen in IMG/M
3300022650Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W3EnvironmentalOpen in IMG/M
3300023207Combined Assembly of Gp0238866, Gp0238878, Gp0238879EngineeredOpen in IMG/M
3300024054 (restricted)Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MGEnvironmentalOpen in IMG/M
3300024056Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300025107Soil microbial communities from Rifle, Colorado - Rifle Oxygen_injection D3 (SPAdes)EnvironmentalOpen in IMG/M
3300025111Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection A3 (SPAdes)EnvironmentalOpen in IMG/M
3300025152Soil microbial communities from Rifle, Colorado - Rifle Oxygen_injection C2 (SPAdes)EnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027740Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeqEnvironmentalOpen in IMG/M
3300027792Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027811Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeqEnvironmentalOpen in IMG/M
3300027841Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027863Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027871Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027887Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300028032Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1EnvironmentalOpen in IMG/M
3300029327Anode biofilm microbial communities from glucose-fed MFC - GM-anode biofilmEngineeredOpen in IMG/M
3300030613Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227EnvironmentalOpen in IMG/M
3300031463Hot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-019-1EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031727Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5Host-AssociatedOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033406Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CTEnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033489Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214EnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
TB_LI09_4DRAFT_1010749023300000231GroundwaterMKALRWFVDSMLGYWILLLVICLGVAAGIYEIWLKGRI*
TB_LI09_4DRAFT_1022933913300000231GroundwaterMKWFVNSMLGYWVLLLVISLGAAAIIYEIWLRGRI*
JGIcombinedJ13530_10022456653300001213WetlandREEGKMAKGMRWFIDSMLGYWILLLVISLGAATVIYEVWLKGRV*
JGIcombinedJ13530_10131783233300001213WetlandWFIDSMIGYWVLLLIISLGGAAIIYLMYLRDHLF*
JGIcombinedJ13530_10248780523300001213WetlandMKWFINSMLGYWILLLAISLGAAAVIYEIWLKGRV*
JGIcombinedJ13530_10513760233300001213WetlandMKWFINSMFGYWILLLAIALGIASWIYFAWLKDALI*
JGIcombinedJ13530_10528548323300001213WetlandMRWFIDSMIGYWILLLSASLGVAAVIYEVWLRGSMHM*
JGIcombinedJ13530_10546856433300001213WetlandMRWLYHTMIGYWILLLSISLGAAAIIYEVWLRGNI*
JGIcombinedJ13530_10614777823300001213WetlandMKWFVNTMLGYWILLLAISLSAAAVVYEIWFKGRI*
JGIcombinedJ13530_10618832043300001213WetlandMAKGLRWFWDSMLGYWVLLLTISLGAAAVVYELWLKGRV*
JGIcombinedJ13530_10684157413300001213WetlandMAKGLRWFIDSMLGYWILLLAISLGAAAVIYELWLKGRV*
JGIcombinedJ13530_10694214623300001213WetlandMAVPRAFRWFIDSMFGYWVLLLVISLVSAAGIYEIWLKGRM*
JGIcombinedJ13530_10814999813300001213WetlandMKWFIDSMFGYWILLLAFSLGVSALIYEVWLRGNL*
JGI24188J35168_100456953300002492Anoxygenic And Chlorotrophic Microbial MatMEEESKAMRWFIDSMLGYWXLLLAISMGTAAAVYLLWLKQAAFSG*
JGI20214J51088_1017088533300003432WetlandMAKGLRWFIDSMLGYWILLLAISLGAAAGIYELWLKGRV*
Ga0031653_1006080923300003859Freshwater Lake SedimentMTGFVHKLRWFVDSMLGYWVLLLIISLGSAAVIYEIWLKGRM*
Ga0066600_1011810133300004155FreshwaterMPKKLRWFIDSMFGYWVLLLLISLGTAAGIYEVWLKGRM*
Ga0068707_100536253300005839Anoxygenic And ChlorotrophicMRWFIDSMLGYWILLLAISMGTAAAVYLLWLKQAAFSG*
Ga0079037_10019968523300006224Freshwater WetlandsMKWFINSMLGFWILLLTISLGAAAVVYEIWLKGHV*
Ga0079037_10022103633300006224Freshwater WetlandsMKWFINSMLGFWILLLTISLGAAALVYEIWLKGQV*
Ga0079037_10026682433300006224Freshwater WetlandsMKWFINSMLGFWVLLLAISLGAAAIVYEIWLKGRV*
Ga0079037_10028877023300006224Freshwater WetlandsMKWFINSMLGFWILLLTISLGAAALVYEIWLKGRI*
Ga0079037_10068852723300006224Freshwater WetlandsMTGFVHKLRWFVDSMLGYWVLLLTISLGSAAVIYEIWLKGRM*
Ga0079303_1024330833300006930Deep SubsurfaceMPKKLRWFIDSMFGYWVLLLVISLGTAAGIYEIWLKGRM*
Ga0073933_107608933300006945Hot Spring SedimentMEEESKAMRWFIDSMLGYWILLLAISMGTAAAVYLLWLKQAAFSG*
Ga0104751_1002875143300007351Deep Subsurface AquiferMKWFINSMIGYWVLLLAISLGIAAVIYEVWLRDALLK*
Ga0105105_1002581843300009009Freshwater SedimentMKWFINSMLGFWILLLTISLGAAALVYEIWLKGHV*
Ga0105093_1050333623300009037Freshwater SedimentMKWFINSMLGFCVLLLAISLGAAAIVYEIWLKGRV*
Ga0105095_1038364033300009053Freshwater SedimentMKWFINSMLGFWILLLTISLGAAAIVYEIWLKGHV*
Ga0105098_1045802023300009081Freshwater SedimentMKWFINSMLGFWILLLAISLGAAAVVYEIWLKGHV*
Ga0105099_1036046023300009082Freshwater SedimentMKWFINSMLGFWILLLTISLGAAALVYEIWLKGRV*
Ga0105103_1028739313300009085Freshwater SedimentMKWFINSMLGFWILLLAISLGAAALVYEIWLKGRV*
Ga0102851_1058648323300009091Freshwater WetlandsMKWFINSMLGYWILLLAISLGAAALIYEIWLKGRV*
Ga0102851_1102557233300009091Freshwater WetlandsWSMAAPKALRWFIDSMFGYWVLLLVISLVSAAGIYEIWLKGRM*
Ga0102851_1130548123300009091Freshwater WetlandsMKWFINSMLGFWILLLAISLGAAALVYEIWLKGHV*
Ga0102851_1186335223300009091Freshwater WetlandsMKWFINSMLGFWILLLVISLGAAALVYEIWLKGHV*
Ga0102851_1300985123300009091Freshwater WetlandsVKFLINTMWGFWLLLLAISLGAAAIVYELWLKGNV*
Ga0115027_1058606913300009131WetlandMAKRLRWFIDSMFGYWVLLLLISLGTAAGIYEVWLKGRM*
Ga0105091_1059370023300009146Freshwater SedimentMKWFINSMLGYWILLLAISLGAAAVVYEIWLKGRI*
Ga0115028_1053579423300009179WetlandMAKGLRWFWDSMLGYWVLLLAISLGAAAVVYELWLKGRV*
Ga0115028_1077720913300009179WetlandMKWFINSMLGFWILLLSISLGAAALVYEIWLKGRI*
Ga0118657_1005596783300009506Mangrove SedimentMPKALRWFVDSMLGYWVLLLTISLFSAAGIYEVWLKGRL*
Ga0129301_100409943300010284Hot Spring Microbial MatMKWLINRLLAFWLLLLAISLGAAALVYEIWLKGRI*
Ga0074046_1009671133300010339Bog Forest SoilMKWFINSMLGYWILLLAFSLGVSAVIYVLWLKDALL*
Ga0137716_1003529723300010938Hot Spring Fe-Si SedimentMKWFIDSMLGYWIMLLAASLGAAACIYVFWLKDALY*
Ga0151652_1176693133300011340WetlandMKWFINSMLGYWVLLLAISLGAAAIVYEIWLKGRF*
Ga0151652_1359081523300011340WetlandMKWFINSMLGYWVLLLAISLGAAALVYEIWLKGRV*
Ga0137460_103171523300011408SoilMKWFINSMLGYWILLLAISLGAAAVVYEIWLKGHV*
Ga0137374_1103855223300012204Vadose Zone SoilMKWFINTMPGYWILLLAISMSAAAGIYELWLKNQM*
Ga0153880_108127433300012411Freshwater SedimentMKWFINSMIGYWILLLTISLGIAAAIYEFWLKGTV*
Ga0173609_1052686823300013315SedimentMPKGIRWFWDSMLGYWVLLLTISLGAAAVVYELWLKGRV*
Ga0075352_116857723300014324Natural And Restored WetlandsMKWFINSMFGFWVLLLVISLGAAAIVYEIWLKGHV*
Ga0182021_1212475723300014502FenMKWFINSMLGYWILLLTISCTIALVIYEVWLKGTV*
Ga0182027_1067680433300014839FenMTFMKWFINSMLGYWILLLTISCTIALVIYEVWLKGVV*
Ga0187786_1014859823300017944Tropical PeatlandMKWFINSMLGFWVLLLAISLGAAAIVYEIWLKGRV
Ga0187785_1026810823300017947Tropical PeatlandMRWFIDSMIGYWVLLLAISLGVSAVIYEVWLKGNI
Ga0187776_1007160123300017966Tropical PeatlandMGRLRWFVDSMVGYWILVLAVSLAIAAGIYEIWLKGKM
Ga0187777_1026011323300017974Tropical PeatlandMRWFIDSMIGYWILLLAISLGAAAVVYEVWLRGNI
Ga0187767_1005255323300017999Tropical PeatlandMQRLRWFVDSMLGYWILLLAVSMGIAAGIYEMWLKGRM
Ga0187773_1099081933300018064Tropical PeatlandMKWFIDSMVGWWVLLLVVSWCAAAVVYELWLRGNIV
Ga0187771_1022848133300018088Tropical PeatlandMGRLRWFVDSMVGYLILLWAVSLGIAAGIYEMWLKGKM
Ga0172286_141918423300019252WetlandMKWFINSMLGFWILLLTISLGAAALVYEIWLKGHV
Ga0194113_1061321723300020074Freshwater LakeMKWFVNTMLGYWILLLVISMGVAAAIYEIWLKGSV
Ga0210356_10609023300021269EstuarineMKWFINSMIGYWIFLLAISLGLAAICYEVFLKQMMR
Ga0212092_101432343300022548Hot Spring Microbial MatMKWLINRLLGFWLLLLAISLGAAALVYEIWLKGRI
Ga0212093_1001531183300022554Hot Spring SedimentMRWFIDSMLGYWILLLAISMGTAAAVYLLWLKQAAFSG
Ga0236338_100729433300022593FreshwaterMKWFINSMLGYWILLLAFSLGVSAVIYVIWLKDALL
Ga0236339_113260533300022650FreshwaterMKWFINSMLGYWILLLAFSLGVSAVIYVLWLKDALL
Ga0255811_1127593133300023207Anaerobic Digester DigestateVLKEANIMNWFWDTMIGYWVLLLAISLGAAAVIYVLYLKDTLF
(restricted) Ga0233425_10000140643300024054FreshwaterMKWFINSMIGYWILLLAISLGAAAVVYEVWLRGNI
(restricted) Ga0233425_10004040173300024054FreshwaterMKWFINSMIGYWVLLLAISLGAAAVVYEVWLRGNI
(restricted) Ga0233425_1001527443300024054FreshwaterMRWFIDSMLGYWILVLAVSLGTAAVIYQIWLKDSL
(restricted) Ga0233425_1002355423300024054FreshwaterMRWFYDSMSGYWILLLLISLGGAAVIYMVWLQDTLF
(restricted) Ga0233425_1005176943300024054FreshwaterMRWFIDSMLGFWVLLLTISLAIAWGIYEIWLRGSV
Ga0124853_114603013300024056Freshwater WetlandsMKWFINSMLGFWILLLTISLGAAALVYEIWLKGRI
Ga0124853_142177113300024056Freshwater WetlandsMKWFINSMLGFWILLLTISLGAAAVVYEIWLKGHV
Ga0208863_104736223300025107SoilMKRILNSMLGFWLLLLGISLGTAGIIYEVWLKGRI
Ga0208968_106435933300025111SoilMPKVLHWFVNSMLGYWILLLVFSMGIAASIYEVWLKDRM
Ga0208373_104375713300025152SoilMKWFVNSMLGYWILLLTISMGAAGIIYEIWLKGKV
Ga0209492_123161123300027721Freshwater SedimentMKWFINSMLGFWILLLAISLGAAAVVYEIWLKGHV
Ga0214474_121388823300027740SoilMKWFINSMLGFWVLLLVISLGAAALVYEIWLKGRI
Ga0209287_1012066433300027792Freshwater SedimentMKWFINSMLGFWILLLTISLGAAALVYEIWLKGRV
Ga0256868_1007266743300027811SoilMKWFINSLMGYWILLLAISLGAAALVYQIWLKGRI
Ga0209262_1013011843300027841FreshwaterMPKKLRWFIDSMFGYWVLLLLISLGTAAGIYEVWLKGRM
Ga0207433_1067081133300027863Hot SpringMEEESKAMRWFIDSMLGYWILLLAISMGTAAAVYLLWLKQAAFSG
Ga0209397_1004390523300027871WetlandMKWFINSMLGFWILLLAISLGAAALVYEIWLKGHV
Ga0209450_1001120343300027885Freshwater Lake SedimentMAKRLRWFIDSMFGYWVLLLLISLGTAAGIYEVWLKGRM
Ga0208980_1005869833300027887WetlandMKWFINSMLGFWILLLVISLGAAAVVYEIWLKGHV
Ga0208980_1011557033300027887WetlandMKWFINSMFGFWVLLLVISLGAAAIVYEIWLKGHV
Ga0208980_1012675723300027887WetlandMAKRLRWFIDSMFGYWVLLLIISLGTAAGIYEVWLKGRM
Ga0208980_1017839223300027887WetlandMKWFINSMLGFWILLLVISLGAAAIVYEVWLKGHV
Ga0208980_1040775733300027887WetlandMKWFVNTMLGYWILLLVISLGAAAVVYEIWLKGRI
Ga0208980_1049203723300027887WetlandMKWFVNTMLGYWILLLAISLSAAAVVYEIWFKGRI
Ga0209777_1019987343300027896Freshwater Lake SedimentMRWLINSMLGYWVLLLVISLGAAGVIYEVWLKGNM
Ga0209254_10003680113300027897Freshwater Lake SedimentMKWFINSMLGFWILLLAISLGAAALVYEIWLKGRV
Ga0209254_1033584223300027897Freshwater Lake SedimentMPKGLRWFVDSMLGYWVLLLVISLGAAAGIYEVWLKGRM
Ga0209254_1082844723300027897Freshwater Lake SedimentMKWFINSMVGYWILLLAISLGIAAVIYAVWLRDALL
Ga0209253_1001335273300027900Freshwater Lake SedimentMKWFINSMLGFWILLLAISLGAAALVCEIWLKGRV
Ga0209253_1012194223300027900Freshwater Lake SedimentMKWFLNSMLGYWVLLLAISLGAAAIIYEIWLKGRM
Ga0209253_1051735623300027900Freshwater Lake SedimentMTGFVHKLRWFVDSMLGYWVLLLIISLGSAAVIYEIWLKGRM
Ga0209253_1102477513300027900Freshwater Lake SedimentMTGFVHKLRWFVDSMLGYWVLLLTISLGSAAVIYEIWLKGRM
Ga0209048_1007470433300027902Freshwater Lake SedimentMRWFIDSMVGYWILLLLISLGVAAIIYLVYLKDAMNF
Ga0209048_1011835233300027902Freshwater Lake SedimentMRWFIDSMIGYWILLLSASLGVAAVIYEVWLRGTMHM
Ga0265296_1000263523300028032GroundwaterMKWFINTMIGYWVLLLAISLGIAAAIYEIWLRDALF
Ga0265296_1004598123300028032GroundwaterMRWFIDSMIGYWVLLLAISLGIAAVIYEVWLRGSLVY
Ga0265296_115070923300028032GroundwaterMKWFIDSMIGYWVLLLTISLGIAAVIYEVWLRDTLLK
Ga0243509_10543853300029327Anode BiofilmMKVFIDSMLGYWILLLAISLGVAAMIYQLWLRNVL
Ga0299915_1083363733300030613SoilMKWLLNSMLGYWILLLVFSLGAAAVIYEVWLKGHL
Ga0299915_1086893513300030613SoilMIGSVHKLRWFVDSMVGYWVLLLVISLGSAAVIYEIWLKGRM
Ga0272448_101035753300031463SedimentMKWFIDSMLGYWIMLLAASLGAAACIYVFWLKDALY
Ga0318573_1041038733300031564SoilMKWFIDSMLGYWILLLAVSMGAAAGIYEMWLKNAM
Ga0316576_1103493523300031727RhizosphereVPKALRWFVDSMLGYWVLLLTISLFSAAGIYEVWLKGRL
Ga0315290_1002916343300031834SedimentMRWFIHSMVGYWVLLLAISLGVAAAIYEIWLRGNI
Ga0315290_1042644133300031834SedimentMKWFIESMFGYWILLLAIALGLAAGVYLVWLKDALV
Ga0315290_1149535523300031834SedimentMKWFVNSMLGFWVLLLAISLGAAAVVYEIWLKGRV
Ga0315297_1004278143300031873SedimentMKWFLNSMLGYWVLLLAISLGAAAIIYEIWLKGRV
Ga0315297_1004532353300031873SedimentMRWFIDSMIGYWILLLSASLGVAAVIYEVWLRGSMHM
Ga0315278_1004196643300031997SedimentMAKGLRWFIDSMLGYWILLLVISLGGAAAIYELWLKGRV
Ga0315278_1034302143300031997SedimentMKWFVTSMFGYWILLLVISLGSAAAIYEIWLRGNM
Ga0315278_1081055633300031997SedimentMKWFINSMLGFWILLLAISLGAAAVVYEIWLKGNV
Ga0315295_1200487513300032156SedimentMKWFIESMLGYWILLLAISLGLAAGIYVIWLKDALY
Ga0315281_1033039113300032163SedimentMKWFINSMLGYWILLLAFSLGAAAVVYEIWLKGHV
Ga0315281_1077880033300032163SedimentMKWFINSMLGYWILLLAISLGAAAIVYEIWLKGHV
Ga0315283_1186304323300032164SedimentMKWIMNTMLGYWILLLVISMGAAALVYEIWLKGRM
Ga0315268_10001789143300032173SedimentMKWFVNSMLGYWILLLIISLGSATVIYEIWLKNRM
Ga0315268_1067947823300032173SedimentMAKGLRWFVDSMLGYWILLLTISLAVAAVIYELWLKGRM
Ga0315268_1094828313300032173SedimentMKWFINSMLGYWTLLLAISLGAAAGIYVVWLKGRM
Ga0315268_1109376713300032173SedimentMKWFINSMIGWWLLLLAISLGISAVAYELFLKQMMR
Ga0315268_1110212523300032173SedimentMKWFVDSMLGYWILLLAVSLCAAALIYEIWLKGTLV
Ga0315268_1133396423300032173SedimentMRWFIDSMIGYWILLLTFSLGVAAVIYEVWLRGNL
Ga0315268_1213539023300032173SedimentMKWFINTMLGYWILLLVISLGAAALIYSIWLKGVI
Ga0315268_1278574513300032173SedimentARHVRRSKMSKRLSWFIDSMLGYWVLLLTISLGAAAGIYEIWLKGRM
Ga0315286_1030213923300032342SedimentMKWFINSMLGFWILLLAISLGAAAIVYEIWLKGHV
Ga0315286_1034387923300032342SedimentMKWFINSMLGYWCLLLAISLGAAAWVYLTWLKDVM
Ga0315286_1100075423300032342SedimentMKWFVNSMFGYWILLLIISLGSAAAIYEIWLRGSM
Ga0315286_1155250523300032342SedimentMKWFVNTMLGYWILLLVISLGAAAVIYEIWLKGRI
Ga0315275_1043055833300032401SedimentMKWFVESMLGYWILLLAISLGLAAGIYVVWLKDALY
Ga0315275_1221048813300032401SedimentMKWFINSMLGYWILLLAISLGAAAIVYEIWLKGNV
Ga0315273_1050335233300032516SedimentMKKLINSMLGYWILLLVISLGAAAVIYEIWLRGNI
Ga0315273_1054381623300032516SedimentMRWFIDSMIGYWILLLTASLGVAAVIYEVWLRGSMHM
Ga0315273_1216682023300032516SedimentMKWFVNSMFGYWILLLIVSLGSAAAIYEIWLRGSM
Ga0315273_1320975623300032516SedimentMKWFINSMLGYWILLLTFSLGSAAVIYEVWLKGRM
Ga0335069_1185584413300032893SoilMRWFIDSMIGYWILVLVFSLAVAAVIYEFWLKGNVF
Ga0316604_1013489033300033406SoilMKWFINSMLGFWILLLSISLGAAALVYEIWLKGRI
Ga0316604_1055443523300033406SoilMPKKLRWFIDSMFGYWVLLLVISLGTAAGIYEIWLKGRM
Ga0316605_1073719423300033408SoilMKWFINSMLGFWILLLAISLGAAALVYEIWLKGRI
Ga0316605_1173494123300033408SoilMKWFINSMLGFWILLLTISLGAAALVYEIWLKGQV
Ga0316622_10018561333300033416SoilMKWFYESMVGYWIMLLAISLGAAAAIYLLWLREALY
Ga0316622_10125954513300033416SoilMAVPRAFRWFIDSMFGYWVLLLVISLVSAAGIYEIWLKGRM
Ga0316622_10200092113300033416SoilMKWFVNSMLGYWILLLAISMGAAAGIYEIWLKGKV
Ga0316622_10264362713300033416SoilMRWFIDSMFGYWILLLAIALGTAAGIYLVWLRDAIF
Ga0316622_10267633613300033416SoilMDKKWYDSMLTYWIVLLVISLGAAGAAYVIWLKEAM
Ga0316601_10192414923300033419SoilMAKRLRWFIDSMFGYWVLLLLISLGTAAGIYEIWLKGRM
Ga0316627_10097456623300033482SoilMKWFVNSMLGFWILLLAISLGAAALVYEIWLKGRI
Ga0316627_10102766423300033482SoilMRWFVNSMLGYWVLLLAISMGTAAAIYEMWLKDRM
Ga0316629_1039404833300033483SoilEKTSMKWFINSMLGFWILLLAISLGAAAIVYEIWLKGHV
Ga0316626_1000440423300033485SoilMTGFVNKLRWFVDSMLGYWVLLLTISLGSAAVIYEIWLKGRM
Ga0316624_1037899233300033486SoilMKWFINSMLGYWVLLLVISLGAAAIIYEVWLKGRV
Ga0299912_1008447023300033489SoilVTTPKAVRWFTESMFGYWVLLLAISLALAAGIYEVWLKGRM
Ga0299912_1057427923300033489SoilMKWFVNSMLGYWVLLLAISLGAAAIIYEIWLKGRM
Ga0299912_1127745823300033489SoilMPKALRWFVESMFGYWVLLLTVSLGVAAVIYEMWLKGKI
Ga0316628_10295950613300033513SoilMKWFINSMLGYWILLLAISLGSAAIIYEVWLKGTI
Ga0316616_10012324613300033521SoilKEETSMKWFINSMLGFWILLLTISLGAAALVYEIWLKGQV
Ga0316616_10264571223300033521SoilMKWLVSSMLGYAILLLAVSMAMALGIYELWLKNRM
Ga0316617_10018060833300033557SoilMKWFINSMLGFWILLLVISLGAAALVYEIWLKGHV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.