| Basic Information | |
|---|---|
| Family ID | F033501 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 177 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MNAIEFINEMDRLAEVHFGEFGYDTCSQDEKKAVIKLLLHNTK |
| Number of Associated Samples | 147 |
| Number of Associated Scaffolds | 176 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.70 % |
| % of genes near scaffold ends (potentially truncated) | 26.55 % |
| % of genes from short scaffolds (< 2000 bps) | 78.53 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (84.746 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (15.254 % of family members) |
| Environment Ontology (ENVO) | Unclassified (64.407 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (63.842 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.11% β-sheet: 0.00% Coil/Unstructured: 47.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 176 Family Scaffolds |
|---|---|---|
| PF16778 | Phage_tail_APC | 1.14 |
| PF01068 | DNA_ligase_A_M | 1.14 |
| PF00268 | Ribonuc_red_sm | 0.57 |
| PF14743 | DNA_ligase_OB_2 | 0.57 |
| PF13385 | Laminin_G_3 | 0.57 |
| PF04542 | Sigma70_r2 | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
|---|---|---|---|
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 1.14 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.14 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.57 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.57 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.57 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.57 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 84.75 % |
| All Organisms | root | All Organisms | 15.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 15.25% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 12.43% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.47% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 5.65% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 5.08% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 5.08% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.08% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.95% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.39% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.39% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 2.82% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.82% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.26% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.26% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.26% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.69% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 1.69% |
| Coastal Water And Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment | 1.69% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.13% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.13% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.13% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.13% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.13% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.13% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.56% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.56% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.56% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.56% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.56% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.56% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.56% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.56% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.56% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.56% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 0.56% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.56% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.56% |
| North Sea | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → North Sea | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2100351011 | Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from medium methane PC12-240-170cm | Environmental | Open in IMG/M |
| 2140918005 | Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from high methane PC12-225-485cm | Environmental | Open in IMG/M |
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000121 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3m | Environmental | Open in IMG/M |
| 3300000127 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 05_45m | Environmental | Open in IMG/M |
| 3300000128 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45m | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
| 3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
| 3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
| 3300001351 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001938 | Marine microbial communities from Bedford Basin, Nova Scotia, Canada - GS005 | Environmental | Open in IMG/M |
| 3300002224 | Marine microbial communities from the Baltic Sea - M1t6 BS2 (105N) | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300005609 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007543 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 | Environmental | Open in IMG/M |
| 3300007552 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571 | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300008651 | Microbial communities of saline water collected from the North Sea in Germany - HE327_13 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009528 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG | Environmental | Open in IMG/M |
| 3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011127 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, 0.02 | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300011261 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02 | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300018642 | Metatranscriptome of marine microbial communities from Baltic Sea - GS695_0p1 | Environmental | Open in IMG/M |
| 3300018980 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127) | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021087 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022913 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MG | Environmental | Open in IMG/M |
| 3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
| 3300022938 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024057 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_9 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025832 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027790 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027810 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027839 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes) | Environmental | Open in IMG/M |
| 3300027849 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027865 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21 | Environmental | Open in IMG/M |
| 3300027883 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027967 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027978 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027980 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031141 | Marine microbial communities from water near the shore, Antarctic Ocean - #351 | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031167 | Marine microbial communities from water near the shore, Antarctic Ocean - #418 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031589 | Marine microbial communities from David Island wharf, Antarctic Ocean - #35 | Environmental | Open in IMG/M |
| 3300031601 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #133 | Environmental | Open in IMG/M |
| 3300031602 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260 | Environmental | Open in IMG/M |
| 3300031608 | Marine microbial communities from water near the shore, Antarctic Ocean - #1 | Environmental | Open in IMG/M |
| 3300031629 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80 | Environmental | Open in IMG/M |
| 3300031647 | Marine microbial communities from water near the shore, Antarctic Ocean - #179 | Environmental | Open in IMG/M |
| 3300031658 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78 | Environmental | Open in IMG/M |
| 3300031688 | Marine microbial communities from water near the shore, Antarctic Ocean - #177 | Environmental | Open in IMG/M |
| 3300031689 | Marine microbial communities from water near the shore, Antarctic Ocean - #280 | Environmental | Open in IMG/M |
| 3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
| 3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
| 3300031702 | Marine microbial communities from David Island wharf, Antarctic Ocean - #37 | Environmental | Open in IMG/M |
| 3300031721 | Marine microbial communities from water near the shore, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ASMM170b_09264050 | 2100351011 | Coastal Water And Sediment | MDNNINNKNMNAIEFTKEMDRLAEVNFGEFGYDTCSHSEKQAVIKLLLHNTK |
| ASHM485C_00970230 | 2140918005 | Coastal Water And Sediment | INEMDYLAQVHFAEFGYDTCSHSEKQAVIKLLLHNTK |
| ASHM485C_00931400 | 2140918005 | Coastal Water And Sediment | MNALQFIKEMDRLAEVHFAEFGYDTCNQHEKQAVIKLLLDNTK |
| DelMOSum2010_102046063 | 3300000101 | Marine | MNAIEFINEMDYLAQVHFAEFGYDTCSYEEKQAVIKLLL |
| DelMOSum2010_102132713 | 3300000101 | Marine | MNAIEFINEMDRLAQVHFAEFGYDTCSQDEKKAVIKLLLHNTK* |
| DelMOSum2010_102261553 | 3300000101 | Marine | MNAIEFTKEMDRLAEVHFGEFGYDTCSQDEKKAVIKLLLHNTK |
| DelMOSum2010_102663482 | 3300000101 | Marine | MNALQFINEMDRLAQVHFAEFGYDTCDQHDKQAVIKLLLDDTK* |
| TDF_OR_ARG04_113mDRAFT_10003222 | 3300000121 | Marine | MNAIEFVDEMDYLAQVHFGEFGYDTCSHDEKKAVIKLLLHNLKK* |
| SA_S1_NOR05_45mDRAFT_100608191 | 3300000127 | Marine | MNAIEFINEMDYLAQVHFAEFGYDTCSQDEKKAVIKLLLHNTK* |
| SA_S1_NOR08_45mDRAFT_100215922 | 3300000128 | Marine | MNAIEFIKEMDRLAEVHFAEFGYDTCSQDEKQAVIKLLLHNTK* |
| NpDRAFT_100197395 | 3300000929 | Freshwater And Marine | MNAEEFVNEMDSIAQNYFGEFGYDTCSSGEKKAVIQLL |
| JGI20156J14371_100952582 | 3300001347 | Pelagic Marine | MNAEEFVXEMDMIAQNYFGEFGYDTCSSGEKKAVIQLLLHNTK* |
| JGI20154J14316_101072004 | 3300001348 | Pelagic Marine | MNAEEFVNEMDMIAQNYFGEFGYDTCSSGEKKAVIQLLLHNTK* |
| JGI20154J14316_101229103 | 3300001348 | Pelagic Marine | MNAEEFVNEMDTIAQNYFGEFGYDTCSSGEKKAVIQLLLHNLNK* |
| JGI20160J14292_101733242 | 3300001349 | Pelagic Marine | MNAEEFVNEMDHLAQVHFAEFGYDTCSSGEKKAVIQLLLHNLNK* |
| JGI20153J14318_100276112 | 3300001351 | Pelagic Marine | MNAEEFVXEMDMIAQNYFGEFGYXTCSSGEKKAVIQLLLHNTK* |
| JGI20157J14317_101561372 | 3300001352 | Pelagic Marine | MNAIEFINEMDRLAQVHFGEFGYDTCSQDEKKAVIKLLLHNTK* |
| JGI20157J14317_101642523 | 3300001352 | Pelagic Marine | NAEEFVNEMDMIAQNYFGEFGYDTCSSGEKKAVIQLLLHNIK* |
| JGI20157J14317_102165512 | 3300001352 | Pelagic Marine | MNAEEFVNEMDTIAQNYFGEFGYDTCSTGEKKAVIELLLHNLNK* |
| GOS2221_10131513 | 3300001938 | Marine | MNAIEFVNEMDRLAEVHFGEFGYDTCSDDEKKAVIKLLLHNLNK* |
| M1t6BS2105N_15263832 | 3300002224 | Marine | MNAIEFINEMDYLAQVHFAEFGYDTCSHSEKKAVIKLLLHNLNK* |
| Ga0065861_10679072 | 3300004448 | Marine | MNALEFTNEMDRLAEVHFAEFGYDTCSHSEKQAVIKLLLHNLNK* |
| Ga0065861_11173951 | 3300004448 | Marine | MNALQFINEMDRLAQVHFAEFGYDTCDQHEKQAVIKLLLDDTK* |
| Ga0073579_11745074 | 3300005239 | Marine | MNALQFINEMDRLAQVHFGEFGYDTCDQHEKQAVIKLLLDDTK* |
| Ga0073579_11745077 | 3300005239 | Marine | MNALQFINEMDRLAEVHFAEFGYDTCNQHEKQAVIKLLLHNTK* |
| Ga0070728_103346552 | 3300005588 | Marine Sediment | MNAIEFTKEMDRLAQVHFAEFGYDTCSQDEKQAVIKLLLHNTK* |
| Ga0070729_103138001 | 3300005589 | Marine Sediment | NMNALQFINEMDRLAQVHFAEFGYDTCDQHEKQAVVKLLLDNLNK* |
| Ga0070726_106141121 | 3300005600 | Marine Sediment | FINEMDRLAQVHFAEFGYDTCDQHEKQAVVKLLLDNLNK* |
| Ga0070722_100004691 | 3300005601 | Marine Sediment | MNALQFINEMDRLAQVHFAEFGYDTCDQHEKQAVVKLLLDNLNK* |
| Ga0070724_102434293 | 3300005609 | Marine Sediment | MNAIEFTKEMDRLAEVHFGEFGYDTCSQDEKKAVIKLLLHNTK* |
| Ga0078893_116732722 | 3300005837 | Marine Surface Water | MNAIQFINEMDDLAKTYFGEFGYDTCNHEQKQAVIKLLLHNLNK* |
| Ga0070743_102375242 | 3300005941 | Estuarine | MNAIEFLNEMDYLAQVHFGEFGYDTCSYEEKQAVIKLLLHNTK* |
| Ga0075466_11216411 | 3300006029 | Aqueous | MNAIEFINEMDRLAEVHFGEFGYDTCSKAEKQAVIKSLLHNSVWVF |
| Ga0075445_102828791 | 3300006193 | Marine | EFVGEMDRLAEVHFGEFGYDTCSSDEQKAVIKLLLHNLKND* |
| Ga0099972_109426681 | 3300006467 | Marine | MNAIEFINEMDYLAQVHFAEFGYDTCSHSEKQAVIKLLLDNKK* |
| Ga0070744_101558371 | 3300006484 | Estuarine | MNAEEFVNEMDSIAQNYFGEFGYDTCSSGEKKAVIQLLL |
| Ga0070744_102285701 | 3300006484 | Estuarine | MNAEEFVNEMDSIAQNYFGEFGYDTCSSGEKKAVIQLLLHNTK* |
| Ga0098055_10123263 | 3300006793 | Marine | MNATEFVNEMDRLAEVHFGEFGYDTCSEDEKKAVIKLLLHNLNK* |
| Ga0075467_100787641 | 3300006803 | Aqueous | MNAIEFINEMDRLAEVHFGEFGYDTCSQAEKQAVIKSLLHNSVWVFLKVDKN* |
| Ga0070750_102094352 | 3300006916 | Aqueous | MNAIEFVNEMDRLAEVHFGEFGYDTCSNDEKKAVIKLLLHNLNK* |
| Ga0070748_11519702 | 3300006920 | Aqueous | MNAIEFVKEMDHLAEVHFGEFGYDTCSDDEKKAVIKLLLHNLNK* |
| Ga0075468_100837431 | 3300007229 | Aqueous | NNMNAIEFINEMDRLAEVHFGEFGYDTCSQAEKQAVIKSLLHNSVWVFLKVDKN* |
| Ga0075469_101787521 | 3300007231 | Aqueous | MNAIEFINEMDRLAEVHFGEFGYDTCSKAEKQAVIKLFLHNSVWVFLKVDKN* |
| Ga0070747_11226072 | 3300007276 | Aqueous | MNAIEFVNEMDRLAEIHFGEFGYDTCSGDEKKAVIKLLLHNLNK* |
| Ga0102853_10548001 | 3300007543 | Estuarine | YKQIKTMNALQFINEMDRLAQVHFGEFGYDTCDQHDKQAVIKLLLDDTK* |
| Ga0102853_11065392 | 3300007543 | Estuarine | MNALQFINEMDRLAQVHFGEFGYDTCDQHDKQAVIKLLLDDTK* |
| Ga0102818_10797971 | 3300007552 | Estuarine | MDNIINNKNMNAIEFVKEMDRLAEVYFGEFGYDTCSHSEKQAVIQLLLHNTK* |
| Ga0105748_101267442 | 3300007992 | Estuary Water | MNALQFINEMDRLAQVHFGEFGYDTCDQHDKQAVIKLLLDD |
| Ga0115371_108774843 | 3300008470 | Sediment | TKIINMNAIEFVGEMDRLAEVHFGEFGYATCSSDEQKAVIKLLLHNLKK* |
| Ga0103623_10071351 | 3300008651 | North Sea | SSTIAKKKKNMNAIEFINEMDRLAEVHFGEFGYDTCSQDEKKAVIKLLLHNTK* |
| Ga0115549_12664932 | 3300009074 | Pelagic Marine | MNAEEFVNEMDYLAQVHFAEFGYDTCSSGEKKAVIQLLLHNLNK* |
| Ga0114995_101648171 | 3300009172 | Marine | MNAIEFINEMDRLAEVHFAEFGYDTCSQDEKKAVIKLLLHNTK* |
| Ga0114993_108398722 | 3300009409 | Marine | MNAIEFINEMDRLAEVHFAEFGYDTCSHSEKQAVIKLLLHNLNK* |
| Ga0114993_113351811 | 3300009409 | Marine | MNALQFINEMDRLAQVHFAEFGYDTCDQHEKQAVIKLLLDNTK* |
| Ga0114994_104205331 | 3300009420 | Marine | ALQFINEMDRLAEVHFAEFGYDTCNQHEKQAVIKLLLHNTK* |
| Ga0114997_101669532 | 3300009425 | Marine | MNALQFINEMDRLAEVHFAEFGYDTCNQHEKQAVIKLLLDNTK* |
| Ga0115005_104019402 | 3300009432 | Marine | MNALQFINEMDRLAEVHFAEFGYDTCNQHEKQAVIKLLLHNLNK* |
| Ga0115008_101078182 | 3300009436 | Marine | MNAIEFINEMDYLAQVHFAEFGYDTCSHSEKKAVIKLLL |
| Ga0115008_110228552 | 3300009436 | Marine | MNALQFINEMDRLAEVHFGEFGYDTCNQHEKQAVIKLLLHNTK* |
| Ga0115008_111251032 | 3300009436 | Marine | MNALQFINEMDRLAQVHFGEFGYDTCDQHEKQAVVKLLLDNLNK* |
| Ga0115571_11094084 | 3300009495 | Pelagic Marine | MNALQFINEMDRLAQVHFAEFGYDTCDQHDKQAVIKLLLDLIANTNKKI* |
| Ga0115003_103763763 | 3300009512 | Marine | MNAIEFTKEMDRLAEVNFGEFGYDTCSQDEKQAVIKLLLHNTK* |
| Ga0114920_112801992 | 3300009528 | Deep Subsurface | MNAIEFVGEMDRLAEVHFGEFGYDTCSYDEKKAVIKLLLHNLKK* |
| Ga0115006_104097164 | 3300009544 | Marine | MNAIEFINEMDYLAQVHFAEFGYDTCSYEEKQAVIKLLLHNTNK* |
| Ga0115002_103719242 | 3300009706 | Marine | MNAIEFTKEMDRLAEVHFAEFGYDTCSHSEKQAVIKLLLHNLNK* |
| Ga0114999_102453543 | 3300009786 | Marine | MNAIEFTNEMDYLAQVHFGEFGYDTCSHSEKQAVIKLLLHNTK* |
| Ga0098049_12196741 | 3300010149 | Marine | NEMDRLAEVHFGEFGYDTCSEDEKKAVIKLLLHNLNK* |
| Ga0114922_104121992 | 3300011118 | Deep Subsurface | MNAEEFVNEMDTIAQNYFGEFGYDTCSSGEKKAVIQLLLHNTK* |
| Ga0114922_112127202 | 3300011118 | Deep Subsurface | MNAIEFLNEMDYLAQVHFGEFGYDTCSYEEKQAVIKLLIHNLNK* |
| Ga0151665_10544971 | 3300011127 | Marine | MNAEEFVNEMDSIARNYFGEFGYDTCSTLEKSAII |
| Ga0151671_10318002 | 3300011253 | Marine | MNAEEFVNEMDSIARNYFGEFGYDTCSTLEKSAIIRLVLRNTK* |
| Ga0151661_10135882 | 3300011261 | Marine | MNAIEFVNEMDRLAEVHFGEFGYDTCSKDEKKAVIKLLLHNLNK* |
| Ga0129327_109177082 | 3300013010 | Freshwater To Marine Saline Gradient | MNAIEFVKEMDRLAEVHFGEFGYDTCSDDEKKAVIKLLLHNLNK* |
| Ga0181412_10102182 | 3300017714 | Seawater | MNAIEFVNEMNHLAEVHFGEFGYDTCSEDEKKAVIKLLLRNLNK |
| Ga0181404_10079093 | 3300017717 | Seawater | MNAIEFVNEMNHLAEVHFGEFGYDTCSEDEKKAVIKLLLHNLNKQ |
| Ga0181398_11524872 | 3300017725 | Seawater | MNAIEFINEMNHLAEVHFGEFGYDTCSEDEKKAVIKLLLNNLNKQ |
| Ga0181401_10400424 | 3300017727 | Seawater | MNAIEFINEMNHLAEVHFGEFGYDTCSEDEKKAVIKLLLHNLNKQ |
| Ga0181431_10593673 | 3300017735 | Seawater | MNAIEFVNEMNRLAEVHFGEFGYDTCSEDEKKAVIKLLLRNLNKQ |
| Ga0181431_10915662 | 3300017735 | Seawater | MNAIEFVNEMNHLAEVHFGEFGYDTCSEDEKKAVIKLLLNNLNK |
| Ga0181409_10114362 | 3300017758 | Seawater | MNAIEFVNEMNRLAEVHFGEFGYDTCSEDEKKAVIKLLLRNLNK |
| Ga0181422_10314076 | 3300017762 | Seawater | MNAIEFVNEMNHLAEVHFGEFGYDTCSEDEKKAVIKLLLRNLNKQ |
| Ga0181423_10881384 | 3300017781 | Seawater | MNAIEFVNEMDRLAEVHFGEFGYDTCSEDEKKAVIKLLLNNLNK |
| Ga0188867_10002361 | 3300018642 | Freshwater Lake | MNAEEFVNEMDMIAQNYFGEFGYDTCSSGEKKAVIQLLLHNTK |
| Ga0192961_100277675 | 3300018980 | Marine | MNAIEFVGEMDRLAEVHFGEFGYDTCSHDEKKAVIKLLLHNLNK |
| Ga0206127_10121305 | 3300020169 | Seawater | MNAEEFVNEMDTIAQNYFGEFGYDTCSTGEKKAVIQLLLHNTK |
| Ga0206124_101237991 | 3300020175 | Seawater | FVNEMDTIAQNYFGEFGYDTCSSGEKKAVIQLLLHNTK |
| Ga0206131_101900241 | 3300020185 | Seawater | MNAEEFVNEMDHLAQVHFAEFGYDTCSSGEKKAVIQLLLHNLNK |
| Ga0206131_103859852 | 3300020185 | Seawater | MNAIEFTKEMDRLAQVHFGEFGYDTCDQHEKQAVVKLLLDNLNK |
| Ga0206130_101058962 | 3300020187 | Seawater | MNAEEFVNEMDYLAQVHFAEFGYDTCSSGEKKAVIQLLLHNLNK |
| Ga0211652_101229532 | 3300020379 | Marine | MNATEFVNEMDRLAEFYFGEFGYDTCSEDEKKAVIKLLLRNLNKQ |
| Ga0211686_101306671 | 3300020382 | Marine | GEMDRLAEVHFGEFGYATCSSDEQKAVIKLLLHNLKND |
| Ga0211677_103654372 | 3300020385 | Marine | MNAIEFVGEMDRLAEVYFGEFGYDTCSHDEKKAVIKLLLHNLNK |
| Ga0206677_100323302 | 3300021085 | Seawater | MNAIEFVNEMNRLAEVHFGEFGYDTCSEDEKKAVIKLLLNNLNK |
| Ga0206683_104221542 | 3300021087 | Seawater | MNATEFVNEMDRLAEFYFGEFGYDTCSEDEKKAVIKLLLHNLNKQ |
| Ga0206682_102541462 | 3300021185 | Seawater | MNAIEFVNEMNHLAEVHFGEFGYDTCSEDEKKAVIKLLLHNLNK |
| Ga0213862_100710232 | 3300021347 | Seawater | MNAIEFIDEMDFIAEREFGEFGYDTCSTREKEAIIRILLENTK |
| Ga0222717_102992631 | 3300021957 | Estuarine Water | MNAEEFINEMDSIAQNYFGEFGYDTCSSGEKKAVIQLLLHNTK |
| Ga0212022_10772951 | 3300022164 | Aqueous | MNAIEFINEMDRLAEVHFGEFGYDTCSKAEKQAVIKLFLHNSVWVFLKVDKN |
| Ga0196903_10268771 | 3300022169 | Aqueous | MNAIEFVKEMDRLAEIHFGEFGYDTCSDDEKKAVIKLLLHNLNK |
| Ga0196901_11536942 | 3300022200 | Aqueous | MNAIEFVKEMDRLAEIHFGEFGYDTCSDDEKKEVIKLLLQNTK |
| (restricted) Ga0233404_100926001 | 3300022913 | Seawater | MNAIEFLNEMDYLAQVHFGEFGYDTCSYEEKQAVIKLLLHNTK |
| (restricted) Ga0233426_102548253 | 3300022920 | Seawater | MNALQFINEMDRLAQVHFAEFGYDTCDQHEKQAVIKLLLDDTK |
| (restricted) Ga0233409_101637502 | 3300022938 | Seawater | MNALQFVNEMDRLAQVHFAEFGYDTCDQHDKQAVIKLLLDNLNK |
| (restricted) Ga0233432_100413526 | 3300023109 | Seawater | MNAIEFVNEMNRLAEVHFGEFGYDTCSEDEKKAVIKLLLHNLNK |
| (restricted) Ga0233412_101982822 | 3300023210 | Seawater | MNAIEFTKEMDRLAEVHFGEFGYDTCSHSEKQAVIKLLLHNTK |
| (restricted) Ga0233412_103088771 | 3300023210 | Seawater | MNALQFINEMDRLAQVHFAEFGYDTCDQHDKQAVIKLLLDNTK |
| (restricted) Ga0255051_103827861 | 3300024057 | Seawater | NMNAEEFVNEMDSIAQFYFGEFGYDTCSSGEKKAVIQLLLKNTK |
| Ga0244777_1000120524 | 3300024343 | Estuarine | MNALQFINEMDRLAQVHFGEFGYDTCDQHDKQAVIKLLLDDTK |
| Ga0244776_105349661 | 3300024348 | Estuarine | MNALQFINEMDRLAQVHFGEFGYDTCDQHDKQAVI |
| Ga0208793_10228004 | 3300025108 | Marine | MNATEFVNEMDRLAEVHFGEFGYDTCSEDEKKAVIKLLLHNLNK |
| Ga0208148_10927181 | 3300025508 | Aqueous | MNAIEFINEMDRLAEVHFGEFGYDTCSQAEKQAVIK |
| Ga0208660_10016941 | 3300025570 | Aqueous | PNDNNMNAIEFINEMDRLAEVHFGEFGYDTCSKAEKQAVIKSLLHNSVWVFLKVDKN |
| Ga0209138_100211912 | 3300025617 | Marine | MNAIEFVKEMDRLAEVHFGEFGYDTCSSEEKKAVIKLLLHNTK |
| Ga0209716_10549021 | 3300025626 | Pelagic Marine | MNALQFINEMDRLAQVHFGEFGYDTCDQHEKQAVVKLLLDNLNK |
| Ga0209716_11865601 | 3300025626 | Pelagic Marine | MNALQFINEMDRLAQVHFAEFGYDTCDQHDKQAVIKLLLDDTK |
| Ga0208643_11498883 | 3300025645 | Aqueous | MNAIEFVKEMDHLAEVHFGEFGYDTCSDDEKKAVIKLLLHNLNK |
| Ga0208160_10067241 | 3300025647 | Aqueous | KEMDRLAEIHFGEFGYDTCSDDEKKAVIKLLLHNLNK |
| Ga0208134_10543562 | 3300025652 | Aqueous | MNAIEFVNEMDRLAEIHFGEFGYDTCSGDEKKAVIKLLLHNLNK |
| Ga0209199_12793101 | 3300025809 | Pelagic Marine | FINEMDRLAQVHFGEFGYDTCSQDEKKAVIKLLLHNTK |
| Ga0209307_11241332 | 3300025832 | Pelagic Marine | MNAEEFVNEMDTIAQNYFGEFGYDTCSTGEKKAVIELLLHNLNK |
| Ga0209603_103177213 | 3300025849 | Pelagic Marine | MNALQFINEMDRLAQVHFAEFGYDTCDQHDKQAVIKLLLDLIANTNKKI |
| Ga0209533_11392261 | 3300025874 | Pelagic Marine | ALQFINEMDRLAQVHFGEFGYDTCDQHDKQAVIKLLLDDTK |
| Ga0208923_10167452 | 3300027320 | Estuarine | MNAEEFVNEMDSIAQNYFGEFGYDTCSSGEKKAIIQLLLHNTK |
| Ga0208133_10267852 | 3300027631 | Estuarine | MNAEEFVNEMDSIAQNYFGEFGYDTCSSGEKKAVIQLLLHNTK |
| Ga0209383_11501921 | 3300027672 | Marine | INMNAIEFVGEMDRLAEVHFGEFGYDTCSSDEQKAVIKLLLHNLKK |
| Ga0209502_100030771 | 3300027780 | Marine | MNALQFINEMDRLAEVHFAEFGYDTCNQHEKQAVIKLLLH |
| Ga0209502_104222381 | 3300027780 | Marine | NMNALQFINEMDRLAEVHFAEFGYDTCNQHEKQAVIKLLLHNTK |
| Ga0209711_101739642 | 3300027788 | Marine | MNALQFINEMDRLAEVHFAEFGYDTCNQHEKQAVIKLLLHNLNK |
| Ga0209711_103225582 | 3300027788 | Marine | MNAIEFINEMDYLAQVHFAEFGYDTCSHSEKQAVIKLLLHNTK |
| Ga0209273_102016602 | 3300027790 | Marine Sediment | MNALQFINEMDRLAQVHFGEFGYDTCDQHEKQAVIKLLLDDTK |
| Ga0209302_101400162 | 3300027810 | Marine | MNAIEFINEMDRLAEVHFGEFGYDTCSHSEKQAVIKLLLHNTK |
| Ga0209578_102601113 | 3300027820 | Marine Sediment | MNALQFINEMDRLAEVHFGEFGYDTCSQDEKKAVIKLLLHNTK |
| Ga0209092_100471801 | 3300027833 | Marine | MNAIEFINEMDRLAEVHFGEFGYDTCSQDEKKAVIKLLLHNTK |
| Ga0209089_104830603 | 3300027838 | Marine | MNAIEFINEMDRLAEVHFAEFGYDTCNQHEKQAVIKLLLHNLNK |
| Ga0209403_101667203 | 3300027839 | Marine | MNAIEFTKEMDRLAEVHFAEFGYDTCNQHEKQAVIKLLLHNLNK |
| Ga0209712_1004623211 | 3300027849 | Marine | MNAIEFTNEMDRLAEVHFAEFGYDTCSHSEKQAVIKLLLHNTK |
| Ga0209013_100320465 | 3300027858 | Marine | MNAIEFINEMNHLAEVHFGEFGYDTCSEDEKKAVIKLLLNNLNK |
| (restricted) Ga0233415_100869695 | 3300027861 | Seawater | MNAIEFLNEMDYLAQVHFGEFGYDTCSYEEKQAVIKLLLHNLNK |
| (restricted) Ga0255052_103225992 | 3300027865 | Seawater | MDRLAQVHFAEFGYDTCDQHDKQAVIKLLLDNLNK |
| Ga0209713_100004653 | 3300027883 | Marine | MNAIEFINEMDYLAQVHFAEFGYDTCSYEEKQAVIKLLLHNTNK |
| Ga0209272_102582761 | 3300027967 | Marine Sediment | NMNAIEFTKEMDRLAQVHFAEFGYDTCSQDEKQAVIKLLLHNTK |
| Ga0209165_100227826 | 3300027978 | Marine Sediment | MNALQFINEMDRLAQVHFAEFGYDTCDQHEKQAVIKLLLDNTK |
| Ga0209475_102035362 | 3300027980 | Marine Sediment | MNAIEFTKEMDRLAQVHFAEFGYDTCSQDEKQAVIKLLLHNTK |
| Ga0256368_10391874 | 3300028125 | Sea-Ice Brine | MNAIEFINEMDRLAQVHFAEFGYDTCSQDEKKAVIKLLLHNTK |
| Ga0265306_101314872 | 3300028598 | Sediment | MNAEEFVNEMDTIAQNYFGEFGYDTCSSGEKKAVIQLLLHNTK |
| Ga0308021_100086051 | 3300031141 | Marine | MNAIEFVGEMDRLAEVHFGEFGYATCSSDEQKAVI |
| Ga0308025_10621924 | 3300031143 | Marine | MNAIEFVNEMDYLAFVHFGEFGYSTCSGDEQKAVIKLLLHNLKN |
| Ga0308023_10809012 | 3300031167 | Marine | NEMDYLAQVHFGEFGYDTCSHDEKQAVIKLLLHNLKK |
| Ga0307488_100802292 | 3300031519 | Sackhole Brine | MNAEEFVNEMDHLAQVHFAEFGYDTCSSGEKKAIIQLLLHNTK |
| Ga0307488_101708822 | 3300031519 | Sackhole Brine | MNAIEFINEMDYLAQVHFAEFGYDTCNHSEKQAVIKLLLHNLNK |
| Ga0307488_104283282 | 3300031519 | Sackhole Brine | MNAIEFLNEMDSIAQVHFGEFGYDTCSYEEKQAVIKLLLHNTK |
| Ga0307488_105087271 | 3300031519 | Sackhole Brine | MNALQFIKEMDRLAEVHFAEFGYDTCNQHEKQAVIKLLLHNTK |
| Ga0307380_107820182 | 3300031539 | Soil | MNAIEFVNEMDRLAEVHFGEFGYDTCSEDEKKAVIKLLLHNLNK |
| Ga0307378_100510113 | 3300031566 | Soil | MNAIEFVNEMDRLAEVHFGEFGYDTCSEDEKKAVIKLLLHNLNKXMSYNTK |
| Ga0307489_114079532 | 3300031569 | Sackhole Brine | MNAIEFVKEMDRLAEVHFGEFGYDTCSYEEKQAVIKLL |
| Ga0307996_11164602 | 3300031589 | Marine | MNAIEFVGEMDRLAEVHFGEFGYATCSSDEQKAVIKLLLHNLKK |
| Ga0307992_12015033 | 3300031601 | Marine | MNAIEFVGEMDRLAEVHFGEFGYATCSSDEQKVVIK |
| Ga0307993_10042381 | 3300031602 | Marine | MNALQFTKEMDRLAEVHFGEFGYDTCNQHEKQAVIKLLLNNLKK |
| Ga0307993_10118774 | 3300031602 | Marine | MNAIEFVGEMDRLAEVHFGEFGYDTCSSDEKKAVIKLLLHNLKND |
| Ga0307993_10837942 | 3300031602 | Marine | MNAIEFVGEMNRLAEVHFGEFGYDTCSSDEQKAVIKLLLHNLK |
| Ga0307993_10853694 | 3300031602 | Marine | NEMDYLAQVHFGEFGYDTCSHDEKKAVITLLLHNMQKNKV |
| Ga0307999_10361253 | 3300031608 | Marine | MNAIEFVNEMDYLAFVHFGEFGYATCSSDEQKAVIKLLLHNLKK |
| Ga0307985_101224301 | 3300031629 | Marine | MNAIEFVNEMDYLAQVHFGEFGYDTCSHDEKKVVIKLLLHNLKND |
| Ga0307985_101535562 | 3300031629 | Marine | MNAIEFVGEMDRLAEVHFGEFGYDTCSSDEQKAVIK |
| Ga0308012_104435161 | 3300031647 | Marine | SHSTKIINMNAIEFVNEMDYLAQVHFGEFGYDTCSHDEKQAVIKLLLHNLKK |
| Ga0307984_11472033 | 3300031658 | Marine | MNAIEFVNEMDYLAQVHFGEFGYDTCSHDEKKVVIKLLLHNLKK |
| Ga0308011_100237111 | 3300031688 | Marine | VGEMDRLAEVHFGEFGYATCSSDEQKAVIKLLLHNLKK |
| Ga0308011_101824591 | 3300031688 | Marine | EFVGEMDRLAEVHFGEFGYATCSSDEQKAVIKLLLHNLKK |
| Ga0308017_10489272 | 3300031689 | Marine | MNAIEFVNEMDYLAFVHFGEFGYSTCSGDEQKAVIKLLLHNLKK |
| Ga0308016_102502611 | 3300031695 | Marine | INMNAIEFVGEMDRLAEVHFGEFGYATCSSDEQKVVIKLLLHNLKK |
| Ga0307995_10449513 | 3300031696 | Marine | MNAIEFVGEMDRLAEVHFGEFGYDTCSSDEQKAVIKLLLHNLKK |
| Ga0307995_13063391 | 3300031696 | Marine | AIEFVGEMDRLAEVHFGEFGYATCSSDEQKAVIKLLLHNLKK |
| Ga0307998_11747871 | 3300031702 | Marine | MNAIEFVGEMDRLAEVHFGEFGYATCSSDEQKAVIK |
| Ga0308013_102567221 | 3300031721 | Marine | MNAIEFVGEMNRLAEVHFGEFGYATCSSDEQKVVIKLLL |
| Ga0315322_106753663 | 3300031766 | Seawater | MNAIEFINEMNHLAEVHFGEFGYDTCSEDEKKAVIKLLLHNLNK |
| Ga0316203_10459232 | 3300032274 | Microbial Mat | MNAIEFINEMDYLAQVHFAEFGYDTCSYEEKQAVIKLLLHNTK |
| Ga0314858_168953_315_449 | 3300033742 | Sea-Ice Brine | MNALQFINEMDRLAEVHFAEFGYDTCDQHEKQAVVKLLLDNLNK |
| ⦗Top⦘ |