| Basic Information | |
|---|---|
| Family ID | F031184 |
| Family Type | Metagenome |
| Number of Sequences | 183 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MADLPKLDVVIGNNFGHLPMFIGAEKGFFKRHGVDAKMLVVDTG |
| Number of Associated Samples | 157 |
| Number of Associated Scaffolds | 183 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.91 % |
| % of genes from short scaffolds (< 2000 bps) | 95.63 % |
| Associated GOLD sequencing projects | 152 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.016 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.300 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.858 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.448 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.50% β-sheet: 22.22% Coil/Unstructured: 65.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 183 Family Scaffolds |
|---|---|---|
| PF02826 | 2-Hacid_dh_C | 46.45 |
| PF01717 | Meth_synt_2 | 18.58 |
| PF09084 | NMT1 | 2.19 |
| PF00391 | PEP-utilizers | 2.19 |
| PF06904 | Extensin-like_C | 1.64 |
| PF03480 | DctP | 1.64 |
| PF07681 | DoxX | 1.09 |
| PF00903 | Glyoxalase | 1.09 |
| PF14833 | NAD_binding_11 | 1.09 |
| PF01326 | PPDK_N | 0.55 |
| PF12200 | DUF3597 | 0.55 |
| PF13505 | OMP_b-brl | 0.55 |
| PF16884 | ADH_N_2 | 0.55 |
| PF02894 | GFO_IDH_MocA_C | 0.55 |
| PF02735 | Ku | 0.55 |
| PF01053 | Cys_Met_Meta_PP | 0.55 |
| PF12973 | Cupin_7 | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 183 Family Scaffolds |
|---|---|---|---|
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 18.58 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 2.19 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 2.19 |
| COG3921 | Uncharacterized conserved protein, contains Extensin-like_C domain | Function unknown [S] | 1.64 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 1.09 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 1.09 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 0.55 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.55 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.55 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.55 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.55 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.55 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.55 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.55 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.55 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.55 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.55 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.55 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.02 % |
| Unclassified | root | N/A | 40.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908028|beta3_all_NODE_73373_len_2712_cov_15_300147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2762 | Open in IMG/M |
| 3300000715|JGI12409J11926_101166 | Not Available | 1063 | Open in IMG/M |
| 3300000956|JGI10216J12902_125663827 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300001414|JGI20174J14864_1005102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 723 | Open in IMG/M |
| 3300002074|JGI24748J21848_1029182 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300002914|JGI25617J43924_10058029 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300004024|Ga0055436_10159832 | Not Available | 691 | Open in IMG/M |
| 3300004480|Ga0062592_101107696 | Not Available | 733 | Open in IMG/M |
| 3300005174|Ga0066680_10233274 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300005218|Ga0068996_10027237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 978 | Open in IMG/M |
| 3300005330|Ga0070690_100625710 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300005332|Ga0066388_105873711 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300005344|Ga0070661_101176841 | Not Available | 641 | Open in IMG/M |
| 3300005455|Ga0070663_100211245 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
| 3300005471|Ga0070698_101380639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300005536|Ga0070697_101002123 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 743 | Open in IMG/M |
| 3300005548|Ga0070665_100473110 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300005554|Ga0066661_10713926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
| 3300005713|Ga0066905_101118007 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300005713|Ga0066905_101373558 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300005713|Ga0066905_102185189 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005713|Ga0066905_102188286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300005764|Ga0066903_106512584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
| 3300005764|Ga0066903_106716510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
| 3300005937|Ga0081455_10589664 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300006175|Ga0070712_100534985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 986 | Open in IMG/M |
| 3300009089|Ga0099828_11204341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
| 3300009444|Ga0114945_10400295 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 819 | Open in IMG/M |
| 3300009649|Ga0105855_1117702 | Not Available | 755 | Open in IMG/M |
| 3300009660|Ga0105854_1323654 | Not Available | 544 | Open in IMG/M |
| 3300009662|Ga0105856_1204918 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
| 3300009691|Ga0114944_1225687 | Not Available | 754 | Open in IMG/M |
| 3300009792|Ga0126374_10630826 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300009826|Ga0123355_10503314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 1493 | Open in IMG/M |
| 3300009839|Ga0116223_10271999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1017 | Open in IMG/M |
| 3300010043|Ga0126380_10075153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1934 | Open in IMG/M |
| 3300010043|Ga0126380_12027663 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300010046|Ga0126384_10234402 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1474 | Open in IMG/M |
| 3300010046|Ga0126384_11645192 | Not Available | 606 | Open in IMG/M |
| 3300010047|Ga0126382_11790194 | Not Available | 577 | Open in IMG/M |
| 3300010162|Ga0131853_11009803 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300010358|Ga0126370_11643577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300010359|Ga0126376_10977675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 844 | Open in IMG/M |
| 3300010359|Ga0126376_12978947 | Not Available | 523 | Open in IMG/M |
| 3300010360|Ga0126372_10136320 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1931 | Open in IMG/M |
| 3300010360|Ga0126372_13089639 | Not Available | 517 | Open in IMG/M |
| 3300010361|Ga0126378_10407899 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1472 | Open in IMG/M |
| 3300010361|Ga0126378_11383308 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300010361|Ga0126378_12997494 | Not Available | 538 | Open in IMG/M |
| 3300010373|Ga0134128_12750106 | Not Available | 542 | Open in IMG/M |
| 3300010375|Ga0105239_11496966 | Not Available | 780 | Open in IMG/M |
| 3300010375|Ga0105239_13353223 | Not Available | 521 | Open in IMG/M |
| 3300010376|Ga0126381_100119387 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3409 | Open in IMG/M |
| 3300010376|Ga0126381_102611411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 723 | Open in IMG/M |
| 3300010396|Ga0134126_10648609 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1204 | Open in IMG/M |
| 3300010396|Ga0134126_11778399 | Not Available | 676 | Open in IMG/M |
| 3300010399|Ga0134127_11705638 | Not Available | 705 | Open in IMG/M |
| 3300010400|Ga0134122_12834969 | Not Available | 538 | Open in IMG/M |
| 3300010863|Ga0124850_1049496 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300011269|Ga0137392_10094587 | All Organisms → cellular organisms → Bacteria | 2344 | Open in IMG/M |
| 3300012189|Ga0137388_11357766 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300012199|Ga0137383_11295079 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012211|Ga0137377_10210756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1866 | Open in IMG/M |
| 3300012361|Ga0137360_11191003 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300012362|Ga0137361_10102942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2487 | Open in IMG/M |
| 3300012362|Ga0137361_11781329 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300012495|Ga0157323_1029516 | Not Available | 574 | Open in IMG/M |
| 3300012925|Ga0137419_10188063 | Not Available | 1520 | Open in IMG/M |
| 3300012944|Ga0137410_11634012 | Not Available | 565 | Open in IMG/M |
| 3300012957|Ga0164303_10086692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1510 | Open in IMG/M |
| 3300012958|Ga0164299_11401711 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300012986|Ga0164304_10336011 | Not Available | 1050 | Open in IMG/M |
| 3300013307|Ga0157372_10483423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1444 | Open in IMG/M |
| 3300013770|Ga0120123_1049099 | Not Available | 904 | Open in IMG/M |
| 3300014158|Ga0181521_10266820 | Not Available | 895 | Open in IMG/M |
| 3300014269|Ga0075302_1059219 | Not Available | 789 | Open in IMG/M |
| 3300015373|Ga0132257_101055962 | Not Available | 1024 | Open in IMG/M |
| 3300016270|Ga0182036_11499208 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300016341|Ga0182035_11525167 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300016422|Ga0182039_11218433 | Not Available | 680 | Open in IMG/M |
| 3300016422|Ga0182039_11871338 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300017966|Ga0187776_10321971 | Not Available | 1012 | Open in IMG/M |
| 3300017966|Ga0187776_11351652 | Not Available | 541 | Open in IMG/M |
| 3300017970|Ga0187783_10346174 | Not Available | 1082 | Open in IMG/M |
| 3300017974|Ga0187777_11271664 | Not Available | 540 | Open in IMG/M |
| 3300017975|Ga0187782_10897818 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
| 3300017975|Ga0187782_11086467 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300017975|Ga0187782_11190352 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300018032|Ga0187788_10148437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 882 | Open in IMG/M |
| 3300018062|Ga0187784_10581684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 900 | Open in IMG/M |
| 3300018063|Ga0184637_10574029 | Not Available | 644 | Open in IMG/M |
| 3300018081|Ga0184625_10469595 | Not Available | 641 | Open in IMG/M |
| 3300018085|Ga0187772_11439156 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300018086|Ga0187769_10260503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1291 | Open in IMG/M |
| 3300019487|Ga0187893_10947288 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300019786|Ga0182025_1256608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1706 | Open in IMG/M |
| 3300020150|Ga0187768_1130464 | Not Available | 578 | Open in IMG/M |
| 3300021374|Ga0213881_10073508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1462 | Open in IMG/M |
| 3300021420|Ga0210394_11814193 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300021439|Ga0213879_10138108 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300021474|Ga0210390_11148016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300021476|Ga0187846_10415786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300021478|Ga0210402_10541324 | Not Available | 1081 | Open in IMG/M |
| 3300022563|Ga0212128_10418409 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 828 | Open in IMG/M |
| 3300024288|Ga0179589_10325080 | Not Available | 695 | Open in IMG/M |
| 3300025146|Ga0209322_10395811 | Not Available | 533 | Open in IMG/M |
| 3300025174|Ga0209324_10834831 | Not Available | 505 | Open in IMG/M |
| 3300025313|Ga0209431_10271034 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1333 | Open in IMG/M |
| 3300025325|Ga0209341_11139250 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300025327|Ga0209751_10483943 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1014 | Open in IMG/M |
| 3300025327|Ga0209751_10904300 | Not Available | 677 | Open in IMG/M |
| 3300025495|Ga0207932_1118142 | Not Available | 507 | Open in IMG/M |
| 3300025878|Ga0209584_10253844 | Not Available | 674 | Open in IMG/M |
| 3300025910|Ga0207684_10025648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5023 | Open in IMG/M |
| 3300025914|Ga0207671_10268874 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1343 | Open in IMG/M |
| 3300025922|Ga0207646_11718866 | Not Available | 538 | Open in IMG/M |
| 3300026320|Ga0209131_1243268 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300026551|Ga0209648_10559669 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300026759|Ga0207527_103550 | Not Available | 569 | Open in IMG/M |
| 3300026771|Ga0207552_101481 | Not Available | 811 | Open in IMG/M |
| 3300026853|Ga0207443_1006123 | Not Available | 641 | Open in IMG/M |
| 3300026881|Ga0207739_1001916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. UYPR1.413 | 2628 | Open in IMG/M |
| 3300026952|Ga0207434_1020922 | Not Available | 547 | Open in IMG/M |
| 3300027446|Ga0207562_1009909 | Not Available | 515 | Open in IMG/M |
| 3300027853|Ga0209274_10700041 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300027875|Ga0209283_10311075 | Not Available | 1038 | Open in IMG/M |
| 3300027875|Ga0209283_10645457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
| 3300027915|Ga0209069_10061023 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
| 3300027915|Ga0209069_10666821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
| 3300028381|Ga0268264_10328186 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1449 | Open in IMG/M |
| 3300028718|Ga0307307_10048049 | Not Available | 1245 | Open in IMG/M |
| 3300028755|Ga0307316_10306915 | Not Available | 581 | Open in IMG/M |
| 3300028787|Ga0307323_10129084 | Not Available | 910 | Open in IMG/M |
| 3300028792|Ga0307504_10324916 | Not Available | 586 | Open in IMG/M |
| 3300028802|Ga0307503_10424610 | Not Available | 700 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10197281 | Not Available | 562 | Open in IMG/M |
| 3300031226|Ga0307497_10013220 | All Organisms → cellular organisms → Bacteria | 2396 | Open in IMG/M |
| 3300031538|Ga0310888_10513233 | Not Available | 718 | Open in IMG/M |
| 3300031544|Ga0318534_10161771 | Not Available | 1293 | Open in IMG/M |
| 3300031547|Ga0310887_10919513 | Not Available | 555 | Open in IMG/M |
| 3300031561|Ga0318528_10319560 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300031561|Ga0318528_10663869 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300031572|Ga0318515_10522997 | Not Available | 633 | Open in IMG/M |
| 3300031573|Ga0310915_10497086 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300031679|Ga0318561_10551768 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300031681|Ga0318572_10497167 | Not Available | 727 | Open in IMG/M |
| 3300031682|Ga0318560_10261593 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300031719|Ga0306917_11126687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300031765|Ga0318554_10680678 | Not Available | 578 | Open in IMG/M |
| 3300031770|Ga0318521_10419802 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300031780|Ga0318508_1081867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 884 | Open in IMG/M |
| 3300031821|Ga0318567_10437910 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300031859|Ga0318527_10089058 | Not Available | 1256 | Open in IMG/M |
| 3300031859|Ga0318527_10377326 | Not Available | 604 | Open in IMG/M |
| 3300031860|Ga0318495_10221856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 849 | Open in IMG/M |
| 3300031890|Ga0306925_11768681 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300031897|Ga0318520_10941645 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300031942|Ga0310916_10760755 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300031946|Ga0310910_10736037 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300031947|Ga0310909_11347556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
| 3300031947|Ga0310909_11478978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
| 3300031949|Ga0214473_10077611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3886 | Open in IMG/M |
| 3300031981|Ga0318531_10382966 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300032025|Ga0318507_10336858 | Not Available | 657 | Open in IMG/M |
| 3300032035|Ga0310911_10114934 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1489 | Open in IMG/M |
| 3300032059|Ga0318533_10576477 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300032061|Ga0315540_10376295 | Not Available | 573 | Open in IMG/M |
| 3300032076|Ga0306924_12162777 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 568 | Open in IMG/M |
| 3300032205|Ga0307472_101227847 | Not Available | 717 | Open in IMG/M |
| 3300032261|Ga0306920_102890192 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300032516|Ga0315273_11175218 | Not Available | 968 | Open in IMG/M |
| 3300032770|Ga0335085_11222216 | Not Available | 797 | Open in IMG/M |
| 3300032770|Ga0335085_11495987 | Not Available | 703 | Open in IMG/M |
| 3300032783|Ga0335079_11607025 | Not Available | 638 | Open in IMG/M |
| 3300032783|Ga0335079_12306613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300032897|Ga0335071_11669843 | Not Available | 581 | Open in IMG/M |
| 3300033289|Ga0310914_11263280 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300033433|Ga0326726_10666472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48 | 1003 | Open in IMG/M |
| 3300033513|Ga0316628_102846001 | Not Available | 635 | Open in IMG/M |
| 3300033810|Ga0314872_022213 | Not Available | 568 | Open in IMG/M |
| 3300034090|Ga0326723_0305873 | Not Available | 714 | Open in IMG/M |
| 3300034195|Ga0370501_0352348 | Not Available | 535 | Open in IMG/M |
| 3300034817|Ga0373948_0101066 | Not Available | 679 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.30% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.74% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.10% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.28% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.28% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.19% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.64% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.64% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.64% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.09% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.09% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.09% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.09% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 1.09% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.09% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.55% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.55% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.55% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.55% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.55% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.55% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.55% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.55% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.55% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.55% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.55% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.55% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.55% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.55% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.55% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.55% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.55% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908028 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 3300000715 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 73 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001414 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 | Environmental | Open in IMG/M |
| 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Host-Associated | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
| 3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025146 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1 | Environmental | Open in IMG/M |
| 3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026759 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026771 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A4-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026853 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A5w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026881 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 15 (SPAdes) | Environmental | Open in IMG/M |
| 3300026952 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A2-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027446 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A2a-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033810 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_E | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| beta3_all_01224050 | 2124908028 | Soil | MADLPKLDVVIGNNFGHLPMFIGAEKGFFKKHGVDAKMLVV |
| JGI12409J11926_1011661 | 3300000715 | Tropical Forest Soil | MADLPKIDVVIGNNFGHLPMFIGAEKGYFKRHGVDAKM |
| JGI10216J12902_1256638271 | 3300000956 | Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKVVDTGTDMVNAMHNGEA |
| JGI20174J14864_10051021 | 3300001414 | Arctic Peat Soil | MAELPKLDVVIGNNFGHLPMFIGAEKGFFKKHGVDAKMLVVDTGTD |
| JGI24748J21848_10291821 | 3300002074 | Corn, Switchgrass And Miscanthus Rhizosphere | MADLPKLNVVIANNFGHLPMFVGAERGFFKTQGVDASFRVVDTGTDMVNAL |
| JGI25617J43924_100580291 | 3300002914 | Grasslands Soil | MNGGSRELPRLDVVIGNNFGHLPMFVGAEKGTFKRHGIDAHMKVVDTGTDMVNAM |
| Ga0055436_101598321 | 3300004024 | Natural And Restored Wetlands | MADLPRLDVVIGNNFGHLPMFIGAEKDFFAKHGVDAKMLVVDT |
| Ga0062592_1011076961 | 3300004480 | Soil | MALPKLNVVIANNFGHLPMFIGAEKGFFKQQGVDASFRVV |
| Ga0066680_102332741 | 3300005174 | Soil | MNAGSEQLPRLDVVIGNNFGHLPMFVGAEKGIFKRHGIDAHMKVVDTGT |
| Ga0068996_100272372 | 3300005218 | Natural And Restored Wetlands | MALPKLNVVIANNFGHLPMFIGAEKGFFKAQGVDASFRVVDTGTDMV |
| Ga0070690_1006257102 | 3300005330 | Switchgrass Rhizosphere | MADLPRLDVVIGNNFGHLPMFIGAEKGFFAKHGVDAKMLVVDT |
| Ga0066388_1058737112 | 3300005332 | Tropical Forest Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKVVDT |
| Ga0070661_1011768412 | 3300005344 | Corn Rhizosphere | MSAAGVREGKIALPKLDVVIANNFGHLPMFIGAEKGFFKQQGVDA |
| Ga0070663_1002112453 | 3300005455 | Corn Rhizosphere | MADLPKLNVVIANNFGHLPMFVGAEKGFFKAQGVDASFRVVDTGT |
| Ga0070698_1013806392 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VMADLPKLNVVIANNFGHLPMFVGAEKGFFKRHGVDASFRV |
| Ga0070697_1010021231 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAGSGQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKVVDTGTDMVNAMHNGE |
| Ga0070665_1004731101 | 3300005548 | Switchgrass Rhizosphere | MALPKLDVVIANNFGHLPMFIGAEKGFFKQQGVDA |
| Ga0066661_107139262 | 3300005554 | Soil | MNAGSGQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKVVDTGTDMVNAMHNG |
| Ga0066905_1011180072 | 3300005713 | Tropical Forest Soil | MADLPRLDVVIGNNFGHLPMFIGAEKGFFRKHGVDAKMLVVD |
| Ga0066905_1013735582 | 3300005713 | Tropical Forest Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKVVDTG |
| Ga0066905_1021851892 | 3300005713 | Tropical Forest Soil | MADLPKLDVVIGNNFGHLPMFIGAEKGFFRKHGVDAKMLVV |
| Ga0066905_1021882862 | 3300005713 | Tropical Forest Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGAEKAIFKNHGIDAHMKVVDTGTDMVNAMHNGEAQIGDMSVTTFLKAVHSGE |
| Ga0066903_1065125843 | 3300005764 | Tropical Forest Soil | MNGGSAQLSRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKVVDTGTDMVNAMHNGE |
| Ga0066903_1067165102 | 3300005764 | Tropical Forest Soil | MNAGSGQLPRLDVVIGNNFGHLPMFVGAEKDIFKNHGIDAHMKVVDTGTDMVNAMHNGEAQIGDMSVTTF |
| Ga0081455_105896641 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MADLPKLDVVIGNNFGHLPMFIGAEKGFFRKHGVDAKMLVVDTGTDM |
| Ga0070712_1005349851 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MALPKLDVVIANNFGHLPMFIGAEKGFFKQHGVDASFRVVDTGTDMVNA |
| Ga0099828_112043412 | 3300009089 | Vadose Zone Soil | MNAGSRELPRLDVVIGNNFGHLPMFVGAEKGIFKRHGIDAHMKVVDTGTDMVNAMHNGEAQI |
| Ga0114945_104002951 | 3300009444 | Thermal Springs | MSTGSNPQLPRLDVVIGNNFGHLPMFIGAEKGIFEKHGVDARMKVVDTGTD |
| Ga0105855_11177022 | 3300009649 | Permafrost Soil | MAELPKLDVVIGNNFGHLPMFIGAEKGFFKKHGVDAKMLVVDTGTDMV |
| Ga0105854_13236542 | 3300009660 | Permafrost Soil | MAELPKLDVVIANNFGHLPMFIGAEKGFFKQHGVDASFKVVDTGTD |
| Ga0105856_12049181 | 3300009662 | Permafrost Soil | MADLPRLDVVIGNNFGHLPMFIGAEKGFFKKHGVD |
| Ga0114944_12256872 | 3300009691 | Thermal Springs | MSTGSNPQLPRLDVVIGNNFGHLPMFIGAEKGIFEKHGVDARMKVVDTGTDMVNTMH |
| Ga0126374_106308261 | 3300009792 | Tropical Forest Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHCRDAHMKVVDTGTDMVNAMHNGEA |
| Ga0123355_105033143 | 3300009826 | Termite Gut | MNAARGALPRLDVVIGNNFGHLPMFVGAEKGFFEQHG |
| Ga0116223_102719992 | 3300009839 | Peatlands Soil | MADLPKLDVVIGNNFGHLPMFIGAEKGCFVKHGVDAKMLVVDTGTDMV |
| Ga0126380_100751532 | 3300010043 | Tropical Forest Soil | MNAGSGQLQRLDVVIGNNFGHLPMFIGAEKGIFQRHGIDARMKVVD |
| Ga0126380_120276632 | 3300010043 | Tropical Forest Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGID |
| Ga0126384_102344021 | 3300010046 | Tropical Forest Soil | MNAGSEQLPRLDVVIGNNFGHLPMFVGAEKGIFKNH |
| Ga0126384_116451922 | 3300010046 | Tropical Forest Soil | MADLPKLDVVIGNNFGHLPMFIGAEKGFFRKHGVDAKMLVVDTGTDMVN |
| Ga0126382_117901941 | 3300010047 | Tropical Forest Soil | MAGLPKLDVVIGNNFGHLPMFIGAEKGFFRKHGVDAKMLVVDT |
| Ga0131853_110098031 | 3300010162 | Termite Gut | MNAGSGQLSRLDVVIGNNFGHLPMFVGAEKGIFRKHG |
| Ga0126370_116435772 | 3300010358 | Tropical Forest Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAH |
| Ga0126376_109776753 | 3300010359 | Tropical Forest Soil | MSLSGVARGPLPRLDVVIGNNFGHLPMFVGTEKGIFKKHGIDAHMKVVDTG |
| Ga0126376_129789472 | 3300010359 | Tropical Forest Soil | MADLAKLNVVIANNFGHLPMFIGAEKGYFKQHGVD |
| Ga0126372_101363203 | 3300010360 | Tropical Forest Soil | MNAGSGRLPRLDVVIGNNFGHLPMFVGAEKGIFKNH |
| Ga0126372_130896391 | 3300010360 | Tropical Forest Soil | MADLPKLDVVIGNNFGHLPMFIGAEKGFFRKHGVDAKMLV |
| Ga0126378_104078992 | 3300010361 | Tropical Forest Soil | MNAGSGQLQRLDVVIGNNFGHLPMFIGAEKGIFQRHGIDARMK |
| Ga0126378_113833081 | 3300010361 | Tropical Forest Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDARMKVVDT |
| Ga0126378_129974941 | 3300010361 | Tropical Forest Soil | MADLPKLDVVIGNNFGHLPMFIGAEKGFFKKHGVD |
| Ga0134128_127501061 | 3300010373 | Terrestrial Soil | MALPKLDVVIANNFGHLPMFIGAEKGFFKQHGVDASFRVVD |
| Ga0105239_114969662 | 3300010375 | Corn Rhizosphere | MADLPKLNVVIANNFGHLPMFIGAEKGFFKNHGVDASFRVVDTG |
| Ga0105239_133532232 | 3300010375 | Corn Rhizosphere | MADLPRLDVVIGNNFGHLPMFIGAEKGFFAKHGVDAKMLVVDTGTDMV |
| Ga0126381_1001193874 | 3300010376 | Tropical Forest Soil | MNSGSGQLSRLDVVIGNNFGHLPMFVGAEKGIFEKHGIEAHMKVVDTG |
| Ga0126381_1026114112 | 3300010376 | Tropical Forest Soil | MNAGSGRLQKLDVVIANNFGHLPMFVGAEKGIFKNHGIDAHMKVVDT |
| Ga0134126_106486092 | 3300010396 | Terrestrial Soil | MADLPKLNVVIANNFGHLPMFVGAERGFFKTQGVDASFRVVDTG |
| Ga0134126_117783991 | 3300010396 | Terrestrial Soil | MADLPKLDVVIANNFGHLPMFVGAEKGFFKNHGVDASFRVVDTGTDM |
| Ga0134127_117056381 | 3300010399 | Terrestrial Soil | MADLPKLNVVIANNFGHLPMFVGAERGFFKTQGVDASFRV |
| Ga0134122_128349692 | 3300010400 | Terrestrial Soil | MALPKLDVVIANNFGHLPMFIGAEKGFFKQQGVDASFKVVDTGTDMV |
| Ga0124850_10494961 | 3300010863 | Tropical Forest Soil | MNAGSGQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKVVEPT* |
| Ga0137392_100945871 | 3300011269 | Vadose Zone Soil | MNAGSGQLPRLDVVIGNNFGHLPMFVGAEKGIFKRH |
| Ga0137388_113577661 | 3300012189 | Vadose Zone Soil | MNAGSGQLPRLDVVIGNNFGHLPMFVGAEKGIFKRHGIDTRMKVVDTGTDMVNAMHNGEA |
| Ga0137383_112950791 | 3300012199 | Vadose Zone Soil | MNAGSGQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKVVDTGTDMVNAMHNGEAQI |
| Ga0137377_102107563 | 3300012211 | Vadose Zone Soil | MNAGSGQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKVVDTGT |
| Ga0137360_111910031 | 3300012361 | Vadose Zone Soil | MNAASAQLPRLDVVIGNNFGHLPMFVGAEKGIFKRHGIDAHMKV |
| Ga0137361_101029421 | 3300012362 | Vadose Zone Soil | MNAGSRELPRLDVVIGNNFGHLPMFVGAEKGIFEKH |
| Ga0137361_117813291 | 3300012362 | Vadose Zone Soil | MNARSGELPRLDVVIGNNFGHLPMFVGAEKGIFKRHGIDAHMKVVDTGTDMVNAMHNGE |
| Ga0157323_10295161 | 3300012495 | Arabidopsis Rhizosphere | MADLPKLNVVIANNFGHLPMFVGAEKGFFKRHGVDASFR |
| Ga0137419_101880632 | 3300012925 | Vadose Zone Soil | MNAGSGQLPRLDVVIGNNFGHLPMFVGAEKGIFKR |
| Ga0137410_116340121 | 3300012944 | Vadose Zone Soil | MADLPKLDVVIGNNFGHLPMFIGAEKGFFKRHGVDAKMLVVDTG |
| Ga0164303_100866921 | 3300012957 | Soil | MADLPKLDVVIGNNFGHLPMFIGAEKGFFAKHGVDARMLVVDTGTDM |
| Ga0164299_114017111 | 3300012958 | Soil | MNAGSGQLPRLDVVIGNNFGHLPMFVGAEKGIFQNHGIDAQLKVVDTGTDM |
| Ga0164304_103360111 | 3300012986 | Soil | MADLPRLDVVIGNNFGHLPMFIGAEKGFFAKHGVDAKML |
| Ga0157372_104834233 | 3300013307 | Corn Rhizosphere | MADLPKLNVVIANNFGHLPMFVGAEKGFFKAHGVDASFRVV |
| Ga0120123_10490991 | 3300013770 | Permafrost | MAELPKLDVVIGNNFGHLPMFIGAEKGYFKQHGVNAKMLVVDTGTVMVN |
| Ga0181521_102668201 | 3300014158 | Bog | MATGSGSLPRLDVVIGNNFGHLPMFVGAEKGFFAKHGVD |
| Ga0075302_10592191 | 3300014269 | Natural And Restored Wetlands | MADLPKLDVVIANNFGHLPMFIGAEKGYFKQHGVDASFRVVDTGTDM |
| Ga0132257_1010559622 | 3300015373 | Arabidopsis Rhizosphere | MSPAGVREGKMALPKLDVVIANNFGHLPMIIGAEKGFFKQQGVDASFKVVDTGTDMVNAL |
| Ga0182036_114992081 | 3300016270 | Soil | MNAGTRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIG |
| Ga0182035_115251672 | 3300016341 | Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKVVD |
| Ga0182039_112184332 | 3300016422 | Soil | MNAGSERLPRLDVVIGNNFGHLPMFVGAEKGIFKKHGIDAHMKV |
| Ga0182039_118713382 | 3300016422 | Soil | MNAGTRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGI |
| Ga0187776_103219712 | 3300017966 | Tropical Peatland | MADLPRLDVVIGNNFGHLPMFIGAEKGFFKKHGVDAKM |
| Ga0187776_113516522 | 3300017966 | Tropical Peatland | MALPKLDVVIANNFGHLPMFIGAEKGFFKGNGVDASFRVVDTGTDMVNAL |
| Ga0187783_103461742 | 3300017970 | Tropical Peatland | MNAGSGQLPRLDVVIGNNFGHLPMFVGAEKGIFIEHGIDARMKVVDTGTDMVN |
| Ga0187777_112716641 | 3300017974 | Tropical Peatland | MADLPKLDVVIGNNFGHLPMFIGAEKGFFAKHGVDAKML |
| Ga0187782_108978181 | 3300017975 | Tropical Peatland | MNSALPKLDVVIGNNFGHLPMFVGAEKGFFARHGVDAKMLVVDTGTDMVNAMHDG |
| Ga0187782_110864672 | 3300017975 | Tropical Peatland | MNAQPLPKLDVVIGNNFGHLPMFVGAEKNFFKQHGVDAQMLVVDTGTDMVNAMH |
| Ga0187782_111903521 | 3300017975 | Tropical Peatland | MNAQTLPKLDVVIGNNFGHLPMFVGAEKNFFKQHGVDAQ |
| Ga0187788_101484372 | 3300018032 | Tropical Peatland | MADLPKLDVVIANNFGHLPMFVGAEKGFFKQQGVDA |
| Ga0187784_105816842 | 3300018062 | Tropical Peatland | MAELPKLDVVIGNNFGHLPMFIGAEKGLFRQHGVDATMKVVDTGTDMVNAMH |
| Ga0184637_105740291 | 3300018063 | Groundwater Sediment | MSTNPGQQMPKLDVVIGNNFGHLPMFVGAEKGFFQKHGVDA |
| Ga0184625_104695952 | 3300018081 | Groundwater Sediment | MALPKLDVVIANNFGHLPMFIGAEKGFFKQHGVDASFKVVDTGTDMV |
| Ga0187772_114391562 | 3300018085 | Tropical Peatland | MNAQTLPKLDVVIGNNFGHLPMFVGAEKNFFKQHGVDARMLVVDTGTDMVNA |
| Ga0187769_102605033 | 3300018086 | Tropical Peatland | MATGSGSLPRLDVVIGNNFGHLPMFVGAEKGFFRKHGVDAKMLVVDTGTD |
| Ga0187893_109472881 | 3300019487 | Microbial Mat On Rocks | MDHDMSANSTRQLPRLDVVIANNFGHLPMFIGAEKGFFKQHG |
| Ga0182025_12566082 | 3300019786 | Permafrost | MTAGSGTLSRLDVVIGNNFGHLPMFVGAEKGLFKKHGVDAHMKVVDTGTDMVNAMHSGEAADRRT |
| Ga0187768_11304642 | 3300020150 | Tropical Peatland | MTLPKLDVVIANNFGHLPMFIGAEKGFFKQHGVDATMKVVDTGTDMVN |
| Ga0213881_100735081 | 3300021374 | Exposed Rock | MSNGMRQLPGLDVVIGNNFGHLPMFVGAEKGIFKRHGIDVRMKVVDTGTDMVDAL |
| Ga0210394_118141931 | 3300021420 | Soil | MNIGALPRLDVVIGNNFGHLPMFVGAEKGFFAKHGVDAKMLVVDT |
| Ga0213879_101381082 | 3300021439 | Bulk Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMK |
| Ga0210390_111480162 | 3300021474 | Soil | MNTALPKLDVVIGNNFGHLPMFVGAEKGFFARHGVDAKMLVVDTGTDMVN |
| Ga0187846_104157861 | 3300021476 | Biofilm | MNAGSLELPRLDVVIGNNFGHLPMFVGAEKGIFNKHGIDAHMKVVDTGTDM |
| Ga0210402_105413242 | 3300021478 | Soil | MNAGSRELPRLDVVIGNNFGHLPMFVGAEKGIFERHGIDAH |
| Ga0212128_104184091 | 3300022563 | Thermal Springs | MSTGSNPQLPRLDVVIGNNFGHLPMFIGAEKGIFEKHGVDARMKVVDTGTDMVN |
| Ga0179589_103250801 | 3300024288 | Vadose Zone Soil | MNAGSRELPRLDVVIGNNFGHLPMFVGAEKGIFEKHG |
| Ga0209322_103958111 | 3300025146 | Soil | MSNLPKLDVVIGNNFGHLPMFIGAEKGYFAKHGVDAKMLVVD |
| Ga0209324_108348312 | 3300025174 | Soil | MSDLPKLDVVIGNNFGHLPMFIGAEKGYFAKHGVDAKML |
| Ga0209431_102710343 | 3300025313 | Soil | MNAQSGQEPALDVVIGNNFGHLPMFIGAQKGIFQKHGVNARMKVVDTGTDM |
| Ga0209341_111392501 | 3300025325 | Soil | MNAQSGQEPVLDVVIGNNFGHLPMFIGAQKGIFQKHGVNARMKVVDTGTDMVNAMHNGEAQIGDMSVTTFLKAVH |
| Ga0209751_104839431 | 3300025327 | Soil | MNAQSGQEPVLDVVIGNNFGHLPMFIGAQKGIFQKHGVNARMKVVDTGTDMVNAMHNGEAQIGDMS |
| Ga0209751_109043002 | 3300025327 | Soil | MSNLPKLDVVIGNNFGHLPMFIGAEKGYFAKHGVDAKMLV |
| Ga0207932_11181422 | 3300025495 | Arctic Peat Soil | MADLPKLDVVIGNNFGHLPMFIGAEKGFFKKHGVDAK |
| Ga0209584_102538442 | 3300025878 | Arctic Peat Soil | MAELPKLDVVIANNFGHLPMFIGAEKGFFKQHGVDASF |
| Ga0207684_100256487 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAGSGQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKVVDTGTDMV |
| Ga0207671_102688741 | 3300025914 | Corn Rhizosphere | MADLPKLNVVIANNFGHLPMFVGAEKGFFKRHGVDASFRVVDTG |
| Ga0207646_117188662 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MADLPKLNVVIANNFGHLPMFVGAERGFFKTQGVDASFRVVDTGTDMVNALH |
| Ga0209131_12432682 | 3300026320 | Grasslands Soil | MNAGSQELPRLDVVIGNNFGHLPMFVGAEKGIFKRHGIDAHMKVVDTGTDM |
| Ga0209648_105596691 | 3300026551 | Grasslands Soil | MNGGSRELPRLDVVIGNNFGHLPMFVGAEKGTFKRHGIDAHMKVVDTGTDMVNAMHNG |
| Ga0207527_1035502 | 3300026759 | Soil | MADLPKLNVVIANNFGHLPMFVGAERGFFKTQGVDAS |
| Ga0207552_1014812 | 3300026771 | Soil | MADLPKLNVVIANNFGHLPMFVGAEKGFFKRHGVDASFRVVDTGTDMVNAL |
| Ga0207443_10061232 | 3300026853 | Soil | MADLPKLNVVIANNFGHLPMFVGAERGFFKTQGVDASFRVVDTGTDMVNALHN |
| Ga0207739_10019161 | 3300026881 | Tropical Forest Soil | MADLPKIDVVIGNNFGHLPMFIGAEKGYFKRHGVDAKMLVVDTGTDMVN |
| Ga0207434_10209221 | 3300026952 | Soil | MADLPKLNVVIANNFGHLPMFVGAEKGFFKRHGVDASFRVVDT |
| Ga0207562_10099091 | 3300027446 | Soil | MADLPKLNVVIANNFGHLPMFVGAEKGFFKRHGVDASFRVVD |
| Ga0209274_107000412 | 3300027853 | Soil | VNAQTLPKLDVVIGNNFGHLPMFVGAEKNFFKQHGVDAQ |
| Ga0209283_103110752 | 3300027875 | Vadose Zone Soil | MNAGSGQLPRLDVVIGNNFGHLPMFVGAEKGIFKRHGIDAHMKVVDTGTDMVNAM |
| Ga0209283_106454571 | 3300027875 | Vadose Zone Soil | MNAGSRELPRLDVVIGNNFGHLPMFVGAEKGIFKRHGIDAHMKVVDTGTDMVNAMHNGEA |
| Ga0209069_100610231 | 3300027915 | Watersheds | MADLPKLDVVIGNNFGHLPMFIGAEKGFFAKHGVDAKMLVVDTGTDMV |
| Ga0209069_106668211 | 3300027915 | Watersheds | MNSGSGQLSRLDVVIGNNFGHLPMFVGAEKGIFKKHGIE |
| Ga0268264_103281861 | 3300028381 | Switchgrass Rhizosphere | MADLPKLNVVIANNFGHLPMFNGAEKGFFKNHGVDAS |
| Ga0307307_100480493 | 3300028718 | Soil | MALPKLDVVIANNFGHLPMFIGAEKGFFKEHGVDASF |
| Ga0307316_103069152 | 3300028755 | Soil | MALPKLDVVIANNFGHLQMFIGAEKGFFKEHGVDAS |
| Ga0307323_101290842 | 3300028787 | Soil | MALPKLDVVIANNFGHLPMFIGAEKGFFKEHGVDA |
| Ga0307504_103249162 | 3300028792 | Soil | MADLPKLDVVIGNNFGHLPMFVGAEKGIFKRHGIDAHMKVVDTGTDMVN |
| Ga0307503_104246102 | 3300028802 | Soil | MADLPKLDVVIGNNFGHLPMFIGAEKGFFAKHGVDAKM |
| (restricted) Ga0255310_101972812 | 3300031197 | Sandy Soil | MADLPKLNVVIANNFGHLPMFVGAEKGFFKQHGVDASF |
| Ga0307497_100132203 | 3300031226 | Soil | MADLPRLDVVIGNNFGHLPMFIGAEKGFFAKHGVDAKMLVV |
| Ga0310888_105132332 | 3300031538 | Soil | MALPKLDVVIANNFGHLPMFIGAEKGFFKQQGVDASFKV |
| Ga0318534_101617712 | 3300031544 | Soil | MNAGSGQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKVVD |
| Ga0310887_109195131 | 3300031547 | Soil | MADLPKLDVVIGNNFGHLPMFIGAEKGFFRKHGVDAKMLVVDTGTDMVNA |
| Ga0318528_103195601 | 3300031561 | Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGI |
| Ga0318528_106638692 | 3300031561 | Soil | MNAGTRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHG |
| Ga0318515_105229971 | 3300031572 | Soil | MADLPKIDVVIGNNFGHLPMFIGAEKGYFKRHGVDAKMLVVD |
| Ga0310915_104970862 | 3300031573 | Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKVV |
| Ga0318561_105517681 | 3300031679 | Soil | MNAGSGQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKVVDTGTDMVNAMHNGEA |
| Ga0318572_104971672 | 3300031681 | Soil | MADLPKIDVVIGNNFGHLPMFIGAEKGYFKRHGVDAKMLVVDTGTDMV |
| Ga0318560_102615932 | 3300031682 | Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGTEKGIFKNHGIDA |
| Ga0306917_111266871 | 3300031719 | Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKVVDTGTDMV |
| Ga0318554_106806782 | 3300031765 | Soil | MADLPKIDVVIGNNFGHLPMFIGAEKGYFKRHGVDAKMLVVDTGT |
| Ga0318521_104198021 | 3300031770 | Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGTEKGIFKNHGIDAHMKVVD |
| Ga0318508_10818671 | 3300031780 | Soil | MADLPKIDVVIGNNFGHLPMFIGAEKGYFKRHGVDAKMLV |
| Ga0318567_104379101 | 3300031821 | Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKV |
| Ga0318527_100890581 | 3300031859 | Soil | MNAGSGQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKVVDTGTDMVNAM |
| Ga0318527_103773261 | 3300031859 | Soil | MADLPKIDVVIGNNFGHLPMFIGAEKGYFKRHGVDAK |
| Ga0318495_102218561 | 3300031860 | Soil | MADLPKIDVVIGNNFGHLPMFIGAEKGYFKRHGVDAKMLVVDTG |
| Ga0306925_117686812 | 3300031890 | Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGAEKGIFENHGIDAHM |
| Ga0318520_109416452 | 3300031897 | Soil | MNAGSGQLPRLDVVIGNNFGHLPMFAGAEKGIFKNHGIDAHMKVVDTGTDMVNAMHNGEAQIG |
| Ga0310916_107607551 | 3300031942 | Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGTEKGIFKNHGI |
| Ga0310910_107360371 | 3300031946 | Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKVVDTGTD |
| Ga0310909_113475562 | 3300031947 | Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKVVDTGTDMVN |
| Ga0310909_114789781 | 3300031947 | Soil | MNAGTRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIGAHMKVVDTGTDMVNAMHNGEAQIGDMSVTT |
| Ga0214473_100776115 | 3300031949 | Soil | MGTKPGQQTPKLDVVIGNNFGHLPMFIGAEKGFFQKHGV |
| Ga0318531_103829662 | 3300031981 | Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGTEKGIFKNHGIDAHMKVV |
| Ga0318507_103368582 | 3300032025 | Soil | MADLPKIDVVIGNNFGHLPMFIGAEKGYFKRHGVDAKMLVVDTGTD |
| Ga0310911_101149341 | 3300032035 | Soil | MNAGSGQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKVV |
| Ga0318533_105764771 | 3300032059 | Soil | MNAGTRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIGAHMKVVDTGT |
| Ga0315540_103762952 | 3300032061 | Salt Marsh Sediment | MAELPRLDVVIGNNFGHLPMFVGAEKGFFKAHGVDA |
| Ga0306924_121627771 | 3300032076 | Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDARMKVVDTGTDMVNAMHNGEA |
| Ga0307472_1012278471 | 3300032205 | Hardwood Forest Soil | MALPKLDVVIANNFGHLPMFIGAEKGFFKQQGVDASFKVVDTGTD |
| Ga0306920_1028901921 | 3300032261 | Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGAEKGSFKNHGIDAHMKVVDTGTDM |
| Ga0315273_111752181 | 3300032516 | Sediment | MSDLPKLDVVIGNNFGHLPMFIGAEKGFFKKHGVDAKMLV |
| Ga0335085_112222161 | 3300032770 | Soil | MTDLPKLDVVIANNFGHLPMFIGAEKGYFKAHGVDASFKVV |
| Ga0335085_114959871 | 3300032770 | Soil | MADLPKLSVVIANNFGHLPMFVGAEKGFFKGHGVDA |
| Ga0335079_116070251 | 3300032783 | Soil | MADLPKLDVVIANNFGHLPMFIGAEKGFFKQHGVDASFKVVDTG |
| Ga0335079_123066132 | 3300032783 | Soil | MADLPKLNVVIANNFGHLPMFIGAEKGFFKQHGVDASF |
| Ga0335071_116698432 | 3300032897 | Soil | MALPKLDVVIANNFGHLPMFIGAEKGFFKQHGVDASFRVVDTGTDMVNALHN |
| Ga0310914_112632802 | 3300033289 | Soil | MNAGSRQLPRLDVVIGNNFGHLPMFVGAEKGIFKNHGIDAHMKVVDTGTDM |
| Ga0326726_106664721 | 3300033433 | Peat Soil | MNSGSGQLSRLDVVIGNNFGHLPMFVGAEKGIFKKHGIEAHMKV |
| Ga0316628_1028460011 | 3300033513 | Soil | MAELPKLDVVIANNFGHLPMFIGAEKGYFKQHGVDASF |
| Ga0314872_022213_2_139 | 3300033810 | Peatland | MADLPRLDVVIGNNFGHLPMFIGAEKGFFKKHGVDAKMLVVDTGTD |
| Ga0326723_0305873_1_126 | 3300034090 | Peat Soil | MAALPRLDVVIGNNFGHLPMFIGAEKGFFAKHGVDAKMLVVD |
| Ga0370501_0352348_1_123 | 3300034195 | Untreated Peat Soil | MAELPKLDVVIANNFGHLPMFIGAEKGFFKQHGVDASFKVV |
| Ga0373948_0101066_1_168 | 3300034817 | Rhizosphere Soil | MSPAGVREGKMALPKLDVVIANNFGHLPMFIGAEKGFFKQQGVDASFKVVDTGTDM |
| ⦗Top⦘ |