Basic Information | |
---|---|
Family ID | F031080 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 183 |
Average Sequence Length | 42 residues |
Representative Sequence | MNEYFEIADAPGEIFDIPEMQDLDSENKFDVNEYLNANYDY |
Number of Associated Samples | 117 |
Number of Associated Scaffolds | 183 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 45.36 % |
% of genes near scaffold ends (potentially truncated) | 29.51 % |
% of genes from short scaffolds (< 2000 bps) | 81.97 % |
Associated GOLD sequencing projects | 104 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.28 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (42.623 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (30.601 % of family members) |
Environment Ontology (ENVO) | Unclassified (39.344 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (87.978 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.59% β-sheet: 0.00% Coil/Unstructured: 88.41% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 183 Family Scaffolds |
---|---|---|
PF01555 | N6_N4_Mtase | 3.83 |
PF07275 | ArdA | 1.09 |
PF13392 | HNH_3 | 1.09 |
PF02086 | MethyltransfD12 | 1.09 |
PF04851 | ResIII | 0.55 |
PF03237 | Terminase_6N | 0.55 |
PF02672 | CP12 | 0.55 |
PF04820 | Trp_halogenase | 0.55 |
PF07669 | Eco57I | 0.55 |
COG ID | Name | Functional Category | % Frequency in 183 Family Scaffolds |
---|---|---|---|
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 3.83 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 3.83 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 3.83 |
COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 1.09 |
COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 1.09 |
COG4734 | Antirestriction protein ArdA | Defense mechanisms [V] | 1.09 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 57.38 % |
Unclassified | root | N/A | 42.62 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000116|DelMOSpr2010_c10182216 | Not Available | 688 | Open in IMG/M |
3300001778|ACM18_1001286 | Not Available | 965 | Open in IMG/M |
3300001778|ACM18_1060484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 629 | Open in IMG/M |
3300001819|ACM37_101221 | All Organisms → Viruses → Predicted Viral | 1360 | Open in IMG/M |
3300001827|ACM21_1019727 | All Organisms → Viruses → Predicted Viral | 1163 | Open in IMG/M |
3300001846|ACM22_1050944 | All Organisms → Viruses → Predicted Viral | 1216 | Open in IMG/M |
3300002040|GOScombined01_103294950 | Not Available | 875 | Open in IMG/M |
3300003580|JGI26260J51721_1008235 | All Organisms → Viruses → Predicted Viral | 2975 | Open in IMG/M |
3300004369|Ga0065726_13938 | Not Available | 18168 | Open in IMG/M |
3300005523|Ga0066865_10000132 | Not Available | 17478 | Open in IMG/M |
3300005525|Ga0068877_10195156 | All Organisms → Viruses → Predicted Viral | 1215 | Open in IMG/M |
3300005527|Ga0068876_10012629 | Not Available | 5502 | Open in IMG/M |
3300005934|Ga0066377_10248064 | Not Available | 550 | Open in IMG/M |
3300005934|Ga0066377_10270507 | Not Available | 526 | Open in IMG/M |
3300006026|Ga0075478_10070707 | All Organisms → Viruses → Predicted Viral | 1129 | Open in IMG/M |
3300006637|Ga0075461_10138437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 750 | Open in IMG/M |
3300006637|Ga0075461_10212605 | Not Available | 576 | Open in IMG/M |
3300006735|Ga0098038_1015644 | All Organisms → Viruses → Predicted Viral | 2928 | Open in IMG/M |
3300006737|Ga0098037_1014142 | All Organisms → Viruses → Predicted Viral | 3044 | Open in IMG/M |
3300006789|Ga0098054_1109877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Llyrvirus → Synechococcus virus SSKS1 | 1029 | Open in IMG/M |
3300006793|Ga0098055_1336226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 562 | Open in IMG/M |
3300006802|Ga0070749_10329134 | Not Available | 852 | Open in IMG/M |
3300006802|Ga0070749_10623303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 580 | Open in IMG/M |
3300006810|Ga0070754_10051668 | All Organisms → Viruses → Predicted Viral | 2169 | Open in IMG/M |
3300006810|Ga0070754_10433877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 571 | Open in IMG/M |
3300006810|Ga0070754_10523031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Cymopoleiavirus → Synechococcus virus SWAM2 | 509 | Open in IMG/M |
3300006869|Ga0075477_10098981 | All Organisms → Viruses → Predicted Viral | 1249 | Open in IMG/M |
3300006869|Ga0075477_10117197 | All Organisms → Viruses → Predicted Viral | 1130 | Open in IMG/M |
3300006869|Ga0075477_10335682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 596 | Open in IMG/M |
3300006870|Ga0075479_10100097 | All Organisms → Viruses → Predicted Viral | 1204 | Open in IMG/M |
3300006874|Ga0075475_10197786 | Not Available | 862 | Open in IMG/M |
3300006919|Ga0070746_10427911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 590 | Open in IMG/M |
3300007344|Ga0070745_1223172 | Not Available | 689 | Open in IMG/M |
3300007538|Ga0099851_1304701 | Not Available | 562 | Open in IMG/M |
3300007538|Ga0099851_1318281 | Not Available | 547 | Open in IMG/M |
3300007539|Ga0099849_1016756 | All Organisms → Viruses → Predicted Viral | 3211 | Open in IMG/M |
3300007539|Ga0099849_1036180 | All Organisms → Viruses → Predicted Viral | 2096 | Open in IMG/M |
3300007539|Ga0099849_1205185 | Not Available | 740 | Open in IMG/M |
3300007539|Ga0099849_1263638 | Not Available | 630 | Open in IMG/M |
3300007539|Ga0099849_1347911 | Not Available | 527 | Open in IMG/M |
3300007539|Ga0099849_1367444 | Not Available | 509 | Open in IMG/M |
3300007541|Ga0099848_1056799 | All Organisms → Viruses → Predicted Viral | 1565 | Open in IMG/M |
3300007541|Ga0099848_1129148 | Not Available | 949 | Open in IMG/M |
3300007541|Ga0099848_1224355 | Not Available | 666 | Open in IMG/M |
3300007542|Ga0099846_1165898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Llyrvirus → Synechococcus virus SSKS1 | 790 | Open in IMG/M |
3300007960|Ga0099850_1387965 | Not Available | 518 | Open in IMG/M |
3300009000|Ga0102960_1186540 | Not Available | 742 | Open in IMG/M |
3300009001|Ga0102963_1139754 | Not Available | 979 | Open in IMG/M |
3300009068|Ga0114973_10263637 | Not Available | 926 | Open in IMG/M |
3300009124|Ga0118687_10023439 | All Organisms → Viruses → Predicted Viral | 2023 | Open in IMG/M |
3300009152|Ga0114980_10480258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-H38 | 709 | Open in IMG/M |
3300009152|Ga0114980_10726506 | Not Available | 555 | Open in IMG/M |
3300009214|Ga0103830_1006747 | Not Available | 897 | Open in IMG/M |
3300009214|Ga0103830_1018957 | Not Available | 619 | Open in IMG/M |
3300009327|Ga0103843_109116 | Not Available | 520 | Open in IMG/M |
3300009330|Ga0103829_108237 | Not Available | 526 | Open in IMG/M |
3300009331|Ga0103824_105108 | Not Available | 761 | Open in IMG/M |
3300009338|Ga0103826_113069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SCSM1 | 569 | Open in IMG/M |
3300009353|Ga0103847_1005654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Atlauavirus | 630 | Open in IMG/M |
3300009550|Ga0115013_10617283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 725 | Open in IMG/M |
3300010296|Ga0129348_1128290 | Not Available | 884 | Open in IMG/M |
3300010297|Ga0129345_1006309 | All Organisms → Viruses → Predicted Viral | 4609 | Open in IMG/M |
3300010297|Ga0129345_1286664 | Not Available | 571 | Open in IMG/M |
3300010299|Ga0129342_1017588 | All Organisms → Viruses → Predicted Viral | 2944 | Open in IMG/M |
3300010300|Ga0129351_1102614 | All Organisms → Viruses → Predicted Viral | 1147 | Open in IMG/M |
3300010300|Ga0129351_1330859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SCSM1 | 573 | Open in IMG/M |
3300010318|Ga0136656_1114778 | Not Available | 937 | Open in IMG/M |
3300010318|Ga0136656_1272203 | Not Available | 554 | Open in IMG/M |
3300010354|Ga0129333_10640965 | Not Available | 919 | Open in IMG/M |
3300010370|Ga0129336_10382844 | Not Available | 770 | Open in IMG/M |
3300010389|Ga0136549_10039617 | All Organisms → Viruses → Predicted Viral | 2538 | Open in IMG/M |
3300010389|Ga0136549_10217568 | Not Available | 824 | Open in IMG/M |
3300010412|Ga0136852_10442870 | All Organisms → Viruses → Predicted Viral | 1264 | Open in IMG/M |
3300010412|Ga0136852_11318531 | Not Available | 685 | Open in IMG/M |
3300012520|Ga0129344_1109111 | Not Available | 696 | Open in IMG/M |
3300012520|Ga0129344_1264585 | Not Available | 503 | Open in IMG/M |
3300012936|Ga0163109_10144577 | All Organisms → Viruses → Predicted Viral | 1746 | Open in IMG/M |
3300012967|Ga0129343_1018211 | Not Available | 662 | Open in IMG/M |
3300012968|Ga0129337_1300879 | Not Available | 554 | Open in IMG/M |
3300012970|Ga0129338_1581118 | Not Available | 643 | Open in IMG/M |
3300013181|Ga0116836_1045332 | Not Available | 508 | Open in IMG/M |
3300013195|Ga0116815_1004099 | All Organisms → Viruses → Predicted Viral | 1665 | Open in IMG/M |
3300017713|Ga0181391_1038900 | All Organisms → Viruses → Predicted Viral | 1143 | Open in IMG/M |
3300017714|Ga0181412_1001359 | Not Available | 9443 | Open in IMG/M |
3300017721|Ga0181373_1043527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 821 | Open in IMG/M |
3300017742|Ga0181399_1128368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 617 | Open in IMG/M |
3300017746|Ga0181389_1059157 | All Organisms → Viruses → Predicted Viral | 1103 | Open in IMG/M |
3300017818|Ga0181565_10026183 | All Organisms → Viruses → Predicted Viral | 4305 | Open in IMG/M |
3300017818|Ga0181565_10438053 | Not Available | 857 | Open in IMG/M |
3300017818|Ga0181565_10687455 | Not Available | 650 | Open in IMG/M |
3300017824|Ga0181552_10069447 | All Organisms → Viruses → Predicted Viral | 2017 | Open in IMG/M |
3300017949|Ga0181584_10017530 | All Organisms → Viruses | 5260 | Open in IMG/M |
3300017949|Ga0181584_10129039 | All Organisms → Viruses → Predicted Viral | 1709 | Open in IMG/M |
3300017949|Ga0181584_10174473 | All Organisms → Viruses → Predicted Viral | 1427 | Open in IMG/M |
3300017949|Ga0181584_10181116 | All Organisms → Viruses → Predicted Viral | 1396 | Open in IMG/M |
3300017949|Ga0181584_10189969 | All Organisms → Viruses → Predicted Viral | 1356 | Open in IMG/M |
3300017949|Ga0181584_10268697 | All Organisms → Viruses → Predicted Viral | 1099 | Open in IMG/M |
3300017949|Ga0181584_10423724 | Not Available | 830 | Open in IMG/M |
3300017949|Ga0181584_10665758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 625 | Open in IMG/M |
3300017949|Ga0181584_10741916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 584 | Open in IMG/M |
3300017951|Ga0181577_10146712 | All Organisms → Viruses → Predicted Viral | 1607 | Open in IMG/M |
3300017951|Ga0181577_10205668 | All Organisms → Viruses → Predicted Viral | 1313 | Open in IMG/M |
3300017951|Ga0181577_10364309 | Not Available | 926 | Open in IMG/M |
3300017952|Ga0181583_10027408 | All Organisms → Viruses → Predicted Viral | 4125 | Open in IMG/M |
3300017952|Ga0181583_10260924 | All Organisms → Viruses → Predicted Viral | 1115 | Open in IMG/M |
3300017952|Ga0181583_10337130 | Not Available | 951 | Open in IMG/M |
3300017952|Ga0181583_10393489 | Not Available | 864 | Open in IMG/M |
3300017952|Ga0181583_10398916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 856 | Open in IMG/M |
3300017952|Ga0181583_10507843 | Not Available | 736 | Open in IMG/M |
3300017952|Ga0181583_10616766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 651 | Open in IMG/M |
3300017956|Ga0181580_10106713 | All Organisms → Viruses → Predicted Viral | 2045 | Open in IMG/M |
3300017956|Ga0181580_10302977 | All Organisms → Viruses → Predicted Viral | 1088 | Open in IMG/M |
3300017956|Ga0181580_10319901 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
3300017956|Ga0181580_11016158 | Not Available | 512 | Open in IMG/M |
3300017957|Ga0181571_10729902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 590 | Open in IMG/M |
3300017958|Ga0181582_10039996 | All Organisms → Viruses → Predicted Viral | 3612 | Open in IMG/M |
3300017958|Ga0181582_10741329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 588 | Open in IMG/M |
3300017962|Ga0181581_10463095 | Not Available | 788 | Open in IMG/M |
3300017962|Ga0181581_10613357 | Not Available | 661 | Open in IMG/M |
3300017967|Ga0181590_10129161 | All Organisms → Viruses → Predicted Viral | 1950 | Open in IMG/M |
3300017967|Ga0181590_11103877 | All Organisms → Viruses | 512 | Open in IMG/M |
3300017967|Ga0181590_11136510 | Not Available | 502 | Open in IMG/M |
3300017968|Ga0181587_10685471 | Not Available | 648 | Open in IMG/M |
3300017969|Ga0181585_10439879 | Not Available | 884 | Open in IMG/M |
3300017969|Ga0181585_10700456 | All Organisms → Viruses | 662 | Open in IMG/M |
3300018039|Ga0181579_10221049 | All Organisms → Viruses → Predicted Viral | 1099 | Open in IMG/M |
3300018421|Ga0181592_10272789 | All Organisms → Viruses → Predicted Viral | 1233 | Open in IMG/M |
3300018421|Ga0181592_10593635 | Not Available | 752 | Open in IMG/M |
3300018421|Ga0181592_10808221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SCSM1 | 617 | Open in IMG/M |
3300018423|Ga0181593_10184566 | All Organisms → Viruses → Predicted Viral | 1654 | Open in IMG/M |
3300018424|Ga0181591_10302713 | All Organisms → Viruses → Predicted Viral | 1218 | Open in IMG/M |
3300019277|Ga0182081_1657568 | Not Available | 647 | Open in IMG/M |
3300019765|Ga0194024_1083476 | Not Available | 723 | Open in IMG/M |
3300019765|Ga0194024_1111826 | Not Available | 628 | Open in IMG/M |
3300020054|Ga0181594_10460125 | Not Available | 525 | Open in IMG/M |
3300020239|Ga0211501_1002517 | All Organisms → Viruses → Predicted Viral | 4021 | Open in IMG/M |
3300020247|Ga0211654_1001895 | All Organisms → Viruses → Predicted Viral | 3722 | Open in IMG/M |
3300020314|Ga0211522_1043248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 795 | Open in IMG/M |
3300020371|Ga0211500_1244405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 510 | Open in IMG/M |
3300020388|Ga0211678_10112774 | All Organisms → Viruses → Predicted Viral | 1194 | Open in IMG/M |
3300020442|Ga0211559_10007928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 5600 | Open in IMG/M |
3300020442|Ga0211559_10424571 | All Organisms → Viruses | 613 | Open in IMG/M |
3300021368|Ga0213860_10440572 | Not Available | 561 | Open in IMG/M |
3300021957|Ga0222717_10650667 | Not Available | 546 | Open in IMG/M |
3300021959|Ga0222716_10279941 | All Organisms → Viruses → Predicted Viral | 1016 | Open in IMG/M |
3300021959|Ga0222716_10376602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 832 | Open in IMG/M |
3300021959|Ga0222716_10773666 | Not Available | 501 | Open in IMG/M |
3300021960|Ga0222715_10008107 | All Organisms → Viruses | 8660 | Open in IMG/M |
3300021960|Ga0222715_10039156 | All Organisms → Viruses → Predicted Viral | 3349 | Open in IMG/M |
3300021960|Ga0222715_10098838 | All Organisms → Viruses → Predicted Viral | 1888 | Open in IMG/M |
3300021960|Ga0222715_10203843 | All Organisms → Viruses → Predicted Viral | 1181 | Open in IMG/M |
3300021960|Ga0222715_10249268 | All Organisms → Viruses → Predicted Viral | 1034 | Open in IMG/M |
3300021960|Ga0222715_10603213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 566 | Open in IMG/M |
3300021961|Ga0222714_10010646 | Not Available | 7919 | Open in IMG/M |
3300021964|Ga0222719_10523731 | Not Available | 706 | Open in IMG/M |
3300022752|Ga0214917_10000445 | All Organisms → Viruses | 53983 | Open in IMG/M |
3300022905|Ga0255756_1167312 | All Organisms → Viruses | 844 | Open in IMG/M |
3300022909|Ga0255755_1160577 | Not Available | 899 | Open in IMG/M |
3300022935|Ga0255780_10127196 | All Organisms → Viruses → Predicted Viral | 1435 | Open in IMG/M |
3300022937|Ga0255770_10442393 | Not Available | 552 | Open in IMG/M |
3300022937|Ga0255770_10481559 | Not Available | 517 | Open in IMG/M |
3300023081|Ga0255764_10035949 | All Organisms → Viruses → Predicted Viral | 3172 | Open in IMG/M |
3300023084|Ga0255778_10182281 | All Organisms → Viruses → Predicted Viral | 1067 | Open in IMG/M |
3300023116|Ga0255751_10172850 | All Organisms → Viruses → Predicted Viral | 1240 | Open in IMG/M |
3300023172|Ga0255766_10054250 | All Organisms → Viruses → Predicted Viral | 2604 | Open in IMG/M |
3300023180|Ga0255768_10391614 | All Organisms → Viruses | 740 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10083140 | All Organisms → Viruses → Predicted Viral | 1332 | Open in IMG/M |
3300025483|Ga0209557_1005382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 5646 | Open in IMG/M |
3300025653|Ga0208428_1052320 | All Organisms → Viruses → Predicted Viral | 1238 | Open in IMG/M |
3300025674|Ga0208162_1030076 | All Organisms → Viruses → Predicted Viral | 1996 | Open in IMG/M |
3300025674|Ga0208162_1129158 | Not Available | 716 | Open in IMG/M |
3300025674|Ga0208162_1159162 | Not Available | 611 | Open in IMG/M |
3300025889|Ga0208644_1233671 | Not Available | 772 | Open in IMG/M |
3300026085|Ga0208880_1091656 | Not Available | 655 | Open in IMG/M |
3300026085|Ga0208880_1132975 | Not Available | 526 | Open in IMG/M |
3300027917|Ga0209536_100219704 | All Organisms → Viruses → Predicted Viral | 2384 | Open in IMG/M |
3300027974|Ga0209299_1030363 | All Organisms → Viruses → Predicted Viral | 2352 | Open in IMG/M |
3300028196|Ga0257114_1025731 | All Organisms → Viruses → Predicted Viral | 2821 | Open in IMG/M |
3300028196|Ga0257114_1158394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 866 | Open in IMG/M |
3300031578|Ga0307376_10503623 | Not Available | 783 | Open in IMG/M |
3300031673|Ga0307377_10572632 | Not Available | 812 | Open in IMG/M |
3300034019|Ga0334998_0727977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage SynMITS9220M01 | 526 | Open in IMG/M |
3300034166|Ga0335016_0188477 | All Organisms → Viruses → Predicted Viral | 1359 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 30.60% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 20.77% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 7.10% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 6.56% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.46% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 3.83% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.83% |
Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 2.73% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.19% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.19% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.64% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.64% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.09% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.09% |
Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 1.09% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.09% |
Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 1.09% |
Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 1.09% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.09% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.55% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.55% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.55% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.55% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.55% |
Saline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline | 0.55% |
Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.55% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300001778 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM18, ROCA_DNA027_0.2um_3g | Environmental | Open in IMG/M |
3300001819 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM37, ROCA_DNA077_2.0um_10k | Environmental | Open in IMG/M |
3300001827 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM21, ROCA_DNA110_2.0um_23k | Environmental | Open in IMG/M |
3300001846 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM22, ROCA_DNA119_0.2um_25b | Environmental | Open in IMG/M |
3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
3300003580 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA | Environmental | Open in IMG/M |
3300004369 | Saline microbial communities from the South Caspian sea - cas-15 | Environmental | Open in IMG/M |
3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009214 | Microbial communities of water from the North Atlantic ocean - ACM51 | Environmental | Open in IMG/M |
3300009327 | Microbial communities of water from the North Atlantic ocean - ACM30 | Environmental | Open in IMG/M |
3300009330 | Microbial communities of water from the North Atlantic ocean - ACM50 | Environmental | Open in IMG/M |
3300009331 | Microbial communities of water from the North Atlantic ocean - ACM11 | Environmental | Open in IMG/M |
3300009338 | Microbial communities of water from the North Atlantic ocean - ACM29 | Environmental | Open in IMG/M |
3300009353 | Microbial communities of water from the North Atlantic ocean - ACM49 | Environmental | Open in IMG/M |
3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
3300012520 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
3300012967 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013181 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 9m_Station6_GOM_Metagenome | Environmental | Open in IMG/M |
3300013195 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 10m_Station7_GOM_Metagenome | Environmental | Open in IMG/M |
3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019277 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
3300020054 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413BT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020239 | Marine microbial communities from Tara Oceans - TARA_B100000003 (ERX555909-ERR598959) | Environmental | Open in IMG/M |
3300020247 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556048-ERR598962) | Environmental | Open in IMG/M |
3300020314 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556135-ERR598974) | Environmental | Open in IMG/M |
3300020371 | Marine microbial communities from Tara Oceans - TARA_B100000003 (ERX555978-ERR598991) | Environmental | Open in IMG/M |
3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300022905 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG | Environmental | Open in IMG/M |
3300022909 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG | Environmental | Open in IMG/M |
3300022935 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG | Environmental | Open in IMG/M |
3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
3300023081 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG | Environmental | Open in IMG/M |
3300023084 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG | Environmental | Open in IMG/M |
3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300026085 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B (SPAdes) | Environmental | Open in IMG/M |
3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSpr2010_101822164 | 3300000116 | Marine | MNDFFEIADAPGEIFDIPELQELEDENKFDVNEYLNGNYDY* |
ACM18_10012863 | 3300001778 | Marine Plankton | MFDELWSEIADAPGEIFDIPEMQELEEKFDVNEYLNGNYDY* |
ACM18_10604841 | 3300001778 | Marine Plankton | KPMNDFFEIADAPGEIFDIPEMQDLDEENQFDYNEYILSNIDY* |
ACM37_1012216 | 3300001819 | Marine Plankton | MNEFFEIADAPGEIFDIPELQDLDEDDRFDLNEYLMGNFDY* |
ACM21_10197274 | 3300001827 | Marine Plankton | TSVQTKRPMNDFFEIADAPGEIFDIPEMQDLDDENKFDVNEYLNANYDY* |
ACM22_10509445 | 3300001846 | Marine Plankton | MNEYFEIADAPGEIFDIPEMQDLDSEDKFDVNEYLNANYDY* |
GOScombined01_1032949504 | 3300002040 | Marine | MFDELWSEIADAPGEIFDIPELRELDDDNKFDYNEYILSNIDY* |
JGI26260J51721_10082351 | 3300003580 | Marine | MFDELWSEIADAPGEIFDIPEMRELDEDNEDKKFNVDEYLKSDYDY* |
Ga0065726_1393840 | 3300004369 | Saline | MFDELWSEIQDAPGEIFDIPEMQELDEDKKFNVTEYLNSNYDY* |
Ga0066865_1000013243 | 3300005523 | Marine | MNDFLTEIQDAPGEIFDIPEMQDLYDEKKFDIEEYLNADYDY* |
Ga0068877_101951564 | 3300005525 | Freshwater Lake | MTDELWSEIQDAPGEIFDIPEMQDSKDFNLDEYLKGDYDY* |
Ga0068876_1001262911 | 3300005527 | Freshwater Lake | MTDELWSEIADAPGEIFDIPEMQESKDFNLDEYLKGDYDY* |
Ga0066377_102480641 | 3300005934 | Marine | MNDFFEIADAPGEIFDIPEMQDLDEENQFDYNEYILSNIDY* |
Ga0066377_102705072 | 3300005934 | Marine | MNEYFEIADAPGEIFDIPEMQELDSDEKFDVNEYLNANYDY* |
Ga0075478_100707072 | 3300006026 | Aqueous | MNDLFLEIADAPGEIFDIPEMQDLDDENKFNVDEYLNADYDY* |
Ga0075461_101384374 | 3300006637 | Aqueous | MFDELWSEIADAPGEIFDIPEMQDSKDFDLDDYLKGDYDY* |
Ga0075461_102126052 | 3300006637 | Aqueous | MNEYFEIADAPGEIFDIPEMQELDSDDKFDVNEYLNGNYDY* |
Ga0098038_10156447 | 3300006735 | Marine | MNDFLTEIQDTPGEIFDIPEMQDLYDEKKFDIDEYLNADYDY* |
Ga0098037_10141423 | 3300006737 | Marine | MNDFLTEIQDTPGEIFDIPEMQDLYDEKKFDIEEYLNADYDY* |
Ga0098054_11098772 | 3300006789 | Marine | MNDLLTEIQDTPGEIFDIPEMQDLYDEKKFDLEEYLNADYDY* |
Ga0098055_13362263 | 3300006793 | Marine | SSPSIILTSVQPKAMNDLLTEIQDTPGEIFDIPEMQDLYDEKKFDLEEYLNADYDY* |
Ga0070749_103291343 | 3300006802 | Aqueous | MNEYFEIADAPGEIFDIPEMQELESDDKFDVNEYLNGNYDY* |
Ga0070749_106233032 | 3300006802 | Aqueous | MNEYFEIADAPGEIFDIPEMQELDTDDKFDVNEYLNANYDY* |
Ga0070754_100516689 | 3300006810 | Aqueous | MNEYFEIADAPGEIFDIPELQELDSENKFDVNEYLNSNYDY* |
Ga0070754_104338773 | 3300006810 | Aqueous | LYSVQTKPMNDLFLEIADAPGEIFDIPEMQDLDDENKFNVDEYLNADYDY* |
Ga0070754_105230312 | 3300006810 | Aqueous | MFDELWSEIQDMPGEIFDIPEMRELDDDNKFNVEDYLKADYDY*NHAISSN*N* |
Ga0075477_100989816 | 3300006869 | Aqueous | PMNEYFEIADAPGEIFDIPEMQELDSDDKFDVNEYLNGNYDY* |
Ga0075477_101171974 | 3300006869 | Aqueous | MFDEFFTEIADAPGEIFDIPEMQDLDSDKKFDMNEYLNANYDY* |
Ga0075477_103356822 | 3300006869 | Aqueous | MNDLFLEIADAPGEIFDIPELQDLDDENKFNVDEYLNADYDY* |
Ga0075479_101000973 | 3300006870 | Aqueous | MNEYFEIADAPGEIFDIPEMQELDTDDKFDVNEYLNGNYDY* |
Ga0075475_101977864 | 3300006874 | Aqueous | PMNEYFEIADAPGEIFDIPEMQELDTDDKFDVNEYLNGNYDY* |
Ga0070746_104279112 | 3300006919 | Aqueous | MNEYFEIADAPGEIFDIPEMQELDSDDKFDVNEYLNANYDY* |
Ga0070745_12231724 | 3300007344 | Aqueous | MNDFFEIADAPGEIFDIPELQDLDYENKFDMNEYLNANYDY* |
Ga0099851_13047011 | 3300007538 | Aqueous | PTETTMFDEFFTEIADAPGEIFDIPEMQDLDSDKKFDMNEYLNANYDY* |
Ga0099851_13182811 | 3300007538 | Aqueous | MNEYFEIADAPGEIFDIPEMQELDSDKKFDVNEYLNGNYDY* |
Ga0099849_10167567 | 3300007539 | Aqueous | MNDFFEIADAPGEIFDIPEMQDLDEENKFDYNEYILSNIDY* |
Ga0099849_10361804 | 3300007539 | Aqueous | MYDELWSEIADAPGEIFDIPEMRELDEDKKFDVNDYLKSDYDY* |
Ga0099849_12051852 | 3300007539 | Aqueous | MFDEFFAEIADAPGEIFDIPEMQDLDTENKFDVNEYLNGNYDY* |
Ga0099849_12636383 | 3300007539 | Aqueous | MFDEFFTEIVDAPGEIFDIPEMQDLDSDKKFDMNEYLNANYDY* |
Ga0099849_13479112 | 3300007539 | Aqueous | MNDLFLEIADAPGEIFDIPEMQDLDDENKFNVDEYLNANYDY* |
Ga0099849_13674442 | 3300007539 | Aqueous | MFEELWSEIADAPGEIFDIPEMQELEEKFDVNEYLNGNYDY* |
Ga0099848_10567994 | 3300007541 | Aqueous | MFDELWSEIADAPGEIFDIPEMRELDEDNKFDYNEYILSNIDY* |
Ga0099848_11291482 | 3300007541 | Aqueous | MFDELWSEIADAPGEIFDIPEMQELDQDRKFDVNEYLNSNYDY* |
Ga0099848_12243552 | 3300007541 | Aqueous | MNEYFEIADAPGEIFDIPELQELDSENKFDMNEYLNSNYDY* |
Ga0099846_11658981 | 3300007542 | Aqueous | MNDFFEIADAPGEIFDIPEMRDLDEENKFDYNEYILSNIDY* |
Ga0099850_13879652 | 3300007960 | Aqueous | MNEYFEIADAPGEIFDIPEMQELDSDKKFDVNEYLNANYDY* |
Ga0102960_11865402 | 3300009000 | Pond Water | MFDEFFTEIADAPGEIFDIPEMQDLDSENKFDVNEYLNGNYDY* |
Ga0102963_11397542 | 3300009001 | Pond Water | MFDEFFTEIADAPGEIFDIPEMQDLDTENKFDVNEYLNGNYDY* |
Ga0114973_102636374 | 3300009068 | Freshwater Lake | MEDTFWSEIYDAPGEIFDIPEMRDLDDENKFNIDEYINA |
Ga0118687_100234395 | 3300009124 | Sediment | MNDLFLEIADAPGEIFDIPEMQDLDSENKFDVDEYLNADYDY* |
Ga0114980_104802582 | 3300009152 | Freshwater Lake | MEDTFWSEIYDAPGEIFDIPEMRDLDDENKFNIDEYLNANYDY* |
Ga0114980_107265062 | 3300009152 | Freshwater Lake | MEDTFWSEIYDAPGEIFDIPEMRDLDDENKFNIDEYINANYDY* |
Ga0103830_10067472 | 3300009214 | River Water | MNDFFDIVDAPGEIYDIPEMQDLDDENKFDVNEYLNANYDY* |
Ga0103830_10189572 | 3300009214 | River Water | MNEYFEIADAPGEIFDIPEMQELDSDEKFDVNEYLNGNYDY* |
Ga0103843_1091161 | 3300009327 | River Water | MNEFFEIADAPGEIFDIPEMQELDSDEKFDVNEYT |
Ga0103829_1082372 | 3300009330 | River Water | MNDFFDIVDAPGEIYDIPEMQDLDDENKFDVNEYLN |
Ga0103824_1051081 | 3300009331 | River Water | MNEFFEIADAPGEIFDIPELQELDDENKFDVNEYLNSNYDY* |
Ga0103826_1130694 | 3300009338 | River Water | DIVDAPGEIYDIPEMQDLDDENKFDVNEYLNANYDY* |
Ga0103847_10056542 | 3300009353 | River Water | MNEFFEIADAPGEIFDIPELQELDDENKFDVNEYLNGNYDY* |
Ga0115013_106172832 | 3300009550 | Marine | MNDFLTEIQDTPGEIFDIPEMQDLYNEKKFDIEEYLNADYDY* |
Ga0129348_11282903 | 3300010296 | Freshwater To Marine Saline Gradient | MNNFFEIADAPGEIFDIPEMQDLDSDKKFDMNEYLNANYDY* |
Ga0129345_100630912 | 3300010297 | Freshwater To Marine Saline Gradient | LRQPPMNEYFEIADAPGEIFDIPEMQELDSDKKFDVNEYLNANYDY* |
Ga0129345_12866642 | 3300010297 | Freshwater To Marine Saline Gradient | MNEYFEIADAPGEIFDIPEMQDLDSENKFDVNEYLNANYDY* |
Ga0129342_101758811 | 3300010299 | Freshwater To Marine Saline Gradient | MNEYFEIADAPGEIFDIPEMQDLDSDKKFDVNEYLNGNYDY* |
Ga0129351_11026142 | 3300010300 | Freshwater To Marine Saline Gradient | MNDLFLEIADAPGEIFDIPELQDLDDDNKFNVDEYLNADYDY* |
Ga0129351_13308591 | 3300010300 | Freshwater To Marine Saline Gradient | MFDEFFTEIADAPGEIFDIPEMQDLDSDKKFDMNEYLNGNYDY* |
Ga0136656_11147782 | 3300010318 | Freshwater To Marine Saline Gradient | MNEYFEIADAPGEIFDIPEMQDLDTENKFDVNEYLNGNYDY* |
Ga0136656_12722031 | 3300010318 | Freshwater To Marine Saline Gradient | EIADAPGEIFDIPEMQDLDSDKKFDVNEYLNGNYDY* |
Ga0129333_106409651 | 3300010354 | Freshwater To Marine Saline Gradient | LRDTPMFDELWSEIADAPGEIFDIPEMRDLDEDNKFDYNEYILSNIDY* |
Ga0129336_103828443 | 3300010370 | Freshwater To Marine Saline Gradient | RDTPMFDELWSEIADAPGEIFDIPEMRDLDEDNKFDYNEYILSNIDY* |
Ga0136549_100396176 | 3300010389 | Marine Methane Seep Sediment | MNDLFLEIADAPGEIFDIPELQDLDDDNKFNVDEYLNGNYDY* |
Ga0136549_102175681 | 3300010389 | Marine Methane Seep Sediment | LRQPPMNEYFEIADAPGEIFDIPELQDLDYENKFDVNEYLNSNYDY* |
Ga0136852_104428701 | 3300010412 | Mangrove Sediment | MFDELWSEIADAPGEIFDLPEMQDLDEDRKFDVNDYLNSNYDY* |
Ga0136852_113185312 | 3300010412 | Mangrove Sediment | MNDFFEIADAPGEIFDIPELQDLDEDNKFDYNEYIMGNIDY* |
Ga0129344_11091112 | 3300012520 | Aqueous | MFDEFFAEIADAPGEIFDIPEMQDLDSDKKFDVNEYLNGNYDY* |
Ga0129344_12645852 | 3300012520 | Aqueous | MNDLFLEIADAPGEIFDIPEMRELDEDNKFDYNEYILSNIDY* |
Ga0163109_101445774 | 3300012936 | Surface Seawater | MNDFLTEIQDTPGEIFDIPEMQDLYNEKKFDIDEYLNADYDY* |
Ga0129343_10182113 | 3300012967 | Aqueous | LQLRQPPMNEYFEIADAPGEIFDIPEMQDLDSDKKFDVNEYLNGNYDY* |
Ga0129337_13008792 | 3300012968 | Aqueous | MFDELWSEIADAPGEIFDIPEMRDLDEDNKFDYNEYLLSNIDY* |
Ga0129338_15811182 | 3300012970 | Aqueous | MFDELWSEIADAPGEIFDIPEMRDLDEDNKFDYNEYILSNIDY* |
Ga0116836_10453322 | 3300013181 | Marine | MNDFFEIADAPGEIFDIPEMQDLYDEKKFDVEEYINGDIDY* |
Ga0116815_10040996 | 3300013195 | Marine | MFDELWSEIQDAPGEIFDIPEMQELDEDKKFDVNDYLNSDIDY* |
Ga0181391_10389002 | 3300017713 | Seawater | MNDLLTEIQDTPGEIFDIPEMQDLYNEKKFDLEEYLNADYDY |
Ga0181412_100135919 | 3300017714 | Seawater | MNDLLTEIQDTPGEIFDIPEMQDLYNEKKFDLEEYLNSDYDY |
Ga0181373_10435273 | 3300017721 | Marine | LTEIQDTPGEIFDIPEMQDLYNEKKFDIDEYLNADYDY |
Ga0181399_11283681 | 3300017742 | Seawater | RKLMNDLLTEIQDTPGEIFDIPEMQDLYNEKKFDLEEYLNSDYDY |
Ga0181389_10591574 | 3300017746 | Seawater | MITSVQPKAMNDLLTEIQDTPGEIFDIPEMQDLYNEKKFDLEEYLNSDYDY |
Ga0181565_100261835 | 3300017818 | Salt Marsh | MFDELWSEIQDAPGEIFDIPEMQELDEDKKFDVNDYLKSNIDY |
Ga0181565_104380533 | 3300017818 | Salt Marsh | MFDELWSEIADAPGEIFDIPEMQELDEDKKFNVNEYLNSNYDY |
Ga0181565_106874552 | 3300017818 | Salt Marsh | MNEYFEIADAPGEIFDIPEMQELESDDKFDVNEYLNGNYDY |
Ga0181552_100694475 | 3300017824 | Salt Marsh | MFDELWSEIQDAPGEIFDIPEMQELDEDKKFDVNDYLNSDIDY |
Ga0181584_1001753013 | 3300017949 | Salt Marsh | MNDFFDIADAPGEIYDIPEMQDLDDENKFDVNEYLNANYDY |
Ga0181584_101290392 | 3300017949 | Salt Marsh | MNDFFEIADAPGEIFDIPEMQDLDEDNKFDYNEYIMGNIDY |
Ga0181584_101744732 | 3300017949 | Salt Marsh | MITSVQTKPMNDLFLEIADAPGEIFDIPELQDLDDENKFNVDEYLNADYDY |
Ga0181584_101811164 | 3300017949 | Salt Marsh | MTDFFEIADAPGEIFDIPEMQELDDENKFDVNEYLNANYDY |
Ga0181584_101899694 | 3300017949 | Salt Marsh | MFDEFFAEIADAPGEIFDIPEMQDLDTENKFDVNEYLNGNYDY |
Ga0181584_102686976 | 3300017949 | Salt Marsh | MNDFFEIADAPGEIFDIPELQDLDDENKFDVNEYLNANYDY |
Ga0181584_104237242 | 3300017949 | Salt Marsh | MNEFFEIADAPGEIFDIPEMQELDSDDKFDVNEYLNANYDY |
Ga0181584_106657582 | 3300017949 | Salt Marsh | MFDEFFTEIADAPGEIFDIPEMQDLDSDKKFDMNEYLNGNYDY |
Ga0181584_107419162 | 3300017949 | Salt Marsh | MNDFFEIADAPGEIFDIPEMQDLDEENKFDYNEYILSNIDY |
Ga0181577_101467128 | 3300017951 | Salt Marsh | MNDFFEIADAPGEIFDIPELQELEDENKFDVNEYLNGNYDY |
Ga0181577_102056685 | 3300017951 | Salt Marsh | MNEYFEIADAPGEIFDIPEMQELDTDDKFDVNEYLNGNYDY |
Ga0181577_103643094 | 3300017951 | Salt Marsh | MNDFFEIADAPGEIFDIPEMQDLDDENKFDVNEYLNANYDY |
Ga0181583_1002740813 | 3300017952 | Salt Marsh | EIADAPGEIFDIPEMQELESDDKFDVNEYLNGNYDY |
Ga0181583_102609241 | 3300017952 | Salt Marsh | QGRHPMNEYFEIADAPGEIFDIPEMQELDSDDKFDVNEYLNANYDY |
Ga0181583_103371304 | 3300017952 | Salt Marsh | MNDLFLEIADAPGEIFDIPEMQDLDEEQKFNVDEYLNADYDY |
Ga0181583_103934891 | 3300017952 | Salt Marsh | MNEFFEIADAPGEIFDIPEMQELDSDDKFDVNEYLNGNYDYXCL |
Ga0181583_103989162 | 3300017952 | Salt Marsh | MTDFFEIADAPGEIFDIPELQELDEDNKFDVNEYLNGNYDY |
Ga0181583_105078433 | 3300017952 | Salt Marsh | MNEYFEIADAPGEIFDIPEMQELDSDDKFDVNEYLNGNYDY |
Ga0181583_106167662 | 3300017952 | Salt Marsh | MITSVQTNQPMNDFFEIADAPGEIFDIPEMQDLYDEKKFDVEEYINGDIDY |
Ga0181580_101067131 | 3300017956 | Salt Marsh | MTDFFEIADAPGEIFDIPELQELDDENKFDVNEYLNGNYDY |
Ga0181580_103029771 | 3300017956 | Salt Marsh | DFFEIADAPGEIFDIPEMQDLDDENKFNVDEYLNADYDY |
Ga0181580_103199013 | 3300017956 | Salt Marsh | MNEFFEIADAPGEIFDIPEMQELDSDDKFDVNEYLNGNYDY |
Ga0181580_110161582 | 3300017956 | Salt Marsh | MNDFFEIADAPGEIFDIPELQDLDEDNRFDYNEYIMGNIDY |
Ga0181571_107299023 | 3300017957 | Salt Marsh | MNEYFEIAVAPGEIFDIPEMQELDSDDKFDVNEYLNGNYDY |
Ga0181582_100399963 | 3300017958 | Salt Marsh | MITSVQTNQPMNDLFLEIAETPGEIFDIPEMQDLDDENKFNVDEYLNADYDY |
Ga0181582_107413291 | 3300017958 | Salt Marsh | MTDFFEIADAPGEIFDIPELQELDEDNKFDYNEYIMGNYDY |
Ga0181581_104630951 | 3300017962 | Salt Marsh | MNEYFEIADAPGEIFDIPEMQELDSDDKFDVNEYLN |
Ga0181581_106133572 | 3300017962 | Salt Marsh | MFDEFFAEIADAPGEIFDIPEMQDLDSENKFDVNEYLNGNYD |
Ga0181590_101291619 | 3300017967 | Salt Marsh | MNDFFEIADAPGEIFDIPELQELDDENKFDVNEYLNGNYDY |
Ga0181590_111038773 | 3300017967 | Salt Marsh | QLRQPPMNEYFEIADAPGEIFDIPEMQELDSDDKFDVNEYLNANYDY |
Ga0181590_111365103 | 3300017967 | Salt Marsh | FEIADAPGEIFDIPEMQELDSDDKFDVNEYLNGNYDY |
Ga0181587_106854713 | 3300017968 | Salt Marsh | MNEFFEIADAPGEIFDIPEMQELDSDDKFDVNEYLNGNYD |
Ga0181585_104398791 | 3300017969 | Salt Marsh | RQPPMNEYFEIADAPGEIFDIPEMQELDSDDKFDVNEYLNGNYDY |
Ga0181585_107004563 | 3300017969 | Salt Marsh | MNDLFLEIADAPGEIFDIPEMQDLDDENKFNVDEYLNADYDY |
Ga0181579_102210494 | 3300018039 | Salt Marsh | MNDLFLEIADAPGEIFDIPELQDLDDENKFNVDEYLNADYDY |
Ga0181592_102727891 | 3300018421 | Salt Marsh | MNDFFEIADAPGEIFDIPEMQDLDEDNKFDYNEYIMGN |
Ga0181592_105936352 | 3300018421 | Salt Marsh | MNEYFEIADAPGEIFDIPEMQELESDDKFDVNEYLNGNYD |
Ga0181592_108082213 | 3300018421 | Salt Marsh | MNDFFEIADAPGEIFDIPEMQDLDDENKFNVDEYLNADYDY |
Ga0181593_101845663 | 3300018423 | Salt Marsh | MITSVQTNQPMNDFFEIADAPGEIFDIPEMQDLDDENKFNVDEYLNADYDY |
Ga0181591_103027134 | 3300018424 | Salt Marsh | MNDFFEIADAPGEIFDIPELQELDDENKFDVNEYLNGNYDYXWKR |
Ga0182081_16575682 | 3300019277 | Salt Marsh | MFDEFFTEIADAPGEIFDIPEMQDLDDENKFDVNEYLNGNYDY |
Ga0194024_10834762 | 3300019765 | Freshwater | MNEYFEIADAPGEIFDIPEMQELDSDDKFDVNEYLNANYDY |
Ga0194024_11118262 | 3300019765 | Freshwater | MNEYFEIADAPGEIFDIPELQELDSENKFDMNEYLNSNYDY |
Ga0181594_104601251 | 3300020054 | Salt Marsh | LQLRQPPMNEYFEIADAPGEIFDIPEMQELDSDDKFDVNEYLNANYDY |
Ga0211501_10025174 | 3300020239 | Marine | MFDELWSEIQDAPGEIFDIPEMQELDEDKKFDVNDYLNSDIDF |
Ga0211654_10018957 | 3300020247 | Marine | MNDFLTEIQDAPGEIFDIPEMQDLYDEKKFDIEEYLNADYDY |
Ga0211522_10432483 | 3300020314 | Marine | MITSVQTNKPMNDFFEIADAPGEIFDIPEMQDLYDEKKFDVEEYINGDIDY |
Ga0211500_12444052 | 3300020371 | Marine | TSVQTNKPMNDFFEIADAPGEIFDIPEMQDLYDEKKFDVEEYINGDIDY |
Ga0211678_101127744 | 3300020388 | Marine | MNDLLTEIQDTPGEIFDIPEMQDLYDEKKFDLEEYLNADYDY |
Ga0211559_100079281 | 3300020442 | Marine | MNDFLTEIQDAPGEIFDIPEMQDLDDDNKFNVEEYLNADYDY |
Ga0211559_104245713 | 3300020442 | Marine | IQDAPGEIFDIPEMQDLDDDNKFNVEEYLNADYDY |
Ga0213860_104405721 | 3300021368 | Seawater | DPMFDELWSEIQDAPGEIFDIPEMQELDEDKKFNVTEYLNSNYDY |
Ga0222717_106506672 | 3300021957 | Estuarine Water | MNDFFEIADAPGEIFDIPELQELDEDNKFDVNEYLNANYDY |
Ga0222716_102799413 | 3300021959 | Estuarine Water | MNDFFEIADAPGEIFDIPEMQDLDSDDKFDVNEYLNANYDY |
Ga0222716_103766022 | 3300021959 | Estuarine Water | MFDEYFSEIADAPGEIFDIPEMQDLDSDKKFDVNEYLNGNYDY |
Ga0222716_107736661 | 3300021959 | Estuarine Water | MFDEFFTEIADAPGEIFDIPEMQDLDSENKFDVNEYLNGNYDY |
Ga0222715_1000810713 | 3300021960 | Estuarine Water | MNDFFEIADAPGEIFDIPEMQDLEEENKFDYNEYILSNIDY |
Ga0222715_1003915611 | 3300021960 | Estuarine Water | MFDEFFAEIADAPGEIFDIPEMQDLDSENKFDVNEYLNGNYDY |
Ga0222715_100988381 | 3300021960 | Estuarine Water | PTETTMFDEFFTEIADAPGEIFDIPEMQDLDSDKKFDMNEYLNGNYDY |
Ga0222715_102038433 | 3300021960 | Estuarine Water | MFDEYFAEIADAPGEIFDIPEMQDLDSDKKFDVNEYLNGNYDY |
Ga0222715_102492685 | 3300021960 | Estuarine Water | PMNEYFEIADAPGEIFDIPEMQDLDSDKKFDVNEYLNANYDY |
Ga0222715_106032131 | 3300021960 | Estuarine Water | MNDFFEIADAPGEIFDIPEMQDLDSENKFDVNEYLNANYDY |
Ga0222714_100106463 | 3300021961 | Estuarine Water | MNEYFEIADAPGEIFDIPEMQDLDTENKFDVNEYLNANYDY |
Ga0222719_105237311 | 3300021964 | Estuarine Water | MFDEFFTEIADAPGEIFDIPEMQDLDSENKFDVNEYL |
Ga0214917_1000044513 | 3300022752 | Freshwater | MEDTFWSEIYDAPGEIFDIPEMRDLDDENKFNIDEYINANYDY |
Ga0255756_11673121 | 3300022905 | Salt Marsh | WSEIQDAPGEIFDIPEMQELDEDKKFDVNDYLNSDIDY |
Ga0255755_11605774 | 3300022909 | Salt Marsh | MFDELWSEIQDAPGEIFDIPEMQELDEDKKFDVNDYLNSDID |
Ga0255780_101271964 | 3300022935 | Salt Marsh | MNDFFEIADAPGEIFDIPEMQDLDEDNKFDYNEYIMGNYDY |
Ga0255770_104423931 | 3300022937 | Salt Marsh | PMNEFFEIADAPGEIFDIPEMQELDSDDKFDVNEYLNGNYDY |
Ga0255770_104815592 | 3300022937 | Salt Marsh | MNDFFDIADAPGEIFDIPELQDLDEENKFDVNEYLNANYDY |
Ga0255764_100359491 | 3300023081 | Salt Marsh | MNDLFLEIADAPGEIFDIPEMQDLDEEQNFNVDEYLNADYDY |
Ga0255778_101822811 | 3300023084 | Salt Marsh | IADAPGEIFDIPEMQDLDEEQKFNVDEYLNADYDY |
Ga0255751_101728505 | 3300023116 | Salt Marsh | PMNEYFEIADAPGEIFDIPEMQELDSDDKFDVNEYLNGNYDY |
Ga0255766_100542501 | 3300023172 | Salt Marsh | QPPMNEYFEIADAPGEIFDIPEMQELDSDDKFDVNEYLNGNYDY |
Ga0255768_103916141 | 3300023180 | Salt Marsh | VLFLEIADAPGEIFDIPEMQDLDEEQKFNVDEYLNADYDY |
(restricted) Ga0233412_100831402 | 3300023210 | Seawater | MFDELWSEIADAPGEIFDIPEMRELDEDNEDKKFNVDEYLKSDYDYXRIKTFHTH |
Ga0209557_10053824 | 3300025483 | Marine | MFDELWSEIADAPGEIFDIPEMRELDEDNEDKKFNVDEYLKSDYDY |
Ga0208428_10523203 | 3300025653 | Aqueous | MNEYFEIADAPGEIFDIPELQELDSENKFDVNEYLNSNYDY |
Ga0208162_10300763 | 3300025674 | Aqueous | MYDELWSEIADAPGEIFDIPEMRELDEDKKFDVNDYLKSDYDY |
Ga0208162_11291583 | 3300025674 | Aqueous | MNEYFEIADAPGEIFDIPEMQELDSDKKFDVNEYLNGNYDY |
Ga0208162_11591622 | 3300025674 | Aqueous | RDMPGEIFDIPEMQELDEDEKFNVESYINSNYDYXXQL |
Ga0208644_12336712 | 3300025889 | Aqueous | MNEYFEIADAPGEIFDIPEMQELDTDDKFDVNEYLNANYDY |
Ga0208880_10916561 | 3300026085 | Marine | MNDFFEIADAPGEIFDIPEMQDLDEENQFDYNEYILS |
Ga0208880_11329751 | 3300026085 | Marine | PMNDFFEIADAPGEIFDIPEMQDLDEDNRFDYNEYIMGNIDY |
Ga0209536_1002197045 | 3300027917 | Marine Sediment | MNEYFEIADAPGEIFDIPEMQDLDSDKKFDVNEYLNGNYDY |
Ga0209299_10303635 | 3300027974 | Freshwater Lake | MEDTFWSEIYDAPGEIFDIPEMRDLDDENKFNIDEYLNANYDY |
Ga0257114_10257313 | 3300028196 | Marine | MNDFLTEIQDTPGEIFDIPEMQDLYNEKKFDLEEYLNSDYDY |
Ga0257114_11583942 | 3300028196 | Marine | MINSVQTKAMNDLLTEIQDTPGEIFDIPEMQDLYDEKKFDLEEYLNADYDY |
Ga0307376_105036232 | 3300031578 | Soil | MFDEFFSEIADAPGEIFDIPEMQDLDSENKFDVNEYLNGNYDY |
Ga0307377_105726321 | 3300031673 | Soil | MFDEFFSEIADAPGEIFDIPEMQDLDSENKFDVNEYLNAN |
Ga0334998_0727977_2_121 | 3300034019 | Freshwater | LWSEIADAPGEIFDIPELRDLDDENKFNVNEYLAADYDY |
Ga0335016_0188477_2_112 | 3300034166 | Freshwater | EIADAPGEIFDIPELRDLDDENKFNVNEYLAADYDY |
⦗Top⦘ |