| Basic Information | |
|---|---|
| Family ID | F030581 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 185 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MVNRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| Number of Associated Samples | 128 |
| Number of Associated Scaffolds | 185 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 9.19 % |
| % of genes near scaffold ends (potentially truncated) | 41.08 % |
| % of genes from short scaffolds (< 2000 bps) | 91.89 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.865 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.622 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.568 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (31.892 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 76.74% β-sheet: 0.00% Coil/Unstructured: 23.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 185 Family Scaffolds |
|---|---|---|
| PF01471 | PG_binding_1 | 2.16 |
| PF00072 | Response_reg | 1.62 |
| PF13248 | zf-ribbon_3 | 1.62 |
| PF00011 | HSP20 | 1.62 |
| PF08447 | PAS_3 | 1.08 |
| PF11298 | DUF3099 | 0.54 |
| PF03466 | LysR_substrate | 0.54 |
| PF14015 | DUF4231 | 0.54 |
| PF08241 | Methyltransf_11 | 0.54 |
| PF14534 | DUF4440 | 0.54 |
| PF13884 | Peptidase_S74 | 0.54 |
| PF11964 | SpoIIAA-like | 0.54 |
| PF13460 | NAD_binding_10 | 0.54 |
| PF01807 | zf-CHC2 | 0.54 |
| PF12706 | Lactamase_B_2 | 0.54 |
| PF08327 | AHSA1 | 0.54 |
| PF00805 | Pentapeptide | 0.54 |
| PF02033 | RBFA | 0.54 |
| PF12127 | FloA | 0.54 |
| PF13263 | PHP_C | 0.54 |
| PF01925 | TauE | 0.54 |
| COG ID | Name | Functional Category | % Frequency in 185 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 1.62 |
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.54 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.54 |
| COG0858 | Ribosome-binding factor RbfA | Translation, ribosomal structure and biogenesis [J] | 0.54 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.86 % |
| Unclassified | root | N/A | 35.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2065487018|GPINP_F5MS3JC02JXTGY | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
| 2088090014|GPIPI_17070481 | All Organisms → cellular organisms → Bacteria | 1959 | Open in IMG/M |
| 2088090014|GPIPI_17332085 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2184 | Open in IMG/M |
| 2088090014|GPIPI_17378231 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1181 | Open in IMG/M |
| 2088090014|GPIPI_17462348 | Not Available | 1021 | Open in IMG/M |
| 2088090014|GPIPI_17488854 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1105 | Open in IMG/M |
| 2170459005|F1BAP7Q02IYDF3 | Not Available | 506 | Open in IMG/M |
| 2170459010|GIO7OMY01AT07U | Not Available | 517 | Open in IMG/M |
| 2170459010|GIO7OMY02GRWXS | Not Available | 558 | Open in IMG/M |
| 2170459012|GOYVCMS01EZWK6 | Not Available | 504 | Open in IMG/M |
| 2189573004|GZGWRS401EB7A0 | Not Available | 516 | Open in IMG/M |
| 2199352025|deepsgr__Contig_172973 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → unclassified Spirochaetaceae → Spirochaetaceae bacterium | 740 | Open in IMG/M |
| 2209111022|2221200689 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1255 | Open in IMG/M |
| 2209111022|2221214458 | Not Available | 801 | Open in IMG/M |
| 3300000891|JGI10214J12806_12710689 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 923 | Open in IMG/M |
| 3300000956|JGI10216J12902_116902145 | Not Available | 711 | Open in IMG/M |
| 3300002902|JGI24803J43973_1007078 | Not Available | 502 | Open in IMG/M |
| 3300004643|Ga0062591_100930672 | Not Available | 819 | Open in IMG/M |
| 3300005165|Ga0066869_10135149 | Not Available | 522 | Open in IMG/M |
| 3300005169|Ga0066810_10106757 | Not Available | 626 | Open in IMG/M |
| 3300005186|Ga0066676_10333618 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1011 | Open in IMG/M |
| 3300005289|Ga0065704_10109787 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ginsengibacter → Ginsengibacter hankyongi | 1990 | Open in IMG/M |
| 3300005289|Ga0065704_10216434 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300005289|Ga0065704_10281518 | Not Available | 921 | Open in IMG/M |
| 3300005294|Ga0065705_10014528 | All Organisms → cellular organisms → Bacteria | 1972 | Open in IMG/M |
| 3300005294|Ga0065705_10211200 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1369 | Open in IMG/M |
| 3300005294|Ga0065705_10345176 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300005294|Ga0065705_10689029 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 658 | Open in IMG/M |
| 3300005295|Ga0065707_10277556 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → unclassified Spirochaetaceae → Spirochaetaceae bacterium | 1056 | Open in IMG/M |
| 3300005328|Ga0070676_10262927 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1156 | Open in IMG/M |
| 3300005365|Ga0070688_100639243 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300005436|Ga0070713_100825110 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300005439|Ga0070711_100587854 | Not Available | 927 | Open in IMG/M |
| 3300005439|Ga0070711_101390689 | Not Available | 610 | Open in IMG/M |
| 3300005451|Ga0066681_10445295 | Not Available | 795 | Open in IMG/M |
| 3300005468|Ga0070707_101212784 | Not Available | 721 | Open in IMG/M |
| 3300005526|Ga0073909_10017668 | All Organisms → cellular organisms → Bacteria | 2275 | Open in IMG/M |
| 3300005543|Ga0070672_101545412 | Not Available | 595 | Open in IMG/M |
| 3300005548|Ga0070665_101604091 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 658 | Open in IMG/M |
| 3300005575|Ga0066702_10854213 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 542 | Open in IMG/M |
| 3300005615|Ga0070702_101785400 | Not Available | 513 | Open in IMG/M |
| 3300005618|Ga0068864_101435126 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 692 | Open in IMG/M |
| 3300005843|Ga0068860_100089605 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2929 | Open in IMG/M |
| 3300006028|Ga0070717_11298637 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300006028|Ga0070717_12040049 | Not Available | 516 | Open in IMG/M |
| 3300006163|Ga0070715_10209459 | Not Available | 995 | Open in IMG/M |
| 3300006163|Ga0070715_10514572 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 687 | Open in IMG/M |
| 3300006172|Ga0075018_10578998 | Not Available | 594 | Open in IMG/M |
| 3300006175|Ga0070712_100203026 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
| 3300006175|Ga0070712_100313028 | Not Available | 1274 | Open in IMG/M |
| 3300006175|Ga0070712_101014202 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 719 | Open in IMG/M |
| 3300006904|Ga0075424_100439614 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1392 | Open in IMG/M |
| 3300009093|Ga0105240_12503967 | Not Available | 534 | Open in IMG/M |
| 3300009100|Ga0075418_10317490 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1662 | Open in IMG/M |
| 3300009100|Ga0075418_12183335 | Not Available | 604 | Open in IMG/M |
| 3300009137|Ga0066709_103146125 | Not Available | 603 | Open in IMG/M |
| 3300009147|Ga0114129_10331787 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2019 | Open in IMG/M |
| 3300009156|Ga0111538_11832337 | Not Available | 764 | Open in IMG/M |
| 3300009174|Ga0105241_11464173 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 656 | Open in IMG/M |
| 3300009553|Ga0105249_11038194 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300010375|Ga0105239_11426202 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 800 | Open in IMG/M |
| 3300010401|Ga0134121_12244358 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 583 | Open in IMG/M |
| 3300011270|Ga0137391_10977395 | Not Available | 690 | Open in IMG/M |
| 3300012685|Ga0137397_10310853 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1174 | Open in IMG/M |
| 3300012882|Ga0157304_1064422 | Not Available | 596 | Open in IMG/M |
| 3300012891|Ga0157305_10177065 | Not Available | 595 | Open in IMG/M |
| 3300012896|Ga0157303_10020795 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1110 | Open in IMG/M |
| 3300012906|Ga0157295_10100712 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 792 | Open in IMG/M |
| 3300012907|Ga0157283_10203610 | Not Available | 626 | Open in IMG/M |
| 3300012914|Ga0157297_10378432 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 560 | Open in IMG/M |
| 3300012955|Ga0164298_11645566 | Not Available | 507 | Open in IMG/M |
| 3300012957|Ga0164303_10697038 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 684 | Open in IMG/M |
| 3300012958|Ga0164299_10001530 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 6617 | Open in IMG/M |
| 3300012958|Ga0164299_10084545 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium 13_1_20CM_3_54_17 | 1603 | Open in IMG/M |
| 3300012958|Ga0164299_10991713 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 618 | Open in IMG/M |
| 3300012960|Ga0164301_10047569 | All Organisms → cellular organisms → Bacteria | 2185 | Open in IMG/M |
| 3300012985|Ga0164308_12031545 | Not Available | 536 | Open in IMG/M |
| 3300012988|Ga0164306_10940314 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 707 | Open in IMG/M |
| 3300012989|Ga0164305_10438782 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1011 | Open in IMG/M |
| 3300012989|Ga0164305_11356423 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300013297|Ga0157378_10206309 | All Organisms → cellular organisms → Bacteria | 1861 | Open in IMG/M |
| 3300013297|Ga0157378_10748994 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1000 | Open in IMG/M |
| 3300015077|Ga0173483_10041313 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1726 | Open in IMG/M |
| 3300015077|Ga0173483_10750875 | Not Available | 557 | Open in IMG/M |
| 3300015371|Ga0132258_10922011 | All Organisms → cellular organisms → Bacteria | 2206 | Open in IMG/M |
| 3300015371|Ga0132258_11374856 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1784 | Open in IMG/M |
| 3300015371|Ga0132258_12935828 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1184 | Open in IMG/M |
| 3300015371|Ga0132258_13724668 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300015372|Ga0132256_100735897 | Not Available | 1102 | Open in IMG/M |
| 3300015372|Ga0132256_102375053 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 633 | Open in IMG/M |
| 3300015374|Ga0132255_104022220 | Not Available | 624 | Open in IMG/M |
| 3300018028|Ga0184608_10066198 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1456 | Open in IMG/M |
| 3300018028|Ga0184608_10239429 | Not Available | 798 | Open in IMG/M |
| 3300018051|Ga0184620_10313138 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300018054|Ga0184621_10186655 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300018072|Ga0184635_10110760 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1089 | Open in IMG/M |
| 3300018081|Ga0184625_10481928 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → unclassified Spirochaetaceae → Spirochaetaceae bacterium | 630 | Open in IMG/M |
| 3300019361|Ga0173482_10101080 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → unclassified Spirochaetaceae → Spirochaetaceae bacterium | 1047 | Open in IMG/M |
| 3300019362|Ga0173479_10167185 | Not Available | 896 | Open in IMG/M |
| 3300019867|Ga0193704_1072220 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 646 | Open in IMG/M |
| 3300019869|Ga0193705_1049328 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 871 | Open in IMG/M |
| 3300019883|Ga0193725_1007980 | All Organisms → cellular organisms → Bacteria | 3027 | Open in IMG/M |
| 3300019886|Ga0193727_1001345 | All Organisms → cellular organisms → Bacteria | 10132 | Open in IMG/M |
| 3300019886|Ga0193727_1007412 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 4373 | Open in IMG/M |
| 3300019886|Ga0193727_1097975 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 868 | Open in IMG/M |
| 3300019886|Ga0193727_1120332 | Not Available | 751 | Open in IMG/M |
| 3300019996|Ga0193693_1001219 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 5749 | Open in IMG/M |
| 3300019996|Ga0193693_1002419 | All Organisms → cellular organisms → Bacteria | 4285 | Open in IMG/M |
| 3300020000|Ga0193692_1002760 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 4594 | Open in IMG/M |
| 3300020004|Ga0193755_1058192 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1258 | Open in IMG/M |
| 3300020006|Ga0193735_1095692 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300020062|Ga0193724_1028742 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1185 | Open in IMG/M |
| 3300021078|Ga0210381_10387514 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300021344|Ga0193719_10122886 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1128 | Open in IMG/M |
| 3300021413|Ga0193750_1028671 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1277 | Open in IMG/M |
| 3300022694|Ga0222623_10394543 | Not Available | 526 | Open in IMG/M |
| 3300022756|Ga0222622_10379141 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 991 | Open in IMG/M |
| 3300022883|Ga0247786_1093958 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → unclassified Spirochaetaceae → Spirochaetaceae bacterium | 644 | Open in IMG/M |
| 3300023057|Ga0247797_1055729 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300024279|Ga0247692_1043629 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 692 | Open in IMG/M |
| 3300025315|Ga0207697_10497514 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300025914|Ga0207671_10776694 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 760 | Open in IMG/M |
| 3300025915|Ga0207693_10333296 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300025915|Ga0207693_10553537 | Not Available | 897 | Open in IMG/M |
| 3300025915|Ga0207693_10709745 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → unclassified Spirochaetaceae → Spirochaetaceae bacterium | 779 | Open in IMG/M |
| 3300025923|Ga0207681_10304237 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300025930|Ga0207701_10272144 | Not Available | 1475 | Open in IMG/M |
| 3300025932|Ga0207690_11400344 | Not Available | 585 | Open in IMG/M |
| 3300025933|Ga0207706_10668026 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300025934|Ga0207686_11290038 | Not Available | 599 | Open in IMG/M |
| 3300025939|Ga0207665_10329429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1148 | Open in IMG/M |
| 3300026041|Ga0207639_11619673 | Not Available | 607 | Open in IMG/M |
| 3300026075|Ga0207708_10279996 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1351 | Open in IMG/M |
| 3300026690|Ga0207494_100312 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 852 | Open in IMG/M |
| 3300026773|Ga0207566_103323 | Not Available | 581 | Open in IMG/M |
| 3300026802|Ga0207511_106566 | Not Available | 554 | Open in IMG/M |
| 3300026814|Ga0207586_100529 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300026816|Ga0207509_102917 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300026820|Ga0207603_105962 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 542 | Open in IMG/M |
| 3300026836|Ga0207612_1006462 | Not Available | 519 | Open in IMG/M |
| 3300027461|Ga0207601_115071 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 500 | Open in IMG/M |
| 3300027821|Ga0209811_10007890 | All Organisms → cellular organisms → Bacteria | 3409 | Open in IMG/M |
| 3300028608|Ga0247819_10645664 | Not Available | 642 | Open in IMG/M |
| 3300030844|Ga0075377_10068070 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 718 | Open in IMG/M |
| 3300030844|Ga0075377_10108260 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 833 | Open in IMG/M |
| 3300030844|Ga0075377_11787762 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → unclassified Spirochaetaceae → Spirochaetaceae bacterium | 673 | Open in IMG/M |
| 3300030916|Ga0075386_10062733 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300030916|Ga0075386_10088601 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300030916|Ga0075386_10089806 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1047 | Open in IMG/M |
| 3300030969|Ga0075394_10004276 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 840 | Open in IMG/M |
| 3300031122|Ga0170822_12821796 | Not Available | 511 | Open in IMG/M |
| 3300031231|Ga0170824_101643870 | Not Available | 644 | Open in IMG/M |
| 3300031231|Ga0170824_115739570 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1259 | Open in IMG/M |
| 3300031231|Ga0170824_116420361 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300031231|Ga0170824_121729792 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 508 | Open in IMG/M |
| 3300031231|Ga0170824_122286665 | Not Available | 888 | Open in IMG/M |
| 3300031231|Ga0170824_123629735 | Not Available | 1557 | Open in IMG/M |
| 3300031231|Ga0170824_126563882 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 933 | Open in IMG/M |
| 3300031446|Ga0170820_11733540 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 701 | Open in IMG/M |
| 3300031446|Ga0170820_12625491 | Not Available | 696 | Open in IMG/M |
| 3300031446|Ga0170820_12635935 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 662 | Open in IMG/M |
| 3300031446|Ga0170820_12907113 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300031446|Ga0170820_13647553 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 550 | Open in IMG/M |
| 3300031446|Ga0170820_14007443 | Not Available | 719 | Open in IMG/M |
| 3300031446|Ga0170820_15821920 | Not Available | 1484 | Open in IMG/M |
| 3300031469|Ga0170819_12314383 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1788 | Open in IMG/M |
| 3300031469|Ga0170819_17051860 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300031474|Ga0170818_104194536 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300031474|Ga0170818_106225058 | Not Available | 723 | Open in IMG/M |
| 3300031474|Ga0170818_111117098 | Not Available | 591 | Open in IMG/M |
| 3300031547|Ga0310887_10443114 | Not Available | 773 | Open in IMG/M |
| 3300031716|Ga0310813_12012121 | Not Available | 545 | Open in IMG/M |
| 3300031720|Ga0307469_11723314 | Not Available | 604 | Open in IMG/M |
| 3300031740|Ga0307468_101551250 | Not Available | 616 | Open in IMG/M |
| 3300031820|Ga0307473_10562856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 780 | Open in IMG/M |
| 3300031943|Ga0310885_10753033 | Not Available | 550 | Open in IMG/M |
| 3300032075|Ga0310890_10482758 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 938 | Open in IMG/M |
| 3300032174|Ga0307470_10586666 | Not Available | 831 | Open in IMG/M |
| 3300032180|Ga0307471_100001886 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11815 | Open in IMG/M |
| 3300032180|Ga0307471_100810117 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1103 | Open in IMG/M |
| 3300032180|Ga0307471_103461442 | Not Available | 559 | Open in IMG/M |
| 3300033412|Ga0310810_10354206 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1542 | Open in IMG/M |
| 3300033412|Ga0310810_10549845 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300033412|Ga0310810_10737162 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 906 | Open in IMG/M |
| 3300033412|Ga0310810_10839031 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 821 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 10.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.32% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.78% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.24% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.70% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.70% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.16% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.16% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.16% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 1.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.62% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.08% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.08% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.08% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.08% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.08% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.08% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.08% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.08% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.54% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.54% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.54% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.54% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002902 | Soil microbial communities from Manhattan, Kansas, USA - Sample 400um Nextera | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300023057 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6 | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026690 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A4a-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300026773 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A5-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300026802 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO22-C (SPAdes) | Environmental | Open in IMG/M |
| 3300026814 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A3-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026816 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO21-B (SPAdes) | Environmental | Open in IMG/M |
| 3300026820 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO21-A (SPAdes) | Environmental | Open in IMG/M |
| 3300026836 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A2-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027461 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE15-E (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPINP_00704410 | 2065487018 | Soil | MVNRFTILVAKFLHIPDRAAVWVIWAAGIAVVIIIGIIVMLWR |
| GPIPI_01513350 | 2088090014 | Soil | MKTQRESRRMVGRFTKMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| GPIPI_00466410 | 2088090014 | Soil | MVSRFTIRVAKFLHIPDWAAVYVIWGAWIAVVIIIGIIVMLWR |
| GPIPI_03352030 | 2088090014 | Soil | MVNRFTIVVAKFLHIPDGAAVYVIWAAWIAVVIIIGI |
| GPIPI_00414290 | 2088090014 | Soil | MKTQRESRRMVSRFTIRVAKFLHIPDWAAVYVIWGAWIAVVIIIGIIVMLWR |
| GPIPI_00818560 | 2088090014 | Soil | MVNRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIG |
| E41_01536460 | 2170459005 | Grass Soil | RIKSPSPSNPMKTQRESRRMVSRFAIMVAKFLHIPDWAAVYVIWAAWIAVVITIGIIVMLWR |
| F62_00116270 | 2170459010 | Grass Soil | MVSRFAIMVAKFLHIPDWAAVYVIWAAWIAVVIIIGIVVMLWR |
| F62_05491790 | 2170459010 | Grass Soil | RRMVGRFTKMVAKFLHIPDGAAVYVIWAAWMAVIIIIGIIVMLWR |
| N56_04104640 | 2170459012 | Grass Soil | MKTQRESRRRVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVAYS |
| FG2_06560610 | 2189573004 | Grass Soil | KTQRESRRMVGRFTKMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| deepsgr_02922140 | 2199352025 | Soil | SNPMKTQRESRRRVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| 2222027509 | 2209111022 | Grass Soil | IMVAKFLHIPDWAAVYVIWAAWIAVVIIIGIIVMLWR |
| 2222056913 | 2209111022 | Grass Soil | MKTQRESRRRVSRFTIMVAKFLHIPDGAAVYIIWAAWIAVVVIIGIIVMLWR |
| JGI10214J12806_127106891 | 3300000891 | Soil | TIMVAKFLHIPDGAAVWVIWAALIAVVIIIGMIAIPWR* |
| JGI10216J12902_1169021451 | 3300000956 | Soil | MKTRRESRRRVSRFTIMVAKFLHIPDGAAVWVIWAALIAVVIIIGMIVIPWR* |
| JGI24803J43973_10070781 | 3300002902 | Soil | MVNRFTIMVAKFLHIPDRAAVWVIWAAGMAVVIIIGIIVMLWR* |
| Ga0062591_1009306721 | 3300004643 | Soil | QRESRRRVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVIYS* |
| Ga0066869_101351491 | 3300005165 | Soil | MKTQRESRRMVSRFAIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR* |
| Ga0066810_101067571 | 3300005169 | Soil | MKTQRESRRRVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR* |
| Ga0066676_103336181 | 3300005186 | Soil | PSNPMKTQRESRRMVSRFAIMVAKFLHIPDWAAVYVIWAAWIAVVIIIGIIVMLWR* |
| Ga0065704_101097874 | 3300005289 | Switchgrass Rhizosphere | MVNRFTIMVAKFLHIPDWAAVYVIWAAWIAVVIIIGIIVMLWR* |
| Ga0065704_102164342 | 3300005289 | Switchgrass Rhizosphere | MKTQRESRRMVGRFTKMVAKFLHIPDGAAVYVIWAAWMAVIIIIGIIVMLWR* |
| Ga0065704_102815182 | 3300005289 | Switchgrass Rhizosphere | MVNRFTIMVAKFLHIPDRAAVYVIWAAWIAVVIIIGIIVMLWR* |
| Ga0065705_100145281 | 3300005294 | Switchgrass Rhizosphere | MVNRFTIMVAKFLHIPDWAAVYVIWAAWIAVVIIIGIIVM |
| Ga0065705_102112003 | 3300005294 | Switchgrass Rhizosphere | MVGRFTKMVAKFLHIPDGAAVYVIWAAWMAVIIIIGIIVMLWR* |
| Ga0065705_103451763 | 3300005294 | Switchgrass Rhizosphere | MVNRFTILVAKFLHIPDRAAVWVIWAAGIAVVIIIGIIVMLWR* |
| Ga0065705_106890292 | 3300005294 | Switchgrass Rhizosphere | MKTQRESRRMVSRFTIMVAKFLHIPDWAAVYVIWAAWIAVVIIIGIIV |
| Ga0065707_102775561 | 3300005295 | Switchgrass Rhizosphere | MKTQRESQRMVGRFTKMVAKFLHIPDRAAVYVIWAAWVAVIIIIGIIVMLWR* |
| Ga0070676_102629272 | 3300005328 | Miscanthus Rhizosphere | MVKSPNPSNPMKTQRKSRRMVGRFTIMVAKFLHISDGAAVWVIWAALIAVVIIIGLIVIPWR* |
| Ga0070688_1006392432 | 3300005365 | Switchgrass Rhizosphere | MVGRFTIMVAKFLHISDGAAVWVIWAALIAVVIIIGLIVIPWR* |
| Ga0070713_1008251102 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSRFTIMVAKFLHIPDGAAVWVIWAAWIAVVIIIGLIVMLWR* |
| Ga0070711_1005878541 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTQRESRRRVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVVVIIGIIVMLWR* |
| Ga0070711_1013906891 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RRVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR* |
| Ga0066681_104452951 | 3300005451 | Soil | MVSRFAIMVAKFLHIPDWAAVYVIWAAWIAVVIIIGIIVMLWR* |
| Ga0070707_1012127842 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAQRKSRRMVNRFTIMVAKFLHIPDRAAVYVIWAAWIAVVIIIGIIVMLWR* |
| Ga0073909_100176682 | 3300005526 | Surface Soil | MVSRFAIMVAKFLHIPDWAAVYVIWAAWIAVVIIIGIIVILWR* |
| Ga0070672_1015454121 | 3300005543 | Miscanthus Rhizosphere | MNAQRKSRRTVSRFTIMVAKFLHIPDRAAVWVIWAAWIAVIIIIGIIVMLWR* |
| Ga0070665_1016040912 | 3300005548 | Switchgrass Rhizosphere | VIAGLVKSPNPSNPMKTQRKSRRMVGRFTIMVAKFLHISDGAAVWVIWAALIAVVIIIGLIV |
| Ga0066702_108542131 | 3300005575 | Soil | MVSRFTTMVAKFLHIPDGAAVWVIWAAWIAVVIIIGLLVMLWR* |
| Ga0070702_1017854001 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTQRKSRRMVGRFTIMVAKFLHISDGAAVWVIWAALIAVVIIIGLIVIPWR* |
| Ga0068864_1014351261 | 3300005618 | Switchgrass Rhizosphere | MVKSPNPSNPMKTQRKSRRMVGRFTIMVAKFLHISDGAAVWVIWAALIAVVIIIGL |
| Ga0068860_1000896053 | 3300005843 | Switchgrass Rhizosphere | LPGMVKSPNPSNPMKTQRKSRRMVGRFTIMVAKFLHISDGAAVWVIWAALIAVVIIIGLIVIPWR* |
| Ga0070717_112986372 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTQRESWRMVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVVVIIGIIVMLWR* |
| Ga0070717_120400491 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | SRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR* |
| Ga0070715_102094591 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | RMVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVVVIIGIIVMLWR* |
| Ga0070715_105145722 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTQRESRRMVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGLVVLLWR* |
| Ga0075018_105789981 | 3300006172 | Watersheds | MKTQRESSRMVSRFAIMVAKFLHIPDGAAVWVIWAAWIAVVIIIGIIVMLWR* |
| Ga0070712_1002030262 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVLLWR* |
| Ga0070712_1003130282 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MVAKFLHIPDGAAVYVIWAAWIAVVVIIGIIVMLWR* |
| Ga0070712_1010142023 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTQRESRRMVSRFAIMVAKFLHIPDRAAVYVIWAAWIAVV |
| Ga0075424_1004396142 | 3300006904 | Populus Rhizosphere | MVSRFTIMVAKFLHIPDRAAVWVIWAAWIAVIIIIGIIVMLWR* |
| Ga0105240_125039671 | 3300009093 | Corn Rhizosphere | MNAQRKSRRMVSRFTIMVAKFLHIPDRAAVWVIWAALIAVVIIIGLIVIPWR* |
| Ga0075418_103174901 | 3300009100 | Populus Rhizosphere | MVSRFTIMVAKFLHIPDRAAVWVIWAAWIAVIIII |
| Ga0075418_121833351 | 3300009100 | Populus Rhizosphere | MVNRFTIMVAKFLHIPDRAAVWVIWAAGIAVVIIIGIIVMLWR* |
| Ga0066709_1031461251 | 3300009137 | Grasslands Soil | MKTQRESRRMVSRFTIMVAKFLHIPDGAAVWVIWAAWIAVVIIIGLIVMLWR* |
| Ga0114129_103317871 | 3300009147 | Populus Rhizosphere | KSRRMVNRFTIMVAKFLHIPDRAAVYVIWAAWIAVVIIIGIIVMLWR* |
| Ga0111538_118323372 | 3300009156 | Populus Rhizosphere | MNAQRKSRRMVSRFTIMVAKFLHIPDRAAVWVIWAASIAVIIIIGIIVMLWR* |
| Ga0105241_114641731 | 3300009174 | Corn Rhizosphere | MKTERESRRRVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR* |
| Ga0105249_110381942 | 3300009553 | Switchgrass Rhizosphere | MVAKFLHIPDGAAVWVIWAAWIAVVIIIGIIVMLWR* |
| Ga0105239_114262021 | 3300010375 | Corn Rhizosphere | MKTRRESRRRVSRFTIMVAKFLHIPDGAAVWVIWAALIAVVIIIGLIVIPWR* |
| Ga0134121_122443581 | 3300010401 | Terrestrial Soil | MNAQRKSRRMVSRFTIMVAKFLHIPDRAAVYVIWAAWIAVVVIIGIIVMLWR* |
| Ga0137391_109773951 | 3300011270 | Vadose Zone Soil | ERIKSLNPSNPMNTQREYWRMVNRFTVRLAKFLHIPDWAAVFVIWTAWIAVVIIIAMLWG |
| Ga0137397_103108531 | 3300012685 | Vadose Zone Soil | MVSRFAIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR* |
| Ga0157304_10644221 | 3300012882 | Soil | MVNRFTIMVAKFLHIPDGAAVWVIWAAWIAVVIIIGIIVMLWR* |
| Ga0157305_101770651 | 3300012891 | Soil | MVGRFTIMVAKFLHIPDGAAVWVIWAALIAVVIIIGMIAIPWR* |
| Ga0157303_100207954 | 3300012896 | Soil | MVSRFTIMVAKFLHIPDRAAVYVIWAAWIAVIIIIGIIVMLWR* |
| Ga0157295_101007121 | 3300012906 | Soil | MVAKFLHIPDRAAVWVIWAAWIAVIIIIGIIVMLWR* |
| Ga0157283_102036103 | 3300012907 | Soil | MVSRFTIMVAKFLHIPDRAAVYVIWAAWIAVVIIIGIIVMLWR* |
| Ga0157297_103784322 | 3300012914 | Soil | TIMVAKFLHIPDRAAVWVIWAAWIAVIIIIGIIVMLWR* |
| Ga0164298_116455661 | 3300012955 | Soil | MVSRFAIIVAKFLHIPDGAAVYVIWAAWIAVVIIIGI |
| Ga0164303_106970381 | 3300012957 | Soil | MKTQRKSRRMVSRFAIIVAKFLHIPDGAAVYVIWAAWIA |
| Ga0164299_1000153011 | 3300012958 | Soil | FTIMVAKFLHTPDGAAVYVIWAAWIAVVIIIGIIVMLWR* |
| Ga0164299_100845453 | 3300012958 | Soil | MVNRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR* |
| Ga0164299_109917131 | 3300012958 | Soil | MKTERESRRRVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVV |
| Ga0164301_100475691 | 3300012960 | Soil | MVSRFAIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIV |
| Ga0164308_120315452 | 3300012985 | Soil | MVGPFTKMVAKFLHIPDRAAVWVIWAAWIAVIIIIGIIVMLWR* |
| Ga0164306_109403142 | 3300012988 | Soil | MVGRFTKMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR* |
| Ga0164305_104387822 | 3300012989 | Soil | MVAKFLRIPDGAAVYVIWAAWIAVVVIIGIIVMLWR |
| Ga0164305_113564231 | 3300012989 | Soil | MVSRFAIMVAKFLHIPDGAAVYVIWAAWMAVIIIIGIIVMLWR* |
| Ga0157378_102063094 | 3300013297 | Miscanthus Rhizosphere | MKTQRERRRRVSQFAIKVAKFLHISDGAAVWVIWAALIAVVIVIGIIVMLWR* |
| Ga0157378_107489942 | 3300013297 | Miscanthus Rhizosphere | MVGRFTIMVAKFLHISDGAAVWVIWAALIAVVIIIGLIVIP |
| Ga0173483_100413132 | 3300015077 | Soil | MVAKFLHIPDLAAVWVIWAAWIAVIIIIGIIVMLWR* |
| Ga0173483_107508752 | 3300015077 | Soil | MVSRFAIMVAKFLHIPDGAAVWVIWAAWIAVVIIIGIIVMLWR* |
| Ga0132258_109220111 | 3300015371 | Arabidopsis Rhizosphere | MVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR* |
| Ga0132258_113748561 | 3300015371 | Arabidopsis Rhizosphere | LRGMVKSPNPSNPMNTQRKSRRMVGRFTIMVAKFLHISDGAAVWVIWAALIAVVIIIGLIVIPWR* |
| Ga0132258_129358284 | 3300015371 | Arabidopsis Rhizosphere | MVRRFTIMVAKFLHIPDRAAVWVIWAAWIAVIIIIGIIVMLWR |
| Ga0132258_137246682 | 3300015371 | Arabidopsis Rhizosphere | MVNRFTIMVAKFLHIPDRAAVWVIWAAWIAVIIIIGIIVMLWR |
| Ga0132256_1007358971 | 3300015372 | Arabidopsis Rhizosphere | MVRRFTIMVAKFLHIPDRAAVWVIWAAWIAVVIIIGIIVMLWR* |
| Ga0132256_1023750531 | 3300015372 | Arabidopsis Rhizosphere | MNTQRKSRRMVGRFTIMVAKFLHISDGAAVWVIWAALIAVVIIIGLIVIPWR* |
| Ga0132255_1040222201 | 3300015374 | Arabidopsis Rhizosphere | RFTIMVAKFLHIPDRAAVWVIWAAWIAVIIIIGIIVMLWR* |
| Ga0184608_100661982 | 3300018028 | Groundwater Sediment | MVSRFTIMVAKFLHIPDSAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0184608_102394291 | 3300018028 | Groundwater Sediment | MKTQRESRRMVSRFAIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0184620_103131381 | 3300018051 | Groundwater Sediment | MVSRFTIMVAKFLHIPDGAAVYVMWAAWIAVVVIIGIIVMLWR |
| Ga0184621_101866551 | 3300018054 | Groundwater Sediment | MNTQRKSRRMVSRFTIMVAKFLHIPDGAAVYVMWAAWIAVVIIIGIIVMLWR |
| Ga0184635_101107601 | 3300018072 | Groundwater Sediment | MKTQRESRRMVSRFAIMVAKFLHIPDWAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0184625_104819282 | 3300018081 | Groundwater Sediment | MKTQRESRRMVGRFTKMVAKFLHIPDGAAVYVIWAARMAVIIIIGIIVMLWR |
| Ga0173482_101010802 | 3300019361 | Soil | MVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0173479_101671852 | 3300019362 | Soil | MVSRFTIMVAKFLHIPDRAAVWVIWAAWIAVIIIIGIIVMLWR |
| Ga0193704_10722201 | 3300019867 | Soil | MKTRRESWRMVHRFTIMVAKFLHIPDRAAVWFIWAAWIAVVIIIGIIVMLWR |
| Ga0193705_10493281 | 3300019869 | Soil | MNTQRKSRRMVSRFTIMVAKFLHIPDSAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0193725_10079805 | 3300019883 | Soil | MVSRFAIMVAKFLHIPDWAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0193727_10013458 | 3300019886 | Soil | MVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWK |
| Ga0193727_10074121 | 3300019886 | Soil | MVNRFTIVVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0193727_10979752 | 3300019886 | Soil | AIRVAKFLHIPDWAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0193727_11203321 | 3300019886 | Soil | MKTQRKSRRRVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIVIGIIIMLWR |
| Ga0193693_10012196 | 3300019996 | Soil | MVNRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVM |
| Ga0193693_10024191 | 3300019996 | Soil | TFPSNPMNTQRESRRMVNRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0193692_10027602 | 3300020000 | Soil | MVNRFTIMVAKFLHIPDWAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0193755_10581921 | 3300020004 | Soil | ALNRPTLPNPMKTQRKSRRRVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVVVIIGIIVMLWR |
| Ga0193735_10956922 | 3300020006 | Soil | MKTQRESRRMVGRFTKMVAKFLHIPDGAAVYVIWAAWIAVVVIIGIIVMLWR |
| Ga0193724_10287421 | 3300020062 | Soil | MKTQRESRRRVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWK |
| Ga0210381_103875141 | 3300021078 | Groundwater Sediment | WRMVSRFTIMVAKFLHIPDGAAVYVMWAAWIAVVVIIGIIVMLWR |
| Ga0193719_101228861 | 3300021344 | Soil | MKTQRESRRRVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVVVIIGIIVMLWR |
| Ga0193750_10286712 | 3300021413 | Soil | MKTQRESRRMVSRFAIMVAKFLHIPDGAAVYVIWAAWIAGVIIIGIIVMLWR |
| Ga0222623_103945432 | 3300022694 | Groundwater Sediment | PTLRTPMKTQRESRRMVSRFAIMVAKFLHIPDWAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0222622_103791411 | 3300022756 | Groundwater Sediment | AIIVAKFLHIPDWAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0247786_10939581 | 3300022883 | Soil | RIKSPNPSNPMKTQRESRRRVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0247797_10557291 | 3300023057 | Soil | MVGRFTKMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0247692_10436291 | 3300024279 | Soil | TRFTIMVAKFLHIPDGAAVWVIWAALIAVVIIIGLIVMPWR |
| Ga0207697_104975142 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | VAKFLHIPDGAAVWVIWAAWIAVVIIIGIIVMLWR |
| Ga0207671_107766942 | 3300025914 | Corn Rhizosphere | MKTQRKSRRMVGRFTIMVAKFLHISDGAAVWVIWAALIAVVIIIGLIVIPWR |
| Ga0207693_103332961 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | IMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVLLWR |
| Ga0207693_105535372 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTQRESRRRVSRFTIMVAKFLHIPDGAAVYVIWA |
| Ga0207693_107097453 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | IMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0207681_103042372 | 3300025923 | Switchgrass Rhizosphere | MKTQRKSRRMVSRFAIMVAKFLHIPDRAAVWVIWAAWIAVIIIIGIILMLWR |
| Ga0207701_102721441 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSRFTIMVAKFLHIPDWAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0207690_114003441 | 3300025932 | Corn Rhizosphere | MKTQRESRRRVSRFTKMVAKFLHIPDGAAVWVIWAAWIAVVIIIGIIVMLWR |
| Ga0207706_106680261 | 3300025933 | Corn Rhizosphere | MVAKFLHIPDGAAVWVIWAAWIAVVIIIGIIVMLWR |
| Ga0207686_112900381 | 3300025934 | Miscanthus Rhizosphere | MKTQRKSRRMVGRFTIMVAKFLHISDGAAVWVIWAALIAVVIVIGIIVMLWR |
| Ga0207665_103294292 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAQRKSRRMVSRFTIMVAKFLHIPDRAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0207639_116196731 | 3300026041 | Corn Rhizosphere | MKTQRESRRMVGRFTIMVAKFLHISDGAAVWVIWAALIAVVIIIGLIVIPWR |
| Ga0207708_102799961 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LPGMVKSPNPSNPMKTQRKSRRMVGRFTIMVAKFLHISDGAAVWVIWAALIAVVIIIGLIVIPWR |
| Ga0207494_1003122 | 3300026690 | Soil | MKTQRESRRRVSRFTKMVAKFLHIPDGAAVYVIWAAWIAVIIIIGIIVMLWR |
| Ga0207566_1033232 | 3300026773 | Soil | MKTQRESRRRVSRFTKMVAKFLHIPDRAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0207511_1065661 | 3300026802 | Soil | MVGRFTIMVAKFLHISDGAAVWVIWAALIAVVIIIGLIVIPWR |
| Ga0207586_1005292 | 3300026814 | Soil | MKTQRESRRRVSRFTKMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0207509_1029172 | 3300026816 | Soil | IKSPNPSNPMKTQRESRRMVGRFAIMVAKFLHIPDWAAVYVIWAAWIAVVIIIGIIVMLW |
| Ga0207603_1059621 | 3300026820 | Soil | MKTRRESRRRVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0207612_10064621 | 3300026836 | Soil | MKTQRESRRTVGRFTKMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0207601_1150712 | 3300027461 | Soil | MKTQRESRRMVSRFTIRVAKFLHIPDGAAVYVIWAAWIAVAIIIGIIVMLWR |
| Ga0209811_100078902 | 3300027821 | Surface Soil | MVSRFAIMVAKFLHIPDWAAVYVIWAAWIAVVIIIGIIVILWR |
| Ga0247819_106456641 | 3300028608 | Soil | MKTQRESRRMVGRFTKMVAKFLHIPDGAAVYVIWAAWMAVIIIIGIIVMLWR |
| Ga0075377_100680701 | 3300030844 | Soil | MKTQRESRRMVNRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0075377_101082602 | 3300030844 | Soil | MKTQRESRRRVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0075377_117877621 | 3300030844 | Soil | QRESRRMVGRFTKMVAKFLHIPDGAAVYVVWAAWMAVIIIIGIIVMLWR |
| Ga0075386_100627332 | 3300030916 | Soil | TIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0075386_100886014 | 3300030916 | Soil | KTQRESRRRVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVVVIIGIIVMLWR |
| Ga0075386_100898062 | 3300030916 | Soil | LKQVLVSNPSNPMKTQRESRRMVSRFAIMVAKFLHIPDWAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0075394_100042763 | 3300030969 | Soil | MVNRFTIMVAKFLHISDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0170822_128217961 | 3300031122 | Forest Soil | MKTQRESRRMVSRFAIMVAKFLHIPDGAAVYVIWAAWIAVVVIIGIIVMLWR |
| Ga0170824_1016438703 | 3300031231 | Forest Soil | MVNRFTIMVAKFLHISDGAAVYVIWAAWIAVVIIIGI |
| Ga0170824_1157395701 | 3300031231 | Forest Soil | MKTQRQSRRMVGRFTKMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVM |
| Ga0170824_1164203611 | 3300031231 | Forest Soil | MKTQRESRRMVGRFTKMVAKFLHIPDGAAVYVIWAA |
| Ga0170824_1217297922 | 3300031231 | Forest Soil | MKTQRESRRMVSRFAAMVAKFLHIPDWAAVYVIWAAWIAVVVIIGIIAMLWR |
| Ga0170824_1222866651 | 3300031231 | Forest Soil | MVNRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIV |
| Ga0170824_1236297352 | 3300031231 | Forest Soil | MKTQRESRRMVSRFAIMVAKFLHIPDGAAVYLIWAVWIAVVIIIGIIVMLWR |
| Ga0170824_1265638821 | 3300031231 | Forest Soil | IMVAKFLHIPDGAAVYVIWAAWIAVVVIIGIIVMLWR |
| Ga0170820_117335401 | 3300031446 | Forest Soil | MKTQRESRRMVGRFTRMVAKFLHIPDGAAVYVIWAAWMAVII |
| Ga0170820_126254911 | 3300031446 | Forest Soil | MVNRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGI |
| Ga0170820_126359352 | 3300031446 | Forest Soil | MKTQRESRRMVNRFTIMVAKFLHISDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0170820_129071131 | 3300031446 | Forest Soil | MKTQRESRRMVSRFAIMVAKFLHIPDGAAVWVIWAAWIAVVIIIGIIVMLWR |
| Ga0170820_136475531 | 3300031446 | Forest Soil | MKTQRESRRMVGRFAIMVAKFLHIPDWAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0170820_140074432 | 3300031446 | Forest Soil | MKTQRKSRRRVSRFTIRVAKFLHISDGAAVYVIWAAWIAVVIIIGIIA |
| Ga0170820_158219201 | 3300031446 | Forest Soil | VSRFAIMVAKFLHIPDGAAVYLIWAVWIAVVIIIGIIVMLWR |
| Ga0170819_123143833 | 3300031469 | Forest Soil | MVGRFTKMVAKFLHIPDGAAVYVIWAAWIAVVIII |
| Ga0170819_170518601 | 3300031469 | Forest Soil | RFTIMVAKFLHIPDGAAVYVIWAAWIAVVVIIGIIVMLWR |
| Ga0170818_1041945363 | 3300031474 | Forest Soil | FTIMVAKFLHIPDSAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0170818_1062250581 | 3300031474 | Forest Soil | MVNRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0170818_1111170982 | 3300031474 | Forest Soil | MVSRVAIMMAKSLHIPDGAAVYVIWAASMVVVIIIGIIVIL |
| Ga0310887_104431141 | 3300031547 | Soil | MKTRRESRRRVSRFTIMVAKVLHIPDGAAVWVIWAALIAVVIIIGMIVIPWR |
| Ga0310813_120121211 | 3300031716 | Soil | MNAQRKSRRMVNRFTIMVAKFLHIPDRAAVYVIWAAWIAVVI |
| Ga0307469_117233142 | 3300031720 | Hardwood Forest Soil | MKPQRESRRMVNRFTIVVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0307468_1015512502 | 3300031740 | Hardwood Forest Soil | MKTERESRRRVSRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0307473_105628562 | 3300031820 | Hardwood Forest Soil | MKPQRESRRMVNRFTIVVAKFLHIPDGAAVYVIWAAWIVVVIIIGIIVMLWR |
| Ga0310885_107530331 | 3300031943 | Soil | MKTRRESRRRVSRFTIMVAKVLHIPDGAAVWVIWAALIAVVIIIGMI |
| Ga0310890_104827582 | 3300032075 | Soil | SRRRVSRFTIMVAKVLHIPDGAAVWVIWAALIAVVIIIGMIVIPWR |
| Ga0307470_105866662 | 3300032174 | Hardwood Forest Soil | MKTQRESRRMVSRFAIMVAKFLHIPDGAAVWVIWAAWIAVVIIIG |
| Ga0307471_1000018862 | 3300032180 | Hardwood Forest Soil | MVAKFLHIPDGAAVYVIWGAWIAVVIIIGIIVMLWR |
| Ga0307471_1008101173 | 3300032180 | Hardwood Forest Soil | MKTQRESWRTVKGFRIMVAKFLHIPDWAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0307471_1034614421 | 3300032180 | Hardwood Forest Soil | PNPSNPMKTQRESRRMVSRFTIMVAKFLHISDGAAVYVIWAAWIAVIIIIGIIVMLWR |
| Ga0310810_103542061 | 3300033412 | Soil | MVSRFTIMVAKFLHIPDGAAVWVIWAAWIAVVIIIG |
| Ga0310810_105498451 | 3300033412 | Soil | NPMNTQRKSWRKVSRFTIMVAKFLHIPDRAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0310810_107371622 | 3300033412 | Soil | VNRFTIMVAKFLHIPDGAAVYVIWAAWIAVVIIIGIIVMLWR |
| Ga0310810_108390312 | 3300033412 | Soil | MVAKVLHIPDGAAVWVIWAALIAVVIIIGMIVIPWR |
| ⦗Top⦘ |