NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F023215

Metagenome / Metatranscriptome Family F023215

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F023215
Family Type Metagenome / Metatranscriptome
Number of Sequences 211
Average Sequence Length 52 residues
Representative Sequence MKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEV
Number of Associated Samples 169
Number of Associated Scaffolds 211

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 71.43 %
% of genes near scaffold ends (potentially truncated) 34.60 %
% of genes from short scaffolds (< 2000 bps) 93.84 %
Associated GOLD sequencing projects 153
AlphaFold2 3D model prediction Yes
3D model pTM-score0.69

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (95.735 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(12.796 % of family members)
Environment Ontology (ENVO) Unclassified
(30.806 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(45.498 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 52.63%    β-sheet: 0.00%    Coil/Unstructured: 47.37%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.69
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 211 Family Scaffolds
PF00036EF-hand_1 5.69
PF13405EF-hand_6 4.27
PF00071Ras 4.27
PF13499EF-hand_7 3.32
PF04387PTPLA 2.37
PF13833EF-hand_8 0.47



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.05 %
UnclassifiedrootN/A0.95 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000970|BBAY66_10079049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila737Open in IMG/M
3300001202|BBAY72_13208780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1353Open in IMG/M
3300001263|BBAY83_10291033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila504Open in IMG/M
3300001849|RCM26_1055205All Organisms → cellular organisms → Eukaryota1187Open in IMG/M
3300001850|RCM37_1227307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila759Open in IMG/M
3300002027|MIS_10156180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1646Open in IMG/M
3300003860|Ga0031658_1022752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1055Open in IMG/M
3300004112|Ga0065166_10058627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1302Open in IMG/M
3300004112|Ga0065166_10088256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1108Open in IMG/M
3300004802|Ga0007801_10027135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1738Open in IMG/M
3300004804|Ga0007796_10072912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1092Open in IMG/M
3300004833|Ga0071101_116863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida889Open in IMG/M
3300005069|Ga0071350_1006085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2672Open in IMG/M
3300005662|Ga0078894_10141862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2152Open in IMG/M
3300005662|Ga0078894_10351288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1335Open in IMG/M
3300005662|Ga0078894_10499813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1092Open in IMG/M
3300005662|Ga0078894_10707081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida889Open in IMG/M
3300005980|Ga0066798_10138167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida687Open in IMG/M
3300005987|Ga0075158_10130190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1456Open in IMG/M
3300005987|Ga0075158_10219543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1090Open in IMG/M
3300005987|Ga0075158_10241457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1032Open in IMG/M
3300005988|Ga0075160_10336261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida823Open in IMG/M
3300005989|Ga0075154_10168823All Organisms → cellular organisms → Eukaryota1265Open in IMG/M
3300006033|Ga0075012_10863521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida542Open in IMG/M
3300006037|Ga0075465_10016893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1411Open in IMG/M
3300006037|Ga0075465_10051549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida871Open in IMG/M
3300006056|Ga0075163_10514842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae → Euplotes → Euplotes harpa1311Open in IMG/M
3300006164|Ga0075441_10032072All Organisms → cellular organisms → Eukaryota2132Open in IMG/M
3300006394|Ga0075492_1541232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1622Open in IMG/M
3300006401|Ga0075506_1638801All Organisms → cellular organisms → Eukaryota960Open in IMG/M
3300006403|Ga0075514_1908708All Organisms → cellular organisms → Eukaryota1503Open in IMG/M
3300006415|Ga0099654_10921578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila512Open in IMG/M
3300006641|Ga0075471_10102840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1533Open in IMG/M
3300006641|Ga0075471_10230708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila956Open in IMG/M
3300006803|Ga0075467_10040776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2928Open in IMG/M
3300006803|Ga0075467_10108588All Organisms → cellular organisms → Eukaryota1642Open in IMG/M
3300006803|Ga0075467_10216755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1055Open in IMG/M
3300006803|Ga0075467_10731779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila503Open in IMG/M
3300006850|Ga0075491_1497274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila766Open in IMG/M
3300006875|Ga0075473_10110470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1093Open in IMG/M
3300006875|Ga0075473_10170469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila876Open in IMG/M
3300006917|Ga0075472_10032870All Organisms → cellular organisms → Eukaryota2416Open in IMG/M
3300006917|Ga0075472_10084848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1531Open in IMG/M
3300007169|Ga0102976_1125285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax1947Open in IMG/M
3300007177|Ga0102978_1229594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1527Open in IMG/M
3300007513|Ga0105019_1118818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1413Open in IMG/M
3300007552|Ga0102818_1066768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila709Open in IMG/M
3300007559|Ga0102828_1109695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila675Open in IMG/M
3300007561|Ga0102914_1081536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1013Open in IMG/M
3300007716|Ga0102867_1066054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida955Open in IMG/M
3300007725|Ga0102951_1181934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida593Open in IMG/M
3300007861|Ga0105736_1031310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1015Open in IMG/M
3300007953|Ga0105738_1085365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila555Open in IMG/M
3300008107|Ga0114340_1184502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila723Open in IMG/M
3300008111|Ga0114344_1179342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida695Open in IMG/M
3300008114|Ga0114347_1195247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila679Open in IMG/M
3300008116|Ga0114350_1041673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1734Open in IMG/M
3300008120|Ga0114355_1179419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida712Open in IMG/M
3300009071|Ga0115566_10721310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila552Open in IMG/M
3300009129|Ga0118728_1107102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1267Open in IMG/M
3300009159|Ga0114978_10079573All Organisms → Viruses → Predicted Viral2195Open in IMG/M
3300009180|Ga0114979_10372477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila839Open in IMG/M
3300009182|Ga0114959_10075028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1896Open in IMG/M
3300009185|Ga0114971_10578461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila622Open in IMG/M
3300009257|Ga0103869_10212051All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300009265|Ga0103873_1071839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila689Open in IMG/M
3300009265|Ga0103873_1088896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila625Open in IMG/M
3300009265|Ga0103873_1105301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila575Open in IMG/M
3300009432|Ga0115005_10191283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1594Open in IMG/M
3300009432|Ga0115005_11613027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila532Open in IMG/M
3300009436|Ga0115008_10268199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1213Open in IMG/M
3300009436|Ga0115008_10405078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila968Open in IMG/M
3300009436|Ga0115008_10531421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida842Open in IMG/M
3300009436|Ga0115008_10759377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida708Open in IMG/M
3300009466|Ga0126448_1025994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1390Open in IMG/M
3300009469|Ga0127401_1023848All Organisms → cellular organisms → Eukaryota1792Open in IMG/M
3300009507|Ga0115572_10765995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila521Open in IMG/M
3300009526|Ga0115004_10848648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida544Open in IMG/M
3300009537|Ga0129283_10398390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila592Open in IMG/M
3300009544|Ga0115006_10534114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1028Open in IMG/M
3300009599|Ga0115103_1360638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila502Open in IMG/M
3300009599|Ga0115103_1413256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida949Open in IMG/M
3300009627|Ga0116109_1129326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida563Open in IMG/M
3300009785|Ga0115001_10256433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1118Open in IMG/M
3300010297|Ga0129345_1144289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila863Open in IMG/M
3300010334|Ga0136644_10106998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1734Open in IMG/M
3300010354|Ga0129333_11579090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila536Open in IMG/M
3300010370|Ga0129336_10448765Not Available700Open in IMG/M
3300010389|Ga0136549_10230515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida793Open in IMG/M
3300010883|Ga0133547_11943796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1080Open in IMG/M
3300010885|Ga0133913_13514851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1021Open in IMG/M
3300010970|Ga0137575_10075492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida536Open in IMG/M
3300011009|Ga0129318_10009407All Organisms → Viruses → Predicted Viral1947Open in IMG/M
3300012182|Ga0136556_1121009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila655Open in IMG/M
3300012516|Ga0129325_1236666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila608Open in IMG/M
3300012935|Ga0138257_1081155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida589Open in IMG/M
3300012954|Ga0163111_10754307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida923Open in IMG/M
3300013004|Ga0164293_10539181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila765Open in IMG/M
3300013004|Ga0164293_10807616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila594Open in IMG/M
3300013004|Ga0164293_10833918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila583Open in IMG/M
3300013004|Ga0164293_10883269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila563Open in IMG/M
3300013005|Ga0164292_10910570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila551Open in IMG/M
3300013014|Ga0164295_10144696All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1766Open in IMG/M
3300013087|Ga0163212_1161177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila707Open in IMG/M
3300013094|Ga0164297_10343572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida570Open in IMG/M
3300013115|Ga0171651_1104475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea919Open in IMG/M
3300013295|Ga0170791_12568738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila509Open in IMG/M
3300013295|Ga0170791_13797551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1287Open in IMG/M
3300013295|Ga0170791_16141046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1125Open in IMG/M
3300015360|Ga0163144_11431096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila613Open in IMG/M
3300017719|Ga0181390_1145986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila599Open in IMG/M
3300017788|Ga0169931_10238960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1497Open in IMG/M
3300017964|Ga0181589_10679217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida647Open in IMG/M
3300017968|Ga0181587_10962489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila525Open in IMG/M
3300018420|Ga0181563_10150485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1464Open in IMG/M
3300018739|Ga0192974_1006370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1708Open in IMG/M
3300018770|Ga0193530_1006854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1948Open in IMG/M
3300018871|Ga0192978_1087026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida569Open in IMG/M
3300019021|Ga0192982_10028204All Organisms → Viruses → Predicted Viral1478Open in IMG/M
3300019048|Ga0192981_10157523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila897Open in IMG/M
3300019048|Ga0192981_10298883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila601Open in IMG/M
3300019153|Ga0192975_10007201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2589Open in IMG/M
3300020048|Ga0207193_1293633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1173Open in IMG/M
3300020074|Ga0194113_10223925All Organisms → Viruses → Predicted Viral1483Open in IMG/M
3300020146|Ga0196977_1103332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea659Open in IMG/M
3300020155|Ga0194050_1218205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida520Open in IMG/M
3300020159|Ga0211734_11088727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1255Open in IMG/M
3300020160|Ga0211733_11121670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea860Open in IMG/M
3300020172|Ga0211729_10924157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1395Open in IMG/M
3300020175|Ga0206124_10350509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida556Open in IMG/M
3300020179|Ga0194134_10090595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1528Open in IMG/M
3300020183|Ga0194115_10065827All Organisms → cellular organisms → Eukaryota2179Open in IMG/M
3300020183|Ga0194115_10182476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1055Open in IMG/M
3300020183|Ga0194115_10440550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila548Open in IMG/M
3300021336|Ga0210307_1086599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila536Open in IMG/M
3300024239|Ga0247724_1052378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila607Open in IMG/M
3300024239|Ga0247724_1056476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila587Open in IMG/M
3300024343|Ga0244777_10264296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1093Open in IMG/M
3300024343|Ga0244777_10666582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida625Open in IMG/M
3300024343|Ga0244777_10940126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila503Open in IMG/M
3300025138|Ga0209634_1195623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila778Open in IMG/M
3300025138|Ga0209634_1300705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea551Open in IMG/M
3300025375|Ga0208259_1009048All Organisms → cellular organisms → Eukaryota1593Open in IMG/M
3300025399|Ga0208107_1072451All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila580Open in IMG/M
3300025591|Ga0208496_1021054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1741Open in IMG/M
3300025626|Ga0209716_1072970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1046Open in IMG/M
3300025640|Ga0209198_1130251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida728Open in IMG/M
3300025645|Ga0208643_1084461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila898Open in IMG/M
3300025648|Ga0208507_1145333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila657Open in IMG/M
3300025684|Ga0209652_1093978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila888Open in IMG/M
3300025694|Ga0209406_1227515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida544Open in IMG/M
3300025732|Ga0208784_1036951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1533Open in IMG/M
3300025789|Ga0208499_1054908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila622Open in IMG/M
3300025848|Ga0208005_1014291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2421Open in IMG/M
3300025872|Ga0208783_10371299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila556Open in IMG/M
3300025887|Ga0208544_10078176All Organisms → Viruses → Predicted Viral1532Open in IMG/M
3300025894|Ga0209335_10208823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida890Open in IMG/M
3300025896|Ga0208916_10448765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila562Open in IMG/M
3300027254|Ga0208177_1004914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2168Open in IMG/M
3300027254|Ga0208177_1076990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila617Open in IMG/M
3300027256|Ga0208932_1029591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila988Open in IMG/M
3300027571|Ga0208897_1067183All Organisms → cellular organisms → Eukaryota937Open in IMG/M
3300027687|Ga0209710_1255211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila565Open in IMG/M
3300027712|Ga0209499_1034488All Organisms → Viruses → Predicted Viral2195Open in IMG/M
3300027714|Ga0209815_1030076All Organisms → cellular organisms → Eukaryota2132Open in IMG/M
3300027720|Ga0209617_10345502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila550Open in IMG/M
3300027771|Ga0209279_10079218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida932Open in IMG/M
3300027777|Ga0209829_10375043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila558Open in IMG/M
3300027781|Ga0209175_10469812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila520Open in IMG/M
3300027786|Ga0209812_10063495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1797Open in IMG/M
3300027786|Ga0209812_10166379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1029Open in IMG/M
3300027786|Ga0209812_10390952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida599Open in IMG/M
3300027810|Ga0209302_10097172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1490Open in IMG/M
3300027833|Ga0209092_10079589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1973Open in IMG/M
3300027833|Ga0209092_10389483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila732Open in IMG/M
3300027833|Ga0209092_10464348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida652Open in IMG/M
3300027849|Ga0209712_10199648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1139Open in IMG/M
3300027849|Ga0209712_10643086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida587Open in IMG/M
3300027851|Ga0209066_10166425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1356Open in IMG/M
3300027963|Ga0209400_1333552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida568Open in IMG/M
3300027971|Ga0209401_1252408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila633Open in IMG/M
(restricted) 3300028557|Ga0247832_1072187All Organisms → cellular organisms → Eukaryota1619Open in IMG/M
3300029910|Ga0311369_10227541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1714Open in IMG/M
3300029955|Ga0311342_10707559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila793Open in IMG/M
3300030596|Ga0210278_1042028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila836Open in IMG/M
3300030671|Ga0307403_10366980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida772Open in IMG/M
3300030699|Ga0307398_10111264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1359Open in IMG/M
3300030699|Ga0307398_10560512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila631Open in IMG/M
3300030788|Ga0073964_11395268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1079Open in IMG/M
3300031523|Ga0307492_10095130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1018Open in IMG/M
3300031569|Ga0307489_10323260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1005Open in IMG/M
3300031600|Ga0307930_1111965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila881Open in IMG/M
3300031638|Ga0302125_10041070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1600Open in IMG/M
3300031660|Ga0307994_1220000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila592Open in IMG/M
3300031717|Ga0307396_10052751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1687Open in IMG/M
3300031729|Ga0307391_10106734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1355Open in IMG/M
3300031750|Ga0307389_11020788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila549Open in IMG/M
3300031758|Ga0315907_10686960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila780Open in IMG/M
3300031758|Ga0315907_10687024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila780Open in IMG/M
3300031784|Ga0315899_10427612All Organisms → cellular organisms → Eukaryota1283Open in IMG/M
3300031788|Ga0302319_11306714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila661Open in IMG/M
3300031951|Ga0315904_10793118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila781Open in IMG/M
3300032050|Ga0315906_10226749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1736Open in IMG/M
3300032050|Ga0315906_10388659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1220Open in IMG/M
3300032616|Ga0314671_10736386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida528Open in IMG/M
3300033984|Ga0334989_0508086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida597Open in IMG/M
3300034022|Ga0335005_0131676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1605Open in IMG/M
3300034068|Ga0334990_0294852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila882Open in IMG/M
3300034355|Ga0335039_0380541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida729Open in IMG/M
3300034355|Ga0335039_0485466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila621Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine12.80%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous11.37%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater7.11%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.69%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine5.21%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.74%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent4.74%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater3.79%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.32%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater2.84%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.37%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.37%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.90%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.42%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.42%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface1.42%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.42%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.95%
WatershedsEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds0.95%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.95%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.95%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.95%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.95%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.47%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.47%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.47%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.47%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.47%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.47%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.47%
Sinkhole FreshwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater0.47%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.47%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.47%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.47%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.47%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.47%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.47%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.47%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.47%
Marine Subseafloor AquiferEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer0.47%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.47%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.47%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.47%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.47%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.47%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.47%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.47%
Marine Methane Seep SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment0.47%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.47%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.47%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.47%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.47%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.47%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000970Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY66Host-AssociatedOpen in IMG/M
3300001202Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY72Host-AssociatedOpen in IMG/M
3300001263Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY83Host-AssociatedOpen in IMG/M
3300001849Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2bEnvironmentalOpen in IMG/M
3300001850Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2aEnvironmentalOpen in IMG/M
3300002027Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5kEnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004802Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2MEnvironmentalOpen in IMG/M
3300004804Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0MEnvironmentalOpen in IMG/M
3300004833Mid-Atlantic Ridge North Pond Expedition - Sample 1383C DeepEnvironmentalOpen in IMG/M
3300005069Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005980Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203EnvironmentalOpen in IMG/M
3300005987Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNAEngineeredOpen in IMG/M
3300005988Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNAEngineeredOpen in IMG/M
3300005989Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNAEngineeredOpen in IMG/M
3300006033Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15EnvironmentalOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006056Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNAEngineeredOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006405Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006850Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007169Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007177Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007861Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3umEnvironmentalOpen in IMG/M
3300007953Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_3umEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009129Combined Assembly of Gp0139513, Gp0139514EnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300009257Microbial communities of water from Amazon river, Brazil - RCM22EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009469Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009537Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - D-2WEnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009627Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_10EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010334Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010389Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsfEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300010970Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016EnvironmentalOpen in IMG/M
3300011009Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNAEnvironmentalOpen in IMG/M
3300012182Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E6 #831EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300013094Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaGEnvironmentalOpen in IMG/M
3300013115Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300015360Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017964Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017968Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018770Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789454-ERR1719490)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020146Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13CEnvironmentalOpen in IMG/M
3300020155Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L239-10mEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020179Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0mEnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024239Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-EEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025375Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22May08 (SPAdes)EnvironmentalOpen in IMG/M
3300025399Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07 (SPAdes)EnvironmentalOpen in IMG/M
3300025591Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2M (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025648Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 (SPAdes)EnvironmentalOpen in IMG/M
3300025684Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025694Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025789Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027254Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027256Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027571Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027712Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027777Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027781Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes)EngineeredOpen in IMG/M
3300027786Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027851Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027971Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028557 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4mEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300030596Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031523Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3LEnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031600Saline water microbial communities from Organic Lake, Antarctica - #46EnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031660Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BBAY66_1007904913300000970Macroalgal SurfaceMKFSKDLLELRDKENKLVKMKRYEEAEKIKMKADLLE*
BBAY72_1320878013300001202Macroalgal SurfaceMKFSKDLLELRAKEAKLVKMKRYEEAEKVKMKADLLEEFERNKLDAEMHAIIEKKESKLRH*
BBAY83_1029103323300001263Macroalgal SurfaceMKFSKDLLELRAKEAKLVKMKRYEEAEKVKMKADLLEEFERNKLDAEMHAI
RCM26_105520533300001849Marine PlanktonMKYSRDLIDLRDREQKLVRVKRYEEAEKVKMKADLL
RCM37_122730723300001850Marine PlanktonMKQSRDLIDLRDREQKLVKVKRYEEAEKVKMKADLLEEFERNKIEAEVSVSN*
MIS_1015618023300002027Sinkhole FreshwaterMKFSKDLLELRDKEAKLVKMKRYEEAEKIKMKADLLEEFERNKLEAEM*
Ga0031658_102275223300003860Freshwater Lake SedimentMKFSKDLLELRDRESKLVRMKRYDEAERIKMKADLLEEFERNKLEAEM*
Ga0065166_1005862723300004112Freshwater LakeMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEV*
Ga0065166_1008825613300004112Freshwater LakeMKFSKDLLELRDKESKLVKAKRYEEAERAKMKADLLEEFERSK
Ga0007801_1002713553300004802FreshwaterMKYSRDLLELRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSFASD*
Ga0007796_1007291223300004804FreshwaterMKFSKDLLELRDRESKLVKLKRYDEAERIKMKADLLEEFERNKLEAEMQSIIEKKEA
Ga0071101_11686323300004833Marine Subseafloor AquiferMKFSRDLLELRDKETKLVKMKRYEEAEKVKLKADLLEQFERNKIEAEMAKMIEKKES*
Ga0071350_100608523300005069FreshwaterMKFSRDLLELRDKEAKLVRVKRYEEAEKVKMKADLLEEFERNKLEAEVCNIVSDLNYADLVYSFKFE*
Ga0078894_1014186243300005662Freshwater LakeMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEV*TF*
Ga0078894_1035128823300005662Freshwater LakeMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSKNEVLMIYFL*
Ga0078894_1049981323300005662Freshwater LakeMKYSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSFLTY*
Ga0078894_1070708123300005662Freshwater LakeMKYSRDLLELRDKEAKLVRVKRYEEAEKIKMKADLLEEFERNKLEAEVSFKSRLTLF*
Ga0066798_1013816733300005980SoilMKFSRDLLELRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSFKFHN*
Ga0075158_1013019013300005987Wastewater EffluentMKFSKDLLELRDKEAKLVKMKRYEEAEKVKMKADLLEEFERNKLEAEVKIILIKI*
Ga0075158_1021954323300005987Wastewater EffluentMKFSKDLLELRDKEAKLVKMKRYEEAEKVKMKADLLEEFEKNKLEAEVIMSFKV*
Ga0075158_1024145733300005987Wastewater EffluentMKYSKDLLELRDKEAKLVKMKRYEEAEKVKMKADLLEEFEKNKLEAEMQGI
Ga0075160_1033626113300005988Wastewater EffluentMKFSKDLLELRDKEAKLVKMKRYEEAEKVKMKADLLEEFERNKLEAEVYTTLFVLFSI*
Ga0075154_1016882353300005989Wastewater EffluentMKFSKDLLELRDKEAKLVKMKRYEEAEKVKMKADLLEEFERNKLEAEVYHSLKV*
Ga0075012_1086352113300006033WatershedsMKFSKDLLELRDKEAKLVKAKRYEEAEKVKMKADLLEEFERNKLEAEM*
Ga0075465_1001689333300006037AqueousMKFSRDLLELRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSLKG*
Ga0075465_1005154933300006037AqueousMKFSRDLLELRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSLA*
Ga0075163_1051484213300006056Wastewater EffluentMKKKFKFSKDLLELRNKEAMLVKPNDTEAEKIKMKADLLE*
Ga0075441_1003207223300006164MarineMKFSKDLLELRDKEAKLVRSKRYEEAEKIKMKADLLEEFERNKLEAEM*
Ga0075492_154123243300006394AqueousMKFSKDLLELRDKESKLVRMKRYEEAEKVKMKADLLEEFERNKLEAEMQAVI*
Ga0075506_163880133300006401AqueousMKFSKDLLELRDKEAKLVRSKRYEEAEKIKMKADLLEEFERNKLEAEMQTVLQKKEA
Ga0075514_190870843300006403AqueousMAKMKFSKDLLELRDKEAKLVKMKRYEEAEKVKMKADLLEEFERNKLEAEM*
Ga0075510_1103710323300006405AqueousLELRDKEAKLVKMKRYEEAEKVKMKADLLEEFERNKLEAEM*
Ga0099654_1092157813300006415LakeMKFSKDLLELRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEM*
Ga0075471_1010284043300006641AqueousMKYSRDLIDLRDREQKLVRVKRYEEAEKVKMKADLLEEFERNKLEAEVSETCD*
Ga0075471_1023070813300006641AqueousMKFSRDLLDLRDRESKLVKVKRYEDAEKVKLKADLLEEFERNK
Ga0075467_1004077623300006803AqueousMKFSRDLLELRDKEAKLVRSKRYEEAEKIKMKADLLEEFERNKLEAEVNRPLRLNSF*
Ga0075467_1010858853300006803AqueousMKFSKDLLELRDKEAKLVRMKRYEEAEKVKMKADLLEEFERNKLEAEVSDLQI*
Ga0075467_1021675513300006803AqueousMKFSKDLLELRDKESKLVRMKRYEEAEKVKMKADLLEEFERNKLEAEVSSPQSRS*
Ga0075467_1073177913300006803AqueousMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEE
Ga0075491_149727433300006850AqueousMKFSKDLLELRDKESKLVRMKRYEEAEKVKMKADSLEEFERNKLEAEMQAVI*
Ga0075473_1011047013300006875AqueousMKFSKDLLELRDREAKLVRMKRYDDAEKIKMKADLLEEFERNKLDAEMESVIEKKEAK
Ga0075473_1017046913300006875AqueousMKFSRDLLDLRDRESKLVKVKRYEDAEKVKLKADLLEEFERNKLEAEV
Ga0075472_1003287023300006917AqueousMKFSKDLLELRDKEAKLVRMKRYEEAEKVKMKADLLEEFERNKLEAEVSPPAVSISQI*
Ga0075472_1008484843300006917AqueousMKFSRDLLELRDKEAKLVRVKRYEEAEKVKMKADLIEEFERNKLEAEVCNIVSDLNYADLVYSFKFE*
Ga0102976_112528523300007169Freshwater LakeMKNSRDLLELRDRESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSKV*
Ga0102978_122959413300007177Freshwater LakeMKFSRDLIDLRDREQKLVRVKRYEEAEKVKMKADLLEEFERNKLEAEVSIFSA*
Ga0105019_111881833300007513MarineMKFSKDLLDLRDREAKFVRMKRYDDAEKIKMKADLLEEFERNKLDAEM*
Ga0102818_106676833300007552EstuarineMKFSKDLLDLRDREAKLVRMKRYDDAEKIKMKADLLEEFERNKLDAEM
Ga0102828_110969513300007559EstuarineMKNSRDLLELRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSV*
Ga0102914_108153623300007561EstuarineMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSKKELLMIYCL*
Ga0102867_106605433300007716EstuarineMKFSKDLLDLRNREAKIVRMKLYDEAEKIKMKADLLEEFE
Ga0102951_118193413300007725WaterLLELRDREAKLVRMKRYDEAEKIKMKADLLEEFERNKLEAEM*
Ga0105736_103131013300007861Estuary WaterMKFSKDLLELRDKEQKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSDIFIFV
Ga0105738_108536513300007953Estuary WaterMKFSKDLLELRDREAKLVRMKRYDEAERIKMKADLLEEFERNKLEAEM*
Ga0114340_118450213300008107Freshwater, PlanktonMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSKKELLIIYFL*
Ga0114344_117934213300008111Freshwater, PlanktonMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSKNELLMIYFL*
Ga0114347_119524713300008114Freshwater, PlanktonMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSKKSY*
Ga0114350_104167343300008116Freshwater, PlanktonMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEA
Ga0114355_117941923300008120Freshwater, PlanktonMKFSKDLLELRDKESKLVKVKRYEEAEKIKMKADLLE
Ga0115566_1072131033300009071Pelagic MarineMKFSKDLLELRDREAKLVRLKRYDEAERIKMKADLLEEFERNKLEAEM*
Ga0118728_110710223300009129MarineMKFSKDLLELRDKEAKLVRVKRYEEAEKIKMKADLLEEFERNKLEAEMQTVLQKKEAK
Ga0114978_1007957333300009159Freshwater LakeMKFSRDLLELRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSVTFT*
Ga0114979_1037247723300009180Freshwater LakeMKFSKDLLELRDRESKLVRTKRYDEAERIKMKADLLEEFERNKLEAEM*
Ga0114959_1007502823300009182Freshwater LakeMKYSRDLLELRDKEAKLVRVKRYEEAEKIKMKADLLEEFERNKLEAEVSFCRFT*
Ga0114971_1057846113300009185Freshwater LakeMKNSRDLLELRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSVWND*
Ga0103869_1021205113300009257River WaterMKQSRDLIDLRDREQKLVKVKRYEEAEKVKMKADLLEEFERNKIEAEMQAVIVKK
Ga0103873_107183923300009265Surface Ocean WaterMKFSKDLLELRDREAKLVRMKRYDEAERIKMKADLLEEFERQKLEAEMQAIIEKKEAQLRRNQ*
Ga0103873_108889613300009265Surface Ocean WaterKELMAKMKFSKDLLELRDKEAKLVKMKRYEEAEKVKMKADLLEEFERNKLEAEM*
Ga0103873_110530113300009265Surface Ocean WaterMKFSKDLLELRDREAKLVRMKRYDEAERIKMKADLLEEFERNKLEAEMQAVIEKKEAK
Ga0115005_1019128323300009432MarineMKFSRDLIELRDKEQKLVKMKRYEEAEKIKMKADLLEEFERNKLGSEVSNPITINFVL*
Ga0115005_1161302713300009432MarineMKFSKDLLELRDREAKLVRMKRYDEAERIKMKADLLEEFERNKLEAEMQ
Ga0115008_1026819923300009436MarineMELRSKMGSKFSRDLIALRDKEKKLVKMKRYEEAEKIKMKADLLEEFERNKLGAEVS*
Ga0115008_1040507813300009436MarineMKFSRDLNELRDKERKLVKMKRYEEAEKIKMKADLLEEFERNKLGAEVSIQL*
Ga0115008_1053142123300009436MarineMKFSKDLLELRDKEAKLVRVKRYEEAEKIKMKADLLEEFERNKLEAEMQTVL*
Ga0115008_1075937723300009436MarineMKFSKDLLELRDKEAKLVRMKRYEEAEKVKMKADLLEEFERNKLEAEVSL*
Ga0126448_102599423300009466Meromictic PondMKFSKDLLELRDREAKLVRMKRYDEAEKIKMKADLLEEFERNKLEAEM*
Ga0127401_102384843300009469Meromictic PondMKFSRDLLDLRDREGKLVKVKRYEEAEKIKMKADLLEEFERNKLESEVSSHNR*
Ga0115572_1076599513300009507Pelagic MarineMKFSKDLLELRDREAKLVRLKRYDEAERIKMKADLLEEF
Ga0115004_1084864823300009526MarineSKDLLELRDREAKLVRLKRYDEAERIKMKADLLEEFERNKLEAEMQAIIEKKDAKLR*
Ga0129283_1039839013300009537Beach Aquifer PorewaterMKFSRDLLELRDKEAKLVKMKRYEEAEKVKMKADLLEEFERNKLEAEVNIIA*
Ga0115006_1053411413300009544MarineMKFSRDLIELRDKEQKLVKMKRYEEAEKIKMKADLLEEFERNKLGSEVSNFIFTNFYFVL
Ga0115103_136063813300009599MarineMKFSKDLLDLRDREAKLVRVKRYEEAEKIKMKADLLEEFERNKLEAEM*
Ga0115103_141325613300009599MarineMKFSKDLLELRDKEAKLVRSKRYEEAEKIKMKADLLEEFERNKLE
Ga0116109_112932623300009627PeatlandMKFSKDLLELRDKEAKLVKMKRYEEAEKVKMKADLLEEFERNKLEAEM*
Ga0115001_1025643333300009785MarineMKFSKDLLELRDREAKLVRMKRYDEAERIKMKADLL
Ga0129345_114428913300010297Freshwater To Marine Saline GradientMKFSKDLLELRDREAKLVRMKRYDEAERIKMKADLLEEFERQKLEAEM
Ga0136644_1010699813300010334Freshwater LakeMKFSKDLIELRDKEAKLVKVKRYEEAEKIKMKADLLEEF
Ga0129333_1157909013300010354Freshwater To Marine Saline GradientLIDLRDREQKLVRVKRYEEAEKVKMKADLLEEFERNKLEAEVSETCD*
Ga0129336_1044876523300010370Freshwater To Marine Saline GradientMKYSRDLIDLRDREQKLVRVKRYEEAEKVKMKADLLEEFERNKLEAEVSML*
Ga0136549_1023051523300010389Marine Methane Seep SedimentMKYSKDLLELRDKEAKLVRMKRYEEAEKVKMKADLLEEFERNKLEAEVS*
Ga0133547_1194379633300010883MarineMKFSKDLLDLRDREAKFVRMKRYDDAEKIKMKADLLEEFERNKLDAEMQATMEKKEAKL
Ga0133913_1351485143300010885Freshwater LakeMKFSKDLIELRDKEAKLVKVKRYEEAEKIKMKADLLEE
Ga0137575_1007549213300010970Pond Fresh WaterDLIELRDRESKLVRMKRYDEAERIKMKGDLLEEFERSKLDTEMLGMVEKKEAKMRHSQ*
Ga0129318_1000940733300011009Freshwater To Marine Saline GradientMKFSRDLLELRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSVTFS*
Ga0136556_112100923300012182Saline LakeMKFSRDLLEMRDKESKLVKMKRYEEAEKIKMKADLLEEFERNKLEAEMQAIIEKKE
Ga0129325_123666613300012516AqueousMKFSKDLLELRDREAKLVRMKRYDEAERIKMKADLLEEFERNKLEAEMQAVIEKKEAKL
Ga0138257_108115513300012935Polar MarineMKFSKDLLELRDREAKLVRMKRYDEAERIKMKADLLEEFERNKLEAEMQAVI*
Ga0163111_1075430723300012954Surface SeawaterMKFSKDLLELRDREAKLVRMKRYDEAERIKMKADLLEEFERNKLEAE
Ga0164293_1053918113300013004FreshwaterMKFSKDLLELRDKEAKLVKAKRYEEAERVKMKADLLEEFERSKLDSEVITHKY*
Ga0164293_1080761613300013004FreshwaterMKFSKDLLELRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKL
Ga0164293_1083391813300013004FreshwaterRMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSKKELLIIYFL
Ga0164293_1088326913300013004FreshwaterKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEV*
Ga0164292_1091057013300013005FreshwaterFSKDLLELRDKEAKLVKAKRYEEAERVKMKADLLEEFERSKLDSEVMTHKC*
Ga0164295_1014469613300013014FreshwaterMKYSRDLLELRDKEAKLVRVKRYEEAEKIKMKADLLEEFERNKLEAEVSF*
Ga0163212_116117713300013087FreshwaterMKFSKDLLELRDKESKLVRAKRYEEAERVKMKADLLEEFERSKLESEM*
Ga0164297_1034357213300013094FreshwaterMKYSKDLLELRDKEGKLVKAKRYEEAERVKMKADLLEEFERSKLETDVRPKFFKPLFIDAKRP*
Ga0171651_110447513300013115MarineMKFSKDLLELRDKEAKLVRVKRYEEAEKIKMKADLLEEFERNKLEA
Ga0170791_1256873823300013295FreshwaterMKFSKDLLELRDRESKLVRTKRYDEAERIKMKADLLEEFERNKLEAEMQAIIEKKE
Ga0170791_1379755123300013295FreshwaterMKFSKDLIELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEMQGVL*
Ga0170791_1614104623300013295FreshwaterMKYSRDLLELRDKEAKLVRVKRYEEAEKIKMKADLLEEFERNKLEAEM*
Ga0163144_1143109623300015360Freshwater Microbial MatMKFSKDLLELRDKEAKLVKMKRYEEAEKVKMKADLLEEFERNKLEAEVRLNYIINVSVIRCKL*
Ga0181390_114598613300017719SeawaterEKIRKELKQKMKFSKDLLELRDREAKLVRLKRYDEAERIKMKADLLEEFERNKLEAEM
Ga0169931_1023896023300017788FreshwaterMKFSRDLIDLRDREQKLVRVKRYEEAEKVKMKADLLEEFERNKLEAEVSC
Ga0181589_1067921723300017964Salt MarshMKFSKDLLDLRDREAKLVRMKRYDDAEKLKMKADLLEEFERNKLDAEMEAVIEKREAKLRHT
Ga0181587_1096248913300017968Salt MarshMKFSKDLLDLRDREAKLVRMKRYDDAEKLKMKADLLEEFERNKLDAE
Ga0181563_1015048533300018420Salt MarshVKYSRDLIELRDREQKLVRVKRYEEAEKVKMKADLLEEFERNKIEAEVSLQLS
Ga0192974_100637023300018739MarineMKFSRDLNELRDKERKLVKMKRYEEAEKIKMKADLLEEFERNKLGAEVSIRLSASFHNLKYR
Ga0193530_100685423300018770MarineMKFSKDLLELRDKEAKLVRMKRYEEAEKVKMKADLLEEFERNKLEAEMQAVI
Ga0192978_108702623300018871MarineMKFSKDLLELRDREAKLVRMKRYDEAERIKMKADLLEEFERNKLEAEMQAIIEK
Ga0192982_1002820433300019021MarineMKFSRDLIELRDKEQKLVKMKRYEEAEKIKMKADLLEEFERNKLGTEVSKFNFSNLNFVL
Ga0192981_1015752333300019048MarineMELRNKMGSKFSRDLIALRDKEKKLVKMKRYEEAEKIKMKADLLEEFERNKLGAEMNTIT
Ga0192981_1029888313300019048MarineNELRARMKFSKDLLELRDKEAKLVRSKRYEEAEKIKMKADLLEEFERNKLEAEM
Ga0192975_1000720153300019153MarineMKFSKDLLELRDKEAKLVRMKRYEEAEKVKMKADLLEEFERNKLEAEVSH
Ga0207193_129363313300020048Freshwater Lake SedimentMKFSKDLLELRDRESKLVRMKRYDEAERIKMKADLLEEFERNKLEAEM
Ga0194113_1022392513300020074Freshwater LakeMKNSRDLLDLRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVRF
Ga0196977_110333223300020146SoilMKFSKDLIELRDKESKLVKMKKYDEAEKIKMKADLLEEFERNKLEAEVRYNNNGKV
Ga0194050_121820513300020155Anoxic Zone FreshwaterMKNSRDLLELRDKESKLVKVKRYEEAEKIKMKADLLEE
Ga0211734_1108872713300020159FreshwaterMKNSRDLLELRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSNEYT
Ga0211733_1112167013300020160FreshwaterMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLE
Ga0211729_1092415733300020172FreshwaterMKFSRDLLELRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSLKG
Ga0206124_1035050923300020175SeawaterMKFSRDLIELRDKEQKLVKMKRYEEAEKIKMKADLLEEFERNKLGSEVSNLMITNFYFVL
Ga0194134_1009059513300020179Freshwater LakeMKFSRDLIELRDREQKLVRVKRYEEAEKVKMKADLLEEFERNKLEAEVTIY
Ga0194115_1006582713300020183Freshwater LakeMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVXTFLNVFTFF
Ga0194115_1018247613300020183Freshwater LakeLRAKMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSEKDSLMIYCL
Ga0194115_1044055013300020183Freshwater LakeELRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSCN
Ga0210307_108659913300021336EstuarineLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSNPNSN
Ga0247724_105237813300024239Deep Subsurface SedimentMKFSKDLLDLRNREAKIVRMKLYDEAEKIKMKADLLEEFERNKLEAEM
Ga0247724_105647613300024239Deep Subsurface SedimentMKFSRDLLDLRDREQKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVRSILSVLHDS
Ga0244777_1026429613300024343EstuarineLRARMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSKKELLMIYCL
Ga0244777_1066658213300024343EstuarineMKYSRDLLELRDKEAKLVRVKRYEEAEKIKMKADLLEE
Ga0244777_1094012613300024343EstuarineMKNSRDLLELRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSV
Ga0209634_119562313300025138MarineMKFSKDLLELRDREAKLVRMKRYDEAERIKMKADLLEEFERNKLEAEM
Ga0209634_130070513300025138MarineMELRSKMGSKFSRDLIALRDKEKKLVKMKRYEEAEKIKMKADLLEEFERNKLGAEVS
Ga0208259_100904813300025375FreshwaterMKYSRDLLELRDKEAKLVRVKRYEEAEKIKMKADLLEEFERNKLEAEVS
Ga0208107_107245113300025399FreshwaterMKYSRDLLELRDKEAKLVRVKRYEEAEKIKMKADLLEEFERNKLEAEVSYCRFT
Ga0208496_102105433300025591FreshwaterMKYSRDLLELRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSFASD
Ga0209716_107297013300025626Pelagic MarineMKFSKDLLELRDREAKLVRLKRYDEAERIKMKADLLEEFERNKLEAEM
Ga0209198_113025133300025640Pelagic MarineMKFSKDLLELRDREAKLVRMKRYDEAERIKMKADLLEEFERNKLE
Ga0208643_108446113300025645AqueousMKFSKDLLELRDKESKLVRMKRYEEAEKVKMKADLLEEFERNKLEAEVSSPQSRS
Ga0208507_114533333300025648FreshwaterMKYSKDLLELRDKEGKLVKAKRYEEAERVKMKADLLEEFERSKLETDVRPTCFKP
Ga0209652_109397813300025684MarineMKFSKDLLELRDKENKLVRVKRYEEAEKVKMKADLLEEFERNKLEAEVRTILFFSPFLSYCLI
Ga0209406_122751513300025694Pelagic MarineMKFSKDLLELRDREAKLVRMKRYDEAERIKMKADLLEEFERNKLEAEMQAVIEKREAKLRHT
Ga0208784_103695113300025732AqueousMKYSRDLIDLRDREQKLVRVKRYEEAEKVKMKADLLEEFERNKLEAEVSETCD
Ga0208499_105490823300025789FreshwaterMKFSKDLLELRDRESKLVKLKRYDEAERIKMKADLLEEFERNKLEAEMQ
Ga0208005_101429143300025848AqueousMKFSKDLLELRDKEAKLVRMKRYEEAEKVKMKADLLEEFERNKLEAEVSPPAVSISQI
Ga0208783_1037129913300025872AqueousMKFSKDLLELRDKEAKLVRMKRYEEAEKVKMKADLLEE
Ga0208544_1007817623300025887AqueousMKFSRDLLELRDKEAKLVRSKRYEEAEKIKMKADLLEEFERNKLEAEVNRPLGLNSF
Ga0209335_1020882313300025894Pelagic MarineMKFSKDLLELRDREAKLVRMKRYDEAERIKMKADLLEEFERN
Ga0208916_1044876513300025896AqueousMKFSKDLLELRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEM
Ga0208177_100491413300027254EstuarineMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVXTF
Ga0208177_107699013300027254EstuarineLRARMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSKKELLMI
Ga0208932_102959113300027256EstuarineLRARMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSKNEVLMIYFL
Ga0208897_106718323300027571EstuarineMKFSKDLLDLRNREAKIVRMKLYDEAEKIKMKADLLEEFERNKL
Ga0209710_125521113300027687MarineMKFSKDLLELRDREAKLVRLKRYDEAERIKMKADLLEEFERNKLEAEMQSIIEKKEAK
Ga0209499_103448833300027712Freshwater LakeMKFSRDLLELRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSVTFT
Ga0209815_103007613300027714MarineMKFSKDLLELRDKEAKLVRSKRYEEAEKIKMKADLLEEFERNKLEAEM
Ga0209617_1034550213300027720Freshwater And SedimentDKIRHELRSRMKFSKDLLELRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEM
Ga0209279_1007921833300027771MarineMKFSKDLLELRDKEAKLVRMKRYEEAEKVKMKADLLEEFERNKLEAEVSRISHVREKGEE
Ga0209829_1037504313300027777Freshwater LakeMKYSRDLLELRDKEAKLVRVKRYEEAEKIKMKADLLEEFERNKLEAEVSFCRFT
Ga0209175_1046981213300027781Wastewater EffluentMKFSKDLLELRDKEAKLVKMKRYEEAEKVKMKADLLEEFERNKLEAEVYTTLFVLFSI
Ga0209812_1006349513300027786Wastewater EffluentMKFSKDLLELRDKEAKLVKMKRYEEAEKVKMKADLLEEFERNKLEAEVKIILIKI
Ga0209812_1016637923300027786Wastewater EffluentMKFSKDLLELRDKEAKLVKMKRYEEAEKVKMKADLLEEFERNKLEAEVYHSLKV
Ga0209812_1039095213300027786Wastewater EffluentMKFSKDLLELRDKEAKLVKMKRYEEAEKVKMKADLLEEFEKNKLEAEVIMSFKV
Ga0209302_1009717213300027810MarineMKFSRDLNELRDKERKLVKMKRYEEAEKIKMKADLLEEFERNKLGAEVSIQL
Ga0209092_1007958913300027833MarineMKFSRDLNELRDKERKLVKMKRYEEAEKIKMKADLLEEFERNKLGAEVSIQLXLFS
Ga0209092_1038948313300027833MarineMGSKFSRDLIALRDKEKKLVKMKRYEEAEKIKMKADLLEEFERNKLGAEVS
Ga0209092_1046434823300027833MarineMKFSKDLLELRDKEAKLVRVKRYEEAEKIKMKADLLEEFERNKLEAEMQTVL
Ga0209712_1019964823300027849MarineMKFSRDLIELRDKEQKLVKMKRYEEAEKIKMKADLLEEFERNKLGSEV
Ga0209712_1064308613300027849MarineRMKFSRDLIELRDKEQKLVKMKRYEEAEKIKMKADLLEEFERNKLGSEVSNPITINFVL
Ga0209066_1016642513300027851WatershedsMKFSKDLLELRDKEAKLVKAKRYEEAEKVKMKADLLEEFERNKLEAEM
Ga0209400_133355213300027963Freshwater LakeSKDLLELRDKEAKLVRAKRYEEAERVKMKADLLEEFERSKLDAEVIHLV
Ga0209401_125240813300027971Freshwater LakeMKFSKDLLELRDRESKLVRTKRYDEAERIKMKADLLEEFERNKLEAEMQVIIEKNEAKLRHT
(restricted) Ga0247832_107218723300028557FreshwaterMKFSKDLLELRDKEAKLVRAKRYEEAERVKMKADLLEEFERSKLDAEVILLL
Ga0311369_1022754123300029910PalsaMKFSKDLLELRDKESKLVKMKRYEEAEKVKMKADLLEEFERNKLEAEVKLAHIL
Ga0311342_1070755933300029955BogMKFSKDLLELRDKEAKLVKMKRYEEAEKVKMKADLLEEFEKNK
Ga0210278_104202823300030596SoilMKYSKDLIELRDKEQKLVKMKRYEEAEKVKMKADLLEEFESNKLEAEV
Ga0307403_1036698023300030671MarineMKWSKDLLELRDRESKLVRMKRYDEAERIKMKADLLEEF
Ga0307398_1011126433300030699MarineMKFSKDLLELRDKESKLVRVKRYEEAEKIKMKADLLEEFERNKLEAEMQTVL
Ga0307398_1056051213300030699MarineMKFSKDLLDLRDREAKLVRMKRYDDAEKLKMKADLLEEFERNKLDAEMESVIEKREAKLRHS
Ga0073964_1139526813300030788MarineMKFSKDLLELRDKEAKLVRLKRYEEAEKIKMKADLLEEFE
Ga0307492_1009513013300031523Sea-Ice BrineMKFSKDLLELRDKEAKLVRIKRYEEAEKVKMKADLLEEFEKNKLEAEM
Ga0307489_1032326023300031569Sackhole BrineMKFSKDLLELRDKEAKLVRMKRYEEAEKVKMKADLLEEFERNKLEAEVCTDISDLN
Ga0307930_111196523300031600Saline WaterMKFSRDLLEMRDKESKLVKMKRYEEAEKIKMKADLLEEFERNKLEA
Ga0302125_1004107023300031638MarineMKFSKDLLELRDKEAKLVRMKRYEEAEKVKMKADLLEEFERNKLEAEVSQ
Ga0307994_122000013300031660MarineMKFSRDLIELRDKEQKLVKMKRYEEAEKIKMKADLLEEFER
Ga0307396_1005275133300031717MarineMKFSKDLLELRDKEAKLVRMKRYEEAEKVKMKADLLEEFERNKLEAEMQAVVQKKEAKVR
Ga0307391_1010673413300031729MarineLLELRDKEAKLVRSKRYEEAEKIKMKADLLEEFERNKLEAEM
Ga0307389_1102078813300031750MarineRNELRARMKFSKDLLELRDKEAKLVRSKRYEEAEKIKMKADLLEEFERNKLEAEM
Ga0315907_1068696013300031758FreshwaterLRARMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSKKELLIIYFL
Ga0315907_1068702413300031758FreshwaterMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSKKSY
Ga0315899_1042761213300031784FreshwaterMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSKKELLIIYFL
Ga0302319_1130671413300031788BogMKFSKDLLELRDKEAKLVKMKRYEEAEKVKMKADLLEEFERNKLEAEVLIFTRIHKLL
Ga0315904_1079311813300031951FreshwaterLRARMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEV
Ga0315906_1022674913300032050FreshwaterMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLE
Ga0315906_1038865923300032050FreshwaterMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSKKELLMIYCL
Ga0314671_1073638613300032616SeawaterMKFSRDLIELRDKEQKLVKMKRYEEAEKIKMKADLL
Ga0334989_0508086_440_5953300033984FreshwaterMKFSRDLLELRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSFKF
Ga0335005_0131676_540_6863300034022FreshwaterMKFSKDLLELRDREAKLVRMKLYDDAERIKMKGDLLEEFERNKLESEL
Ga0334990_0294852_16_1773300034068FreshwaterMKYSRDLLELRDKESKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSNSLV
Ga0335039_0380541_1_1623300034355FreshwaterMKFSRDLLELRDKEAKLVKVKRYEEAEKIKMKADLLEEFERNKLEAEVSKKELL
Ga0335039_0485466_393_5453300034355FreshwaterMKFSKDLLELRDKEAKLVKMKRYEEAEKVKMKADLLEEFEKNKLEAEVIK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.