NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000970

3300000970: Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY66



Overview

Basic Information
IMG/M Taxon OID3300000970 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0085351 | Gp0056515 | Ga0011746
Sample NameMacroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY66
Sequencing StatusPermanent Draft
Sequencing CenterJ. Craig Venter Institute (JCVI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size653523679
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMacroalgal Surface Microbial Communities
TypeHost-Associated
TaxonomyHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Surface (saline)

Location Information
LocationBotany Bay, Sydney, NSW, Australia
CoordinatesLat. (o)-33.966629Long. (o)151.166614Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003009Metagenome / Metatranscriptome513Y
F023215Metagenome / Metatranscriptome211Y
F028441Metagenome / Metatranscriptome191Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
BBAY66_10001596All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes16232Open in IMG/M
BBAY66_10001795All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes14767Open in IMG/M
BBAY66_10079049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila737Open in IMG/M
BBAY66_11966336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata1982Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
BBAY66_10001596BBAY66_100015966F028441MTLKQLIKLENKAKEVWVVSPTLHYDTENKDFSELVSVNLGQKTKYRYIVPATSTVIKNINNYKKIYGVTEKEINKNFLILPESEFNPFLEETAIYNATTKPIACVAPATEEGNDVIKFCEETSKRMTKAFKALWKKYKRTNP*
BBAY66_10001795BBAY66_1000179515F028441MTLKQLIKLENKAKEVWVVSPTLHYDIENKDFSEIVSVNLGEKTKYRYIVPGTRLVEKNIKAYKKMYNVTEAEIATNFLILPVSEFNPFLEETAIYNATSDCIACCAPATENSNDVIKFNQDTSKAMAKAYKALWKKYKRTNP*
BBAY66_10079049BBAY66_100790491F023215MKFSKDLLELRDKENKLVKMKRYEEAEKIKMKADLLE*
BBAY66_11966336BBAY66_119663366F003009MKIPFQNYYKQNLRNITKYFIILSVKYHFLSAIFGFFIILTIVSQLISGTMLAFSLIPEPMLIPIIRDEEDLEDLYTDDFF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.