| Basic Information | |
|---|---|
| Family ID | F021544 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 218 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MANFDLSKLMEGKNPQSVMLAETRELKGKWEQTGLLEGLGE |
| Number of Associated Samples | 203 |
| Number of Associated Scaffolds | 218 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 40.55 % |
| % of genes near scaffold ends (potentially truncated) | 95.41 % |
| % of genes from short scaffolds (< 2000 bps) | 88.99 % |
| Associated GOLD sequencing projects | 198 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (52.294 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (10.092 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.651 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (65.596 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 218 Family Scaffolds |
|---|---|---|
| PF01165 | Ribosomal_S21 | 6.42 |
| PF07068 | Gp23 | 1.83 |
| PF01555 | N6_N4_Mtase | 0.46 |
| PF11450 | DUF3008 | 0.46 |
| PF14579 | HHH_6 | 0.46 |
| PF03420 | Peptidase_S77 | 0.46 |
| COG ID | Name | Functional Category | % Frequency in 218 Family Scaffolds |
|---|---|---|---|
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 6.42 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.46 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.46 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.46 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.32 % |
| Unclassified | root | N/A | 14.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2236876001|none_p196275 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 536 | Open in IMG/M |
| 3300000930|BpDRAFT_10109566 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 728 | Open in IMG/M |
| 3300001282|B570J14230_10015313 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2866 | Open in IMG/M |
| 3300001282|B570J14230_10037665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1673 | Open in IMG/M |
| 3300001344|JGI20152J14361_10060407 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 926 | Open in IMG/M |
| 3300001472|JGI24004J15324_10141592 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 566 | Open in IMG/M |
| 3300002696|Ga0005228J37280_1018573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 944 | Open in IMG/M |
| 3300003427|JGI26084J50262_1102694 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 583 | Open in IMG/M |
| 3300003474|NAP4_1069244 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 712 | Open in IMG/M |
| 3300003617|JGI26082J51739_10049868 | All Organisms → Viruses → Predicted Viral | 1322 | Open in IMG/M |
| 3300003645|NAP1_1059858 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 521 | Open in IMG/M |
| 3300003681|Ga0008457_1007458 | Not Available | 1460 | Open in IMG/M |
| 3300003721|Ga0008275_117637 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 506 | Open in IMG/M |
| 3300003908|JGI26085J52751_1010732 | All Organisms → Viruses → Predicted Viral | 1458 | Open in IMG/M |
| 3300004767|Ga0007750_1354920 | Not Available | 888 | Open in IMG/M |
| 3300004790|Ga0007758_10024875 | All Organisms → Viruses → Predicted Viral | 1178 | Open in IMG/M |
| 3300004795|Ga0007756_11584241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 961 | Open in IMG/M |
| 3300004836|Ga0007759_10206252 | All Organisms → Viruses → Predicted Viral | 1186 | Open in IMG/M |
| 3300005420|Ga0068879_1638128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1073 | Open in IMG/M |
| 3300005523|Ga0066865_10179312 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 790 | Open in IMG/M |
| 3300005527|Ga0068876_10337173 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 850 | Open in IMG/M |
| 3300005581|Ga0049081_10031764 | All Organisms → cellular organisms → Bacteria | 2006 | Open in IMG/M |
| 3300005837|Ga0078893_10326517 | All Organisms → Viruses → Predicted Viral | 2526 | Open in IMG/M |
| 3300006391|Ga0079052_1379105 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 845 | Open in IMG/M |
| 3300006400|Ga0075503_1092907 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 747 | Open in IMG/M |
| 3300006401|Ga0075506_1080168 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 928 | Open in IMG/M |
| 3300006401|Ga0075506_1106954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1416 | Open in IMG/M |
| 3300006403|Ga0075514_1117941 | All Organisms → Viruses → Predicted Viral | 1402 | Open in IMG/M |
| 3300006405|Ga0075510_10883813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
| 3300006867|Ga0075476_10105833 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1079 | Open in IMG/M |
| 3300006925|Ga0098050_1067592 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 928 | Open in IMG/M |
| 3300007333|Ga0079270_1216696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 830 | Open in IMG/M |
| 3300007539|Ga0099849_1048146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1783 | Open in IMG/M |
| 3300007603|Ga0102921_1127304 | Not Available | 924 | Open in IMG/M |
| 3300007622|Ga0102863_1172956 | Not Available | 635 | Open in IMG/M |
| 3300007712|Ga0102929_1088520 | All Organisms → Viruses → Predicted Viral | 1331 | Open in IMG/M |
| 3300007716|Ga0102867_1068498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
| 3300007862|Ga0105737_1092380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
| 3300007863|Ga0105744_1136785 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 609 | Open in IMG/M |
| 3300007960|Ga0099850_1267116 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 656 | Open in IMG/M |
| 3300007973|Ga0105746_1037260 | All Organisms → Viruses → Predicted Viral | 1498 | Open in IMG/M |
| 3300007974|Ga0105747_1355211 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 502 | Open in IMG/M |
| 3300008107|Ga0114340_1071497 | All Organisms → Viruses → Predicted Viral | 2044 | Open in IMG/M |
| 3300008113|Ga0114346_1089211 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1436 | Open in IMG/M |
| 3300008119|Ga0114354_1264636 | Not Available | 542 | Open in IMG/M |
| 3300009058|Ga0102854_1183879 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 599 | Open in IMG/M |
| 3300009086|Ga0102812_10153408 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1260 | Open in IMG/M |
| 3300009086|Ga0102812_10412929 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 735 | Open in IMG/M |
| 3300009158|Ga0114977_10749282 | Not Available | 517 | Open in IMG/M |
| 3300009433|Ga0115545_1099226 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1055 | Open in IMG/M |
| 3300009508|Ga0115567_10723826 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 595 | Open in IMG/M |
| 3300009543|Ga0115099_10381782 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 704 | Open in IMG/M |
| 3300009544|Ga0115006_12013494 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 531 | Open in IMG/M |
| 3300009550|Ga0115013_10536338 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 770 | Open in IMG/M |
| 3300009606|Ga0115102_10193250 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 668 | Open in IMG/M |
| 3300009677|Ga0115104_10669544 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 653 | Open in IMG/M |
| 3300009738|Ga0123379_1119769 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 711 | Open in IMG/M |
| 3300010299|Ga0129342_1206555 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 696 | Open in IMG/M |
| 3300010312|Ga0102883_1045569 | All Organisms → Viruses → Predicted Viral | 1305 | Open in IMG/M |
| 3300010312|Ga0102883_1217935 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 538 | Open in IMG/M |
| 3300011310|Ga0138363_1137952 | Not Available | 710 | Open in IMG/M |
| 3300011311|Ga0138370_1068736 | All Organisms → Viruses → Predicted Viral | 1321 | Open in IMG/M |
| 3300011317|Ga0138386_1115779 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 563 | Open in IMG/M |
| 3300012006|Ga0119955_1139399 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 647 | Open in IMG/M |
| 3300012504|Ga0129347_1030024 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 538 | Open in IMG/M |
| 3300012504|Ga0129347_1074687 | All Organisms → Viruses → Predicted Viral | 1449 | Open in IMG/M |
| 3300012518|Ga0129349_1310699 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 605 | Open in IMG/M |
| 3300012528|Ga0129352_10683615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1371 | Open in IMG/M |
| 3300012702|Ga0157596_1166003 | Not Available | 608 | Open in IMG/M |
| 3300012706|Ga0157627_1129498 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 569 | Open in IMG/M |
| 3300012731|Ga0157616_1037300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
| 3300012966|Ga0129341_1293491 | All Organisms → Viruses → Predicted Viral | 1103 | Open in IMG/M |
| 3300012970|Ga0129338_1324324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1251 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10638760 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 567 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10513905 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 727 | Open in IMG/M |
| 3300016727|Ga0182051_1110228 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 990 | Open in IMG/M |
| 3300016732|Ga0182057_1105578 | All Organisms → Viruses → Predicted Viral | 1413 | Open in IMG/M |
| 3300016734|Ga0182092_1048389 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 514 | Open in IMG/M |
| 3300016758|Ga0182070_1232982 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 791 | Open in IMG/M |
| 3300017717|Ga0181404_1004650 | All Organisms → Viruses → Predicted Viral | 3795 | Open in IMG/M |
| 3300017724|Ga0181388_1008729 | All Organisms → Viruses → Predicted Viral | 2644 | Open in IMG/M |
| 3300017749|Ga0181392_1058035 | All Organisms → Viruses → Predicted Viral | 1183 | Open in IMG/M |
| 3300017752|Ga0181400_1045053 | All Organisms → Viruses → Predicted Viral | 1379 | Open in IMG/M |
| 3300017753|Ga0181407_1098027 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 739 | Open in IMG/M |
| 3300017761|Ga0181356_1187459 | Not Available | 620 | Open in IMG/M |
| 3300017761|Ga0181356_1204431 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 583 | Open in IMG/M |
| 3300017763|Ga0181410_1037097 | All Organisms → Viruses → Predicted Viral | 1540 | Open in IMG/M |
| 3300017764|Ga0181385_1014351 | All Organisms → Viruses → Predicted Viral | 2533 | Open in IMG/M |
| 3300017764|Ga0181385_1162307 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 677 | Open in IMG/M |
| 3300017767|Ga0181406_1135060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
| 3300017777|Ga0181357_1335144 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 506 | Open in IMG/M |
| 3300017782|Ga0181380_1025730 | All Organisms → Viruses → Predicted Viral | 2175 | Open in IMG/M |
| 3300017783|Ga0181379_1119394 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 955 | Open in IMG/M |
| 3300017783|Ga0181379_1241207 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 626 | Open in IMG/M |
| 3300017785|Ga0181355_1303431 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 599 | Open in IMG/M |
| 3300017956|Ga0181580_10103170 | All Organisms → Viruses → Predicted Viral | 2087 | Open in IMG/M |
| 3300017956|Ga0181580_10481118 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 814 | Open in IMG/M |
| 3300018416|Ga0181553_10161506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1325 | Open in IMG/M |
| 3300018417|Ga0181558_10135375 | All Organisms → Viruses → Predicted Viral | 1483 | Open in IMG/M |
| 3300018420|Ga0181563_10110911 | All Organisms → Viruses → Predicted Viral | 1779 | Open in IMG/M |
| 3300018426|Ga0181566_10345893 | All Organisms → Viruses → Predicted Viral | 1067 | Open in IMG/M |
| 3300018428|Ga0181568_11270221 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 550 | Open in IMG/M |
| 3300018735|Ga0193544_1024022 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 613 | Open in IMG/M |
| 3300018876|Ga0181564_10517637 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 638 | Open in IMG/M |
| 3300019459|Ga0181562_10070177 | Not Available | 2071 | Open in IMG/M |
| 3300020014|Ga0182044_1220475 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1017 | Open in IMG/M |
| 3300020055|Ga0181575_10514260 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 640 | Open in IMG/M |
| 3300020109|Ga0194112_10078896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3065 | Open in IMG/M |
| 3300020151|Ga0211736_10840422 | All Organisms → Viruses → Predicted Viral | 2067 | Open in IMG/M |
| 3300020159|Ga0211734_10312893 | Not Available | 608 | Open in IMG/M |
| 3300020159|Ga0211734_10536252 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 657 | Open in IMG/M |
| 3300020178|Ga0181599_1231256 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 721 | Open in IMG/M |
| 3300020198|Ga0194120_10530108 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 525 | Open in IMG/M |
| 3300020200|Ga0194121_10049246 | Not Available | 3354 | Open in IMG/M |
| 3300020207|Ga0181570_10540263 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 527 | Open in IMG/M |
| 3300020252|Ga0211696_1044893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
| 3300020379|Ga0211652_10017023 | All Organisms → Viruses → Predicted Viral | 2179 | Open in IMG/M |
| 3300020385|Ga0211677_10321190 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Nonlabens → Nonlabens antarcticus | 615 | Open in IMG/M |
| 3300020404|Ga0211659_10017375 | Not Available | 3556 | Open in IMG/M |
| 3300020424|Ga0211620_10436825 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 553 | Open in IMG/M |
| 3300020429|Ga0211581_10077781 | All Organisms → Viruses → Predicted Viral | 1339 | Open in IMG/M |
| 3300020438|Ga0211576_10598568 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 549 | Open in IMG/M |
| 3300020446|Ga0211574_10208305 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 849 | Open in IMG/M |
| 3300020464|Ga0211694_10175067 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 874 | Open in IMG/M |
| 3300020527|Ga0208232_1049663 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 531 | Open in IMG/M |
| 3300020534|Ga0208596_1056954 | Not Available | 500 | Open in IMG/M |
| 3300020537|Ga0208722_1018763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1098 | Open in IMG/M |
| 3300020538|Ga0208595_1011660 | All Organisms → Viruses → Predicted Viral | 1560 | Open in IMG/M |
| 3300020562|Ga0208597_1048645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
| 3300020720|Ga0214252_1022520 | Not Available | 829 | Open in IMG/M |
| 3300021334|Ga0206696_1305339 | Not Available | 1517 | Open in IMG/M |
| 3300021345|Ga0206688_10921511 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 599 | Open in IMG/M |
| 3300021368|Ga0213860_10246133 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 784 | Open in IMG/M |
| 3300021373|Ga0213865_10125078 | Not Available | 1344 | Open in IMG/M |
| 3300021957|Ga0222717_10028543 | All Organisms → Viruses → Predicted Viral | 3699 | Open in IMG/M |
| 3300021960|Ga0222715_10422966 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 723 | Open in IMG/M |
| 3300021962|Ga0222713_10301410 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1021 | Open in IMG/M |
| 3300021962|Ga0222713_10630184 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 621 | Open in IMG/M |
| 3300021962|Ga0222713_10799735 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 526 | Open in IMG/M |
| 3300021977|Ga0232639_1391364 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Merostomata → Xiphosura → Limulidae → Limulus → Limulus polyphemus | 537 | Open in IMG/M |
| 3300023108|Ga0255784_10296567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
| 3300023110|Ga0255743_10322669 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 790 | Open in IMG/M |
| 3300023172|Ga0255766_10121025 | All Organisms → Viruses → Predicted Viral | 1540 | Open in IMG/M |
| 3300023176|Ga0255772_10080667 | All Organisms → Viruses → Predicted Viral | 2114 | Open in IMG/M |
| 3300023566|Ga0228679_1020839 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 676 | Open in IMG/M |
| 3300023566|Ga0228679_1029226 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 577 | Open in IMG/M |
| 3300023568|Ga0228696_1024060 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 706 | Open in IMG/M |
| 3300023693|Ga0232112_1030211 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 604 | Open in IMG/M |
| 3300023704|Ga0228684_1008365 | Not Available | 1470 | Open in IMG/M |
| 3300024183|Ga0228603_1002263 | All Organisms → Viruses → Predicted Viral | 2260 | Open in IMG/M |
| 3300024235|Ga0228665_1112831 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 559 | Open in IMG/M |
| (restricted) 3300024259|Ga0233437_1288174 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 644 | Open in IMG/M |
| 3300024266|Ga0228661_1081501 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 605 | Open in IMG/M |
| 3300024281|Ga0228610_1067976 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 523 | Open in IMG/M |
| 3300024289|Ga0255147_1095088 | Not Available | 550 | Open in IMG/M |
| 3300024296|Ga0228629_1132461 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 656 | Open in IMG/M |
| 3300024301|Ga0233451_10391286 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 504 | Open in IMG/M |
| 3300024343|Ga0244777_10616819 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 656 | Open in IMG/M |
| 3300024358|Ga0255173_1077594 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 552 | Open in IMG/M |
| 3300024420|Ga0228632_1138616 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 566 | Open in IMG/M |
| 3300024485|Ga0256318_1026707 | All Organisms → Viruses → Predicted Viral | 1211 | Open in IMG/M |
| 3300024496|Ga0255151_1043303 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 749 | Open in IMG/M |
| 3300024503|Ga0255152_1083740 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 542 | Open in IMG/M |
| 3300024505|Ga0255150_1067050 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 560 | Open in IMG/M |
| 3300024513|Ga0255144_1011512 | Not Available | 1543 | Open in IMG/M |
| 3300024515|Ga0255183_1013651 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2058 | Open in IMG/M |
| 3300024566|Ga0256309_1108005 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 698 | Open in IMG/M |
| 3300024855|Ga0255281_1057795 | Not Available | 794 | Open in IMG/M |
| 3300024863|Ga0255246_1021134 | Not Available | 1454 | Open in IMG/M |
| 3300024864|Ga0255271_1112022 | Not Available | 596 | Open in IMG/M |
| 3300024866|Ga0255272_1013087 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2013 | Open in IMG/M |
| 3300025084|Ga0208298_1005633 | All Organisms → Viruses → Predicted Viral | 3499 | Open in IMG/M |
| 3300025085|Ga0208792_1093738 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 526 | Open in IMG/M |
| 3300025617|Ga0209138_1170439 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 533 | Open in IMG/M |
| 3300025620|Ga0209405_1037511 | All Organisms → Viruses → Predicted Viral | 1785 | Open in IMG/M |
| 3300025636|Ga0209136_1117053 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 744 | Open in IMG/M |
| 3300025653|Ga0208428_1056602 | All Organisms → Viruses → Predicted Viral | 1177 | Open in IMG/M |
| 3300025676|Ga0209657_1193358 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 544 | Open in IMG/M |
| 3300025701|Ga0209771_1043257 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1704 | Open in IMG/M |
| 3300026136|Ga0208763_1029863 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 824 | Open in IMG/M |
| 3300026270|Ga0207993_1142801 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 628 | Open in IMG/M |
| 3300026420|Ga0247581_1054808 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 633 | Open in IMG/M |
| 3300026435|Ga0256297_1009435 | All Organisms → Viruses → Predicted Viral | 1407 | Open in IMG/M |
| 3300026447|Ga0247607_1053719 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 703 | Open in IMG/M |
| 3300026454|Ga0256319_1084411 | Not Available | 624 | Open in IMG/M |
| 3300026466|Ga0247598_1025380 | Not Available | 1641 | Open in IMG/M |
| 3300026468|Ga0247603_1052298 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 823 | Open in IMG/M |
| 3300026483|Ga0228620_1044828 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1019 | Open in IMG/M |
| 3300026491|Ga0228641_1100763 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 623 | Open in IMG/M |
| 3300026503|Ga0247605_1045814 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1090 | Open in IMG/M |
| 3300027186|Ga0208797_1019296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
| 3300027300|Ga0255140_1024792 | All Organisms → Viruses → Predicted Viral | 1212 | Open in IMG/M |
| 3300027595|Ga0255122_1085343 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 519 | Open in IMG/M |
| 3300027710|Ga0209599_10018038 | Not Available | 2020 | Open in IMG/M |
| 3300027751|Ga0208304_10358912 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 502 | Open in IMG/M |
| 3300027753|Ga0208305_10326789 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 533 | Open in IMG/M |
| 3300027772|Ga0209768_10152432 | All Organisms → Viruses → Predicted Viral | 1080 | Open in IMG/M |
| 3300027816|Ga0209990_10317474 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 694 | Open in IMG/M |
| 3300028102|Ga0247586_1011296 | All Organisms → Viruses → Predicted Viral | 1467 | Open in IMG/M |
| 3300028196|Ga0257114_1294633 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 562 | Open in IMG/M |
| 3300028334|Ga0247597_1025916 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 768 | Open in IMG/M |
| 3300030724|Ga0308138_1045233 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 620 | Open in IMG/M |
| 3300031706|Ga0307997_10094338 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1197 | Open in IMG/M |
| 3300031766|Ga0315322_10715431 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 628 | Open in IMG/M |
| 3300031784|Ga0315899_10032586 | All Organisms → Viruses | 5491 | Open in IMG/M |
| 3300032116|Ga0315903_10753366 | Not Available | 719 | Open in IMG/M |
| 3300033979|Ga0334978_0424210 | Not Available | 625 | Open in IMG/M |
| 3300033981|Ga0334982_0099666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1533 | Open in IMG/M |
| 3300033981|Ga0334982_0452595 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 575 | Open in IMG/M |
| 3300033995|Ga0335003_0143566 | Not Available | 1195 | Open in IMG/M |
| 3300034061|Ga0334987_0245672 | All Organisms → Viruses → Predicted Viral | 1223 | Open in IMG/M |
| 3300034062|Ga0334995_0439387 | Not Available | 804 | Open in IMG/M |
| 3300034062|Ga0334995_0713978 | Not Available | 562 | Open in IMG/M |
| 3300034082|Ga0335020_0239133 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 900 | Open in IMG/M |
| 3300034110|Ga0335055_0217602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
| 3300034117|Ga0335033_0244232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 946 | Open in IMG/M |
| 3300034283|Ga0335007_0295123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1065 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 10.09% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 10.09% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 8.26% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 8.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.34% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.88% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.96% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.50% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 5.50% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.21% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.21% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.29% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.83% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.83% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.38% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.38% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.38% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.92% |
| Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 0.92% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.46% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.46% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.46% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.46% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.46% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.46% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.46% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.46% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.46% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.46% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.46% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.46% |
| Pond Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil | 0.46% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2236876001 | Marine microbial communities from Columbia River, CM, sample from CR-7km from mouth, GS312-0p1-CR7-chlmax | Environmental | Open in IMG/M |
| 3300000930 | Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16m | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300002696 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_100m_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300003474 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 4 | Environmental | Open in IMG/M |
| 3300003617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA | Environmental | Open in IMG/M |
| 3300003645 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 1 | Environmental | Open in IMG/M |
| 3300003681 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_48_BLW_10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003721 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003908 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA | Environmental | Open in IMG/M |
| 3300004767 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004790 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004795 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005420 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006391 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 DCM_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006401 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006405 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300007333 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S12 Surf_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007712 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_B_D2_MG | Environmental | Open in IMG/M |
| 3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009543 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009738 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_244_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010312 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02 | Environmental | Open in IMG/M |
| 3300011310 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S2 DCM_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011311 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S23 DCM_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011317 | Marine microbial communities from the Southern Atlantic ocean - KN S17 DCM_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300012504 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012518 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012528 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012702 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012731 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012966 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300016727 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011510BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016732 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016734 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016758 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071403BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018735 | Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399747-ERR1328127) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020014 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020252 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX555968-ERR599022) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020424 | Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138) | Environmental | Open in IMG/M |
| 3300020429 | Marine microbial communities from Tara Oceans - TARA_B100000614 (ERX556134-ERR599032) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300020464 | Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020534 | Freshwater microbial communities from Lake Mendota, WI - 12JUL2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020537 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020538 | Freshwater microbial communities from Lake Mendota, WI - 28JUN2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020720 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021334 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021345 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021977 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Hafa_FS925 _150kmer | Environmental | Open in IMG/M |
| 3300023108 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG | Environmental | Open in IMG/M |
| 3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
| 3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300023566 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 18R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023568 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 84R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023693 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 29R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023704 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024183 | Seawater microbial communities from Monterey Bay, California, United States - 3D | Environmental | Open in IMG/M |
| 3300024235 | Seawater microbial communities from Monterey Bay, California, United States - 79D | Environmental | Open in IMG/M |
| 3300024259 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_200_MG | Environmental | Open in IMG/M |
| 3300024266 | Seawater microbial communities from Monterey Bay, California, United States - 75D | Environmental | Open in IMG/M |
| 3300024281 | Seawater microbial communities from Monterey Bay, California, United States - 11D | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024296 | Seawater microbial communities from Monterey Bay, California, United States - 36D | Environmental | Open in IMG/M |
| 3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024358 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d | Environmental | Open in IMG/M |
| 3300024420 | Seawater microbial communities from Monterey Bay, California, United States - 40D | Environmental | Open in IMG/M |
| 3300024485 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024496 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300024503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300024505 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300024515 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d | Environmental | Open in IMG/M |
| 3300024566 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024853 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024855 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024863 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024864 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024866 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025620 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes) | Environmental | Open in IMG/M |
| 3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025676 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026136 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes) | Environmental | Open in IMG/M |
| 3300026270 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 (SPAdes) | Environmental | Open in IMG/M |
| 3300026420 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026435 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026447 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026454 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026466 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026468 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026483 | Seawater microbial communities from Monterey Bay, California, United States - 23D | Environmental | Open in IMG/M |
| 3300026491 | Seawater microbial communities from Monterey Bay, California, United States - 52D | Environmental | Open in IMG/M |
| 3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027186 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes) | Environmental | Open in IMG/M |
| 3300027300 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8d | Environmental | Open in IMG/M |
| 3300027595 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028102 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300028334 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030724 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_949_20m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031706 | Marine microbial communities from David Island wharf, Antarctic Ocean - #36 | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| none_1962751 | 2236876001 | Marine Estuarine | MANFDLSKLMEGKNPQSVMLNETRQLKGKWEQTGLLEGLNEKSKAQCLFF |
| BpDRAFT_101095661 | 3300000930 | Freshwater And Marine | MANFDLSKLMEGKNPQAVMLNETRQLKGKWEQTGLLEGLNDK |
| B570J14230_100153135 | 3300001282 | Freshwater | MANFNVKSLLEAKNPQTVMLEQTRGLKTKWSKTGLLE |
| B570J14230_100376653 | 3300001282 | Freshwater | MNFDLNKLTEGKNPQSVMLEQTRGLRSKWEKTGLLEGMKER |
| JGI20152J14361_100604071 | 3300001344 | Pelagic Marine | MANFDLSKLMEGKNPQQVMLAETRELKGKWDQTGLLEGLGER |
| JGI24004J15324_101415921 | 3300001472 | Marine | MANFDLSKLMEGKNPQAVMLEQTRGLKNKWEQTGLLEGLNEREQ |
| Ga0005228J37280_10185732 | 3300002696 | Marine | MANFDLSKLMEGKNPQSVMLAETRELKGKWEQTGLLEGLGERE |
| JGI26084J50262_11026942 | 3300003427 | Marine | MANFDLSKLMEGRNPQAVMLNETRQLKGKWEATGLLEGLNAKEQGAMAVLL |
| NAP4_10692442 | 3300003474 | Estuarine | MANFDLSKLMEGKNPQSVMLAETRELKGKWEQTGLLEGLG |
| JGI26082J51739_100498682 | 3300003617 | Marine | MANFDLSKLMEGRNPQAVMLNETRQLKGKWEATGLLEGLNAKEQG |
| NAP1_10598581 | 3300003645 | Estuarine | MANFDLSKLMEGKNPQQVMLAETRELKGKWEQTGLLEGLG |
| Ga0008457_10074582 | 3300003681 | Seawater | MANFDLSKLMEGKNPQQVMLAETRELKGKWEQTGLLEGLGEREQSQVSV |
| Ga0008275_1176372 | 3300003721 | Marine | MANFDLNKLMEAKNPQQVMLNETRQLKGKWERTGLLEGLG |
| JGI26085J52751_10107322 | 3300003908 | Marine | MANFDLSKLMEGKNPQTVMLNETRQLKGKWEATGLLEGLNEKEQGAMSV |
| Ga0007750_13549201 | 3300004767 | Freshwater Lake | MAQFDLNKLMEGKNPTTIMLEQTRGLKHKWEKTGLLEGLTGATEEHGM |
| Ga0007758_100248752 | 3300004790 | Freshwater Lake | MANFDLSKLMEGKNPQAVMLAETRQLKSKWEKTGLLEGMKER |
| Ga0007756_115842411 | 3300004795 | Freshwater Lake | MNFDLNKLTEGKNPQSVMLEQTRGLRSKWEKTGLLEGMKERD |
| Ga0007759_102062521 | 3300004836 | Freshwater Lake | MANFDLSKLMEGKNPQAVMLAETRQLKSKWEKTGLLEGMK |
| Ga0068879_16381281 | 3300005420 | Freshwater Lake | MANFDLGKLMEGKNPQAVMLAETRQLKAKWEKTGLLEGMKEREQHSM |
| Ga0066865_101793122 | 3300005523 | Marine | MANFDLSKLMEGKNPQSVMLAETRELKGKWEQTGLLEGLNEREQSQISVLLE |
| Ga0068876_103371732 | 3300005527 | Freshwater Lake | MNFDLNKLTEGKNPQSVMLEQTRGLKAKWEKTGLLEGMKERDQHSM |
| Ga0049081_100317644 | 3300005581 | Freshwater Lentic | MANFNLSKLMEGRNPQAVMLAETRQLKNKWEATGLLE |
| Ga0078893_103265175 | 3300005837 | Marine Surface Water | MANFDLSKLMEGKNPQQVMLAETRELKGKWEQTGLL |
| Ga0079052_13791051 | 3300006391 | Marine | MANFDLSKLTEGKNPQSVMLEETRGLKTKWEQTGLLEGLKERDSHQMA |
| Ga0075503_10929072 | 3300006400 | Aqueous | MANFDLSKLMEGKNPQSVMLAETRELKGKWEQTGLLEG |
| Ga0075506_10801682 | 3300006401 | Aqueous | MANFDLSKLMEGKNPQSVMLAETRELKSKWEQTGLLEGL |
| Ga0075506_11069541 | 3300006401 | Aqueous | MANFDLNKLMEAKNPQAVMLEETRGLKAKWDRTGLLE |
| Ga0075514_11179412 | 3300006403 | Aqueous | MANFDLSKLMEGKNPQSVMLAETRQLKGKWESTGLLEG |
| Ga0075510_108838131 | 3300006405 | Aqueous | MANFDLSKLTEGKNPQSVMLEETRGLKNKWEQTGLLEG |
| Ga0075476_101058331 | 3300006867 | Aqueous | MANFDLNKLMEAKNPQAVMLEETRGLKAKWDRTGLLEGLKE |
| Ga0098050_10675922 | 3300006925 | Marine | MANFDLSKLTEGKNPQQVMLAETRQLTSKWEQTGLLEGLGEREQGQMSVLL |
| Ga0079270_12166962 | 3300007333 | Marine | MANFDLNKLMEGKNPQAVMLEETRGLKNKWEKTGLLEGL |
| Ga0099849_10481461 | 3300007539 | Aqueous | MANFDLNKLMEAKNPQSVMLEETRGLRSKWNRTGLLEGLRE |
| Ga0102921_11273042 | 3300007603 | Estuarine | MANFDLSKLMEGKNPTSIMLEQTRGLKNKWEKTGLLEGIDNKPQQH |
| Ga0102863_11729561 | 3300007622 | Estuarine | MANFDLSKLMEGKNPTSIMLEQTRGLKSKWEKTGL |
| Ga0102929_10885201 | 3300007712 | Pond Soil | MANFDLNKLMEAKNPQAVMLEETRGLKNKWERTGLLEGLGEIGK |
| Ga0102867_10684982 | 3300007716 | Estuarine | MANFDLSKLMEGKNPQAVMLAETRQLKSKWEKTGLLEGLKDKDQHSMAV |
| Ga0105737_10923803 | 3300007862 | Estuary Water | MANFDLSKLMEGKNPQQVMLAETRELKGKWEQPGLLEGLGEREQS |
| Ga0105744_11367851 | 3300007863 | Estuary Water | MANFDLSKLTEGKNPQSVMLAETRELKGKWEQTGLLEGLKEREQSQMSVL |
| Ga0099850_12671161 | 3300007960 | Aqueous | MASNLNVSKLMAGKNPRQVMLEETRGLRNKWDRTGLLHGLSETEQA |
| Ga0105746_10372602 | 3300007973 | Estuary Water | MANFDLSKLMEGKNPTSIMLEQTRGLKSKWEKTGLL |
| Ga0105747_13552112 | 3300007974 | Estuary Water | MANFDLGKLMEGKNPQAVMLAETRQLKQKWEKTGLLEGMKERE |
| Ga0114340_10714972 | 3300008107 | Freshwater, Plankton | MANFDLGKLMEGKNPQAVMLAETRQLKAKWEKTGLLEGMKEIYH* |
| Ga0114346_10892112 | 3300008113 | Freshwater, Plankton | MANFNLSKLMEGKNPQQIMLAETRQLRNKWAKTGLLEGLKEREQSQISVLLE |
| Ga0114354_12646362 | 3300008119 | Freshwater, Plankton | MANFDLTKLMEGKNPTSVMLEQTRGLKNKWEKTGLLEGIGEK |
| Ga0102854_11838791 | 3300009058 | Estuarine | MANFDLSKLTEGKNPQSVMLAETRELKSKWEQTGLLEGLGEREQSQIS |
| Ga0102812_101534082 | 3300009086 | Estuarine | MANFDLSKLMEGKNPQAVMLNETRQLKGKWEQTGLLEGL |
| Ga0102812_104129292 | 3300009086 | Estuarine | MANFDLSKLMEGKNPQQVMLAETRQLQAKWEKTGLLEGLKS |
| Ga0114977_107492822 | 3300009158 | Freshwater Lake | MAQFDLNKLMEGKNPTTIMLEQTRGLKHKWEKTGLLE |
| Ga0115545_10992261 | 3300009433 | Pelagic Marine | MANFDLSKLMEGKNPQQVMLAETRELKGKWDQTGLLEG |
| Ga0115567_107238262 | 3300009508 | Pelagic Marine | MANFDLSKLMEGKNPQSVMLAETRELKGKWEQTGLLE |
| Ga0115099_103817822 | 3300009543 | Marine | MANFDLSKLMEGKNPQSVMLAETRELKGKWEQTGLLEGLGEREQS |
| Ga0115006_120134941 | 3300009544 | Marine | MANFDLSKLMEGKNPQSVMLAETRQLKGKWEQTGL |
| Ga0115013_105363381 | 3300009550 | Marine | MANFDLNKLMEGKNPQSIMLQETRGLKNKWEKTGLLEGLKERDQHQM |
| Ga0115102_101932502 | 3300009606 | Marine | MANFDLSKLTEGKNPQSVMLAETRELKSKWEQTGLLEGLGERE |
| Ga0115104_106695442 | 3300009677 | Marine | MANFDLSKLTEGKNPQQVMLAETRQLTSKWEQTGLLEGLKEREQ |
| Ga0123379_11197691 | 3300009738 | Marine | MANFDLSKLMEGKNPQSVMLAETRQLKSKWDNTGLLEGLGE |
| Ga0129342_12065551 | 3300010299 | Freshwater To Marine Saline Gradient | MANFDLSKLMEGKNPQQVMLAETRELKAKWEQTGLLEGLKEREQSQ |
| Ga0102883_10455692 | 3300010312 | Estuarine | MANFDLSKLMEGKNPQAVMLAETRQLKAKWDKTGLLEGMKERDQH |
| Ga0102883_12179352 | 3300010312 | Estuarine | MANFNLSKLMEGRNPQAVMLAETRQLKSKWEATGLLEGLK |
| Ga0138363_11379521 | 3300011310 | Marine | MANFDLSKLTEGKNPQSVMLEETRGLKTKWEQTGLLEG |
| Ga0138370_10687362 | 3300011311 | Marine | MANFDLNKLMEGKNPQSVMLEETRGLKNKWEKTGLLEGLKER |
| Ga0138386_11157791 | 3300011317 | Marine | MANFDLSKLMEGKNPQAVMLEQTRGLKSKWENTGLLE |
| Ga0119955_11393991 | 3300012006 | Freshwater | MANFDLSKLMEGKNPQAVMLAETRQLKSKWEKTSLLEGMKERDQHSMAGLF* |
| Ga0129347_10300241 | 3300012504 | Aqueous | MANFDLSKLTEGKNPQQVMLAETRELKAKWEQTGLLEGLKEREQSQISVLLEN |
| Ga0129347_10746871 | 3300012504 | Aqueous | MANFDLSKLMEGKNPQSVMLAETRQLKGKWEATGLLEGLNEKE |
| Ga0129349_13106992 | 3300012518 | Aqueous | MANFDLNKLMEAKNPQSVMLEETRGLRSKWNRTGLLEGL |
| Ga0129352_106836152 | 3300012528 | Aqueous | MANFDLSKLMEGKNPQSVMLAETRELKSKWEQTGLLEGLGEREQSQISVLLE |
| Ga0157596_11660032 | 3300012702 | Freshwater | MANFNVKSLLEAENPQTVMLEQTRGLKTKWSKTGLLEGLK |
| Ga0157627_11294981 | 3300012706 | Freshwater | MANFDLSKLMEGKNPQAVMLAETRQLRNKWEKTGLLEG* |
| Ga0157616_10373001 | 3300012731 | Freshwater | MNFDLNKLTEGKNPQSVMLEQTRGLRAKWEKTGLLEGMKER |
| Ga0129341_12934912 | 3300012966 | Aqueous | MANFDLSKLTEAKNTQQVMLAETRQLQSYSQQTGLLAGLKEREQSQMAVLLEN |
| Ga0129338_13243241 | 3300012970 | Aqueous | MNLKKLMTGANPQSVMLEQTRGLKAKWEKTGLLEG |
| (restricted) Ga0172367_106387602 | 3300013126 | Freshwater | MANFDLSKLMEGKNPQQVMLAETRALRNKWEKTGL |
| (restricted) Ga0172373_105139051 | 3300013131 | Freshwater | MANFDLSKLMEGKNPQQVMLAETRALRNKWEKTGLL |
| Ga0182051_11102283 | 3300016727 | Salt Marsh | MANFDLSKLMEGKNPQTVMLNETRQLKGKWENTGLLEGLGEKE |
| Ga0182057_11055782 | 3300016732 | Salt Marsh | MANFDLSKLMEGKNPQQVMLSETRELRGKWEQTGLL |
| Ga0182092_10483891 | 3300016734 | Salt Marsh | MANFDLSKLTEGKNPQQVMLAETRELKAKWEQTGLLEGLKEREQSQISVL |
| Ga0182070_12329822 | 3300016758 | Salt Marsh | MANFDLSKLMEAKNPQSVMLEETRQLKGKWENTGLLEGLGEKEQG |
| Ga0181404_10046501 | 3300017717 | Seawater | MANFDLSKLMEGKNPQSVMLAETRELKGKWEQTGLLEGLGEREQSQISVL |
| Ga0181388_10087291 | 3300017724 | Seawater | MANFDLSKLMEGKNPQSVMLAETRQLKGKWEQTGLLE |
| Ga0181392_10580352 | 3300017749 | Seawater | MANFDLSKLTEGKNPQSVMLAETRELKSKWEQTGLLEGLGEREQSQISVLLE |
| Ga0181400_10450532 | 3300017752 | Seawater | MANFDLSKLTEGKNPQSVMLAETRELKSKWEQTGLLEGLGER |
| Ga0181407_10980272 | 3300017753 | Seawater | MANFDLSKLMEGKNPQSVMLNETRQLKGKWEQTGLSHLFTS |
| Ga0181356_11874592 | 3300017761 | Freshwater Lake | MANFDLSKLIEGKNPTSIMLEQTRGLKSKWEKTGLLEGIDNKPQQHAM |
| Ga0181356_12044312 | 3300017761 | Freshwater Lake | MANFDLSKLMEGKNPQAVMLAETRQLKSKWEKTGLLEGLKD |
| Ga0181410_10370972 | 3300017763 | Seawater | MANFDLSKLMEGKNPQAVMLNETRQLKGKWEQTGLLE |
| Ga0181385_10143515 | 3300017764 | Seawater | MANFDLSKLMEGKNPQSVMLAERRELKGKWEQTGLL |
| Ga0181385_11623072 | 3300017764 | Seawater | MANFDLSKLMEGKNPQSVMLAETRELKGKWEQTGLL |
| Ga0181406_11350602 | 3300017767 | Seawater | MANFDLNKLMEGKNPQSVMLEETRGLKTKWEQTGLLEGLKERDQHQMSVLL |
| Ga0181357_13351441 | 3300017777 | Freshwater Lake | MANFNLSKLMEGRNPQAVMLAETRQLKSKWEATGLLEGLKEREQSQ |
| Ga0181380_10257304 | 3300017782 | Seawater | MANFDLSKLMEGKNPQSVMLAETRELKGKWEQTGLLEGLGEREQSQISV |
| Ga0181379_11193942 | 3300017783 | Seawater | MANFDLSKLMEGKNPQQVMLAETRELKGKWEQTGLLEGLKER |
| Ga0181379_12412071 | 3300017783 | Seawater | MANFDLSKLMEGKNPQQVMLAETRELKGKWEQTGLLEGLGEREQSQVSVLLEN |
| Ga0181355_13034311 | 3300017785 | Freshwater Lake | MANFNLSKLMEGKNPQQIMLAETRQLRNKWAKTGLL |
| Ga0181580_101031704 | 3300017956 | Salt Marsh | MANFDLSKLTEGKNPQSVMLAETRELKNKWEQTGLLEGLGEREQSQISVLLENQ |
| Ga0181580_104811182 | 3300017956 | Salt Marsh | MANFDLSKLMEGKNPQSVMLAETRALRSKWEQTGLLEGLKEREQSQISVLLEN |
| Ga0181553_101615062 | 3300018416 | Salt Marsh | MANFDLSKLMEGKNPQQVMLAETRELKSKWAKTGLLEGLK |
| Ga0181558_101353752 | 3300018417 | Salt Marsh | MANFDLSKLTEGKNPQQVMLAETRQLTSKWEQTGLLEGL |
| Ga0181563_101109113 | 3300018420 | Salt Marsh | MANFDLSKLMEGKNPQTVMLNETRQLKGKWENTGLLEGLG |
| Ga0181566_103458932 | 3300018426 | Salt Marsh | MANFDLSKLMEGKNPQSVMLAETRELKGKWEQTGLLEGL |
| Ga0181568_112702211 | 3300018428 | Salt Marsh | MANFDLSKLMEGKNPQQVMFAETRELKSKWDRTGLLEGLEEREQ |
| Ga0193544_10240221 | 3300018735 | Marine | MANFDLSKLMEGKNPQSVMLEETRGLRSKWDKTGLLEGLKERESAQMSVLL |
| Ga0181564_105176372 | 3300018876 | Salt Marsh | MANFDLSKLMEGKNPQQVMLAETRELKSKWAKTGLLEGLKDREQSQ |
| Ga0181562_100701774 | 3300019459 | Salt Marsh | MANFDLSKLMEGKNPQSVMLAETRELKSKWEQTGLLEGLG |
| Ga0182044_12204751 | 3300020014 | Salt Marsh | MANFDLSKLMEGKNPQQVMLAETRELKGKWEQTGLLEGLGE |
| Ga0181575_105142601 | 3300020055 | Salt Marsh | MANFDLSKLMEGKNPQQVMLAETRELKSKWDRTGLL |
| Ga0194112_100788961 | 3300020109 | Freshwater Lake | MANFDLGKLMEGKNPQAVMLAETRQLKNKWEKTGLL |
| Ga0211736_108404224 | 3300020151 | Freshwater | MANFDLSKLMEGKNPQSVMLNETRQLKSKWEKTGLLEGL |
| Ga0211734_103128932 | 3300020159 | Freshwater | MANFDLSKLMEGKNPTSVMLEQTRGLKSKWEKTGLLEGIDNKPQQH |
| Ga0211734_105362522 | 3300020159 | Freshwater | MANFDLGKLMEGKNPQAVMLAETRQLKSKWEKTGLLEGMK |
| Ga0181599_12312562 | 3300020178 | Salt Marsh | MANFDLNKLMEAKNPQAVMLEETRGLKAKWDRTGLLEGL |
| Ga0194120_105301081 | 3300020198 | Freshwater Lake | MANFNVKSLLEAKNPQAIMLEQTRGLKGKWDKTGLLEGLKERD |
| Ga0194121_100492461 | 3300020200 | Freshwater Lake | MANFDLGKLMEGKNPQAVMLAETRQLKNKWEKTGLLE |
| Ga0181570_105402632 | 3300020207 | Salt Marsh | MSNFDLSKLMEGKNPQQVMLAETRELKGKWEQTGLLEGL |
| Ga0211696_10448931 | 3300020252 | Marine | MKEIKMANFDLSKLTEGKNPQSVMLEETRGLKTKWEQTGLLEGLKERDSHQMAVL |
| Ga0211652_100170234 | 3300020379 | Marine | MANFDLSKLTEGKNPQAVMLAETRELKSKWEQTGLLEGLG |
| Ga0211677_103211901 | 3300020385 | Marine | MANFDLSKLMEGKNPQSVMLNETRQLKGKWEQTGLLEGLNEKEQGAMSVLL |
| Ga0211659_100173751 | 3300020404 | Marine | MANFDLSKLTEGKNPQAVMLAETRELKSKWEQTGLLEGLGEREQSQISVLLE |
| Ga0211620_104368252 | 3300020424 | Marine | MANFDLNKLMEGKNPQSVMLEETRGLKNKWEKTGLLEGLKE |
| Ga0211581_100777812 | 3300020429 | Marine | MANFDLNKLMEGKNPQSVMLAETRGLKNKWEKTGLLEGLQERDQHQMSV |
| Ga0211576_105985681 | 3300020438 | Marine | MANFDLSKLTEGKNPQSVMLAETRELKSKWEQTGLLEG |
| Ga0211574_102083052 | 3300020446 | Marine | MANFDLSKLMEGKNPQSVMLAETRELKGKWEQTGLLEGLNEREQ |
| Ga0211694_101750672 | 3300020464 | Marine | MANFDLNKLMEGKNPQSIMLQETRGLKNKWEKTGLLEGLQERDQHQMSV |
| Ga0208232_10496631 | 3300020527 | Freshwater | MANFDLSKLMEGKNPQAVMLAETRQLKAKWEKTGLLEGMK |
| Ga0208596_10569542 | 3300020534 | Freshwater | MANFNVKSLLEAKNPQTVMLEQTRGLKTKWSKTGLLEGL |
| Ga0208722_10187632 | 3300020537 | Freshwater | MANFDLSKLMEGKNPQAVMLAETRQLKSKWEKTGLLEGMKEREQHS |
| Ga0208595_10116603 | 3300020538 | Freshwater | MANFDLSKLMEGKNPQSVMLAETRQLKTKWEKTGLLEGMKERDQH |
| Ga0208597_10486451 | 3300020562 | Freshwater | MANFDLSKLMEGKNPQAVMLAETRQLKSKWEKTGLLEGMKERDQH |
| Ga0214252_10225201 | 3300020720 | Freshwater | MANFDLTKLMEGKNPTAVMLEQTRGLKNKWEKTGLLEGIDAKPQQHAMAVL |
| Ga0206696_13053392 | 3300021334 | Seawater | MANFDLSKLMEGKNPQSVMLAETRELKGKWEQTGLLEGLGEREQSQISVLLEN |
| Ga0206688_109215112 | 3300021345 | Seawater | MANFDLSKLTEGKNPQSVMLAETRELKGKWEQTGLLEGLGERE |
| Ga0213860_102461331 | 3300021368 | Seawater | MANFDLSKLMEGKNPQSVMLAETRELKSKWEQTGLLEGLGEREQSQI |
| Ga0213865_101250781 | 3300021373 | Seawater | MANFDLSKLTEGKNPQSVMLAETRELKNKWEQTGL |
| Ga0222717_100285431 | 3300021957 | Estuarine Water | MANFDLSKLMEGKNPQSVMLAETRELKSKWEQTGLLEGLGEREQSQ |
| Ga0222715_104229662 | 3300021960 | Estuarine Water | MANFDLSKLTEGKNPQSVMLAETRELKSKWEQTGLLEGLGE |
| Ga0222713_103014102 | 3300021962 | Estuarine Water | MANFDLSKLMEGKNPQQVMLAETRQLQSKWAKTGLLEGLKSREQSQIAVLLEN |
| Ga0222713_106301841 | 3300021962 | Estuarine Water | MANFDLSKLMEGKNPQQVMLAETRELKSKWERTGLLEGLKE |
| Ga0222713_107997351 | 3300021962 | Estuarine Water | MANFDLSKLMEGKNPQQVMLAETRQLQAKWAKTGLLEGLKTREQSQ |
| Ga0232639_13913641 | 3300021977 | Hydrothermal Vent Fluids | MGNFNLSKLMEGKNPQAVMLEETRGLRNKWEKTGLLEGLDNRQQSFISADWWL |
| Ga0255784_102965672 | 3300023108 | Salt Marsh | MANFDLSKLTEGKNPQSVMLEETRGLKNKWEQTGLLE |
| Ga0255743_103226691 | 3300023110 | Salt Marsh | MANFDLSKLMEGKNPQQVMLAETRELRSKWEQTGLLEGLK |
| Ga0255766_101210251 | 3300023172 | Salt Marsh | MANFDLSKLMEGKNPQSVMLNETRQLKGKWAQTGLLEGLMKKSKAQCLFF |
| Ga0255772_100806673 | 3300023176 | Salt Marsh | MANFDLSKLMEGKNPQSVMLAETRQLKSKWENTGLLEGL |
| Ga0228679_10208392 | 3300023566 | Seawater | MANFDLSKLMEGKNPQQVMLAETRELKGKWEQTGLLEGLGEREQS |
| Ga0228679_10292261 | 3300023566 | Seawater | MANFDLSKLMEGKNPQSVMLAETRELKGKWEQTGLLEGLGER |
| Ga0228696_10240601 | 3300023568 | Seawater | MANFDLSKLMEGKNPQQVMLAETRELKGKWEQTGLLEGLGEREQSQVS |
| Ga0232112_10302112 | 3300023693 | Seawater | MANFDLSKLTEGKNPQSVMLEETRGLKSKWEQTGLLEGLKERDQ |
| Ga0228684_10083651 | 3300023704 | Seawater | MANFDLSKLMEGKNPQSVMLAETRELKGKWEQTGLLEGLGE |
| Ga0228603_10022633 | 3300024183 | Seawater | MANFDLSKLMEGKNPQSVMLEETRQLKGKWESTGLL |
| Ga0228665_11128312 | 3300024235 | Seawater | MANFDLSKLMEGKNPQSVMLNETRQLKGKWEQTGLLEGLNEKEQGAMS |
| (restricted) Ga0233437_12881742 | 3300024259 | Seawater | MANFDLSKLMEGKNPQSVMLAETRELKGKWEQTGLLEGLGEREQSQIS |
| Ga0228661_10815012 | 3300024266 | Seawater | MANFDLSKLTEGKNPQSVMLAETRELKGKWEQTEL |
| Ga0228610_10679761 | 3300024281 | Seawater | MANFDLSKLMEGKNPQQVMLAETRELKGKWEQTGLLEGLGEREQSQVSVL |
| Ga0255147_10950881 | 3300024289 | Freshwater | MAQFDLSKLMEGKNPTSIMLEQTRGLKNKWEKTGLLEGLGEK |
| Ga0228629_11324611 | 3300024296 | Seawater | MANFDLSKLMEGKNPQQVMLAETRELKGKWEQTGL |
| Ga0233451_103912861 | 3300024301 | Salt Marsh | MANFDLSKLMEGKNPQQVMLAETRQLQAKWEQTGLLEGLKSR |
| Ga0244777_106168191 | 3300024343 | Estuarine | MANFDLSKLMEGKNPQAVMLAETRQLKSKWEKTGLLEGMKERD |
| Ga0255173_10775942 | 3300024358 | Freshwater | MANFDLGKLMEGKNPQAVMLAETRQLKSKWEKTGLLEGLKER |
| Ga0228632_11386161 | 3300024420 | Seawater | MANFDLSKLMEGKNPQSVMLNETRQLKGKWEQTGLLEGLNEKEQGA |
| Ga0256318_10267072 | 3300024485 | Freshwater | MANFDLSKLMEGKNPQAVMLAETRQLKSKWEKTGLLEGMKERDQ |
| Ga0255151_10433031 | 3300024496 | Freshwater | MANFDLSKLMEGKNPQQVMLAETRALRNKWEKTGLLE |
| Ga0255152_10837401 | 3300024503 | Freshwater | MANFDLGKLMEGKNPQAVMLAETRQLKNKWEKTGLLEGLKE |
| Ga0255150_10670502 | 3300024505 | Freshwater | MANFDLGKLMEGKNPQAVMLAETRQLKSKWEKTGLLEGLKEREQHSMA |
| Ga0255144_10115121 | 3300024513 | Freshwater | MAQFDLSKLMEGKNPTSIMLEQTRGLKNKWEKTGLLEGL |
| Ga0255183_10136514 | 3300024515 | Freshwater | MANFNVKSLLEAKNPQAVMLEQTRGLKGKWDKTGLLEGLKERDQH |
| Ga0256309_11080051 | 3300024566 | Freshwater | MANFNLSKLMEGKNPQAVMLAETRQLKSKWEATGLLEGLKEREQSQ |
| Ga0255252_10766632 | 3300024853 | Freshwater | MANFDLSKLMEGKNPQAVMLAETRQLKSKWEKNWPFRRYER |
| Ga0255281_10577951 | 3300024855 | Freshwater | MANFNVKSLLEAKNPQAVMLEQTRGLKGKWDKTGLLEG |
| Ga0255246_10211343 | 3300024863 | Freshwater | MANFNVKSLLEAKNPQAVMLEQTRGLRTKWDKTGLLEG |
| Ga0255271_11120221 | 3300024864 | Freshwater | MAQFDLSKLMEGKNPTSIMLEQTRGLKNKWEKTGLLEG |
| Ga0255272_10130872 | 3300024866 | Freshwater | MANFDLSKLMEGKNPQQVMLAETRALRNKWEKNWSS |
| Ga0208298_10056335 | 3300025084 | Marine | MANFDLSKLMEGKNPQSVMLNETRQLKGKWEQTGLLEGLNEK |
| Ga0208792_10937382 | 3300025085 | Marine | MANFDLSKLMEGKNPQSVMLEETRQLKGKWESTGLLEGLNAKEQGAMS |
| Ga0209138_11704391 | 3300025617 | Marine | MANFDLNKLMEAKNPQAVMLEETRQLKGKWDRTGLLEGLGEKEQGAMSV |
| Ga0209405_10375113 | 3300025620 | Pelagic Marine | MANFDLSKLMEGKNPQAVMLNETRQLKGKWEQTGLLEGLNEK |
| Ga0209136_11170531 | 3300025636 | Marine | MANFDLSKLMEGKNPQQVMLSETRQLKSKWDATGLLEGLNTKEQGAM |
| Ga0208428_10566021 | 3300025653 | Aqueous | MANFDLSKLMEGKNPQSVMLAETRQLKGKWESTGLLEGLNEKEQGAMSVL |
| Ga0209657_11933581 | 3300025676 | Marine | MANFDLSKLMEGKNPQSVMLAETRELKGKWEQTGL |
| Ga0209771_10432573 | 3300025701 | Marine | MANFDLSKLMEGKNPQQVMLSETRQLKSKWDATGLLEGLNAKEQGAMAVML |
| Ga0208763_10298632 | 3300026136 | Marine | MANFDLSKLMEGKNPQQVMLAETRELKGKWEQTGLLEGLGEREQSQIS |
| Ga0207993_11428011 | 3300026270 | Marine | MANFDLSKLMEGKNPQSVMLAETRELKGKWEQTGLLEGLNEREQSQISV |
| Ga0247581_10548082 | 3300026420 | Seawater | MANFDLSKLMEGKNPQSVMLAETRELKGKWEQTGLLEGLGEREQSQISVLLE |
| Ga0256297_10094351 | 3300026435 | Freshwater | MANFDLSKLMEGKNPQAVMLAETRQLKTKWEKTGLLEGMKERDQ |
| Ga0247607_10537191 | 3300026447 | Seawater | MANFDLSKLMEGKNPQSVMLAETRELKSKWEQTGLLEGLGE |
| Ga0256319_10844112 | 3300026454 | Freshwater | MANFNVKSLLEAKNPQAVMLEQTRGLRTKWEKTGLLEGLKDRDQHS |
| Ga0247598_10253802 | 3300026466 | Seawater | MANFDLSKLTEGKNPQSVMLAETRELKGKWEQTGLLEGLGEREQSQISVLL |
| Ga0247603_10522982 | 3300026468 | Seawater | MANFDLSKLMEGKNPQSVMLAETRELKSKWEQTGLLEGLGER |
| Ga0228620_10448282 | 3300026483 | Seawater | MANFDLSKLMEGKNPQAVMLSETRQLKSKWDATGLLEG |
| Ga0228641_11007632 | 3300026491 | Seawater | MANFDLSKLTEGKNPQSVMLEETRGLKSKWEQTGLLEG |
| Ga0247605_10458141 | 3300026503 | Seawater | MANFDLSKLMEGKNPQQVMLAETRELKGKWEQTGLLEGL |
| Ga0208797_10192961 | 3300027186 | Estuarine | MANFDLSKLMEGKNPQAVMLAETRQLKSKWEKTGLLEGMKE |
| Ga0255140_10247921 | 3300027300 | Freshwater | MANFDLSKLMEGKNPQAVMLAETRQLKSKWEKTGLLEGM |
| Ga0255122_10853432 | 3300027595 | Freshwater | MANFDLSKLMEGKNPQAVMLAETRQLKSKWEKTGLLEGMKESVGLSLSY |
| Ga0209599_100180381 | 3300027710 | Deep Subsurface | MANFDLTKLMEGKNPTSVMLEQTRGLKNKWEKTGLLEGIGEKPQQHAMAVL |
| Ga0208304_103589121 | 3300027751 | Estuarine | MANFDLSKLMEGKNPTSIMLEQTRGLKSKWEKTGLLEGIDNKP |
| Ga0208305_103267892 | 3300027753 | Estuarine | MANFDLSKLMEGKNPQQVMLAETRELKGKWEQTGLLE |
| Ga0209768_101524322 | 3300027772 | Freshwater Lake | MANFDLSKLMEGKNPQAVMLAETRQLKSKWEKTGLLEG |
| Ga0209990_103174741 | 3300027816 | Freshwater Lake | MANFDLGKLMEGKNPQAVMLAETRQLKNKWEKTGLLEGLKEREQHSMAVLL |
| Ga0247586_10112961 | 3300028102 | Seawater | MANYDLSKLMEGKNPQAVMLNETRQLKGKWEQTGLLEGLNEKE |
| Ga0257114_12946332 | 3300028196 | Marine | MANFDLSKLTEGKNPQSVMLAETRELKGKWEQTGLLEGLKEREQSQMS |
| Ga0247597_10259161 | 3300028334 | Seawater | MANFDLSKLMEGKNPQQVMLAETRELKGKWEQTGLLEGLGEREQSQ |
| Ga0308138_10452332 | 3300030724 | Marine | MANFDLSKLMEGKNPQAVMLEETRQLKGKWEQTGLLEGLNTKEQGAMSVLL |
| Ga0307997_100943382 | 3300031706 | Marine | MANFDLSKLMEGKNPQQVMLAETRELKGKWEQTGLLEGLKDREQSQISVLLE |
| Ga0315322_107154311 | 3300031766 | Seawater | MANFDLSKLMEGKNPQAVMLEQTRGLKNKWEQTGLLEGLNEREQSQMSVLL |
| Ga0315899_100325861 | 3300031784 | Freshwater | MANFNVKSLLEAKNPQAVMLEQTRGLRTKWEKTGLLEGLKDRDQHSM |
| Ga0315903_107533661 | 3300032116 | Freshwater | MANFNVKSLLEAKNPQSIMLEQTRGLKKKWDKTGLLEGLRER |
| Ga0334978_0424210_485_625 | 3300033979 | Freshwater | MANFNVKSLLEAKNPQTVMLEQTRGLRAKWEKTGLLEGMKERDQHSM |
| Ga0334982_0099666_2_115 | 3300033981 | Freshwater | MNFDLNKLTEGKNPQSVMLEQTRGLKSKWEKTGLLEGM |
| Ga0334982_0452595_434_574 | 3300033981 | Freshwater | MANFDLSKLMEGKNPQAVMLAETRQLKSKWEKTGLLEGMKERDQHSM |
| Ga0335003_0143566_1_114 | 3300033995 | Freshwater | MANFNVKSLLEAKNPQAVMLEQTRGLRTKWEKTGLLEG |
| Ga0334987_0245672_1_129 | 3300034061 | Freshwater | MANFNLNKLMEAKNPQQVMLEQTRGLKSKWEKTGLLEGLKERD |
| Ga0334995_0439387_2_118 | 3300034062 | Freshwater | MANFDLTKLMEGKNPTAIMLEQTRGLKNKWEKTGLLEGI |
| Ga0334995_0713978_3_119 | 3300034062 | Freshwater | MANFDLTKLMEGKNPTSVMLEQTRGLKNKWEKTGLLEGI |
| Ga0335020_0239133_3_140 | 3300034082 | Freshwater | MANFDLSKLMEGKNPQAVMLAETRQLKSKWEKTGLLEGMKERDQHS |
| Ga0335055_0217602_734_841 | 3300034110 | Freshwater | MANFDLSKLMEGKNPQAVMLAETRQLKSKWEKTGLL |
| Ga0335033_0244232_822_944 | 3300034117 | Freshwater | MANFDLSKLMEGKNPQAVMLAETRQLKAKWDKTGLLEGMKE |
| Ga0335007_0295123_956_1063 | 3300034283 | Freshwater | MANFDLGKLMEGKNPQAVMLAETRQLKSKWEKTGLL |
| ⦗Top⦘ |