| Basic Information | |
|---|---|
| Family ID | F019942 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 226 |
| Average Sequence Length | 41 residues |
| Representative Sequence | YMIKISGLEHLTASEQLEVLGGLLDVSEGRPRSNQKDVLTT |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 226 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.77 % |
| % of genes near scaffold ends (potentially truncated) | 59.73 % |
| % of genes from short scaffolds (< 2000 bps) | 100.00 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (79.646 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (72.124 % of family members) |
| Environment Ontology (ENVO) | Unclassified (90.708 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (79.646 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.48% β-sheet: 0.00% Coil/Unstructured: 56.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 226 Family Scaffolds |
|---|---|---|
| PF04195 | Transposase_28 | 3.98 |
| PF14223 | Retrotran_gag_2 | 0.44 |
| PF00078 | RVT_1 | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 79.65 % |
| All Organisms | root | All Organisms | 20.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005618|Ga0068864_100814266 | Not Available | 918 | Open in IMG/M |
| 3300005842|Ga0068858_101194784 | Not Available | 747 | Open in IMG/M |
| 3300005843|Ga0068860_102083341 | Not Available | 589 | Open in IMG/M |
| 3300009092|Ga0105250_10522027 | Not Available | 541 | Open in IMG/M |
| 3300009101|Ga0105247_10571056 | Not Available | 834 | Open in IMG/M |
| 3300009101|Ga0105247_10957061 | Not Available | 665 | Open in IMG/M |
| 3300009971|Ga0105127_10684 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 819 | Open in IMG/M |
| 3300009975|Ga0105129_102594 | Not Available | 907 | Open in IMG/M |
| 3300009980|Ga0105135_113296 | Not Available | 660 | Open in IMG/M |
| 3300009980|Ga0105135_117193 | Not Available | 614 | Open in IMG/M |
| 3300009980|Ga0105135_121197 | Not Available | 575 | Open in IMG/M |
| 3300009980|Ga0105135_122292 | Not Available | 565 | Open in IMG/M |
| 3300009980|Ga0105135_126824 | Not Available | 530 | Open in IMG/M |
| 3300009980|Ga0105135_127868 | Not Available | 523 | Open in IMG/M |
| 3300009980|Ga0105135_129573 | Not Available | 512 | Open in IMG/M |
| 3300009981|Ga0105133_107376 | Not Available | 767 | Open in IMG/M |
| 3300009989|Ga0105131_121622 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 640 | Open in IMG/M |
| 3300009990|Ga0105132_141983 | Not Available | 517 | Open in IMG/M |
| 3300009992|Ga0105120_1033900 | Not Available | 614 | Open in IMG/M |
| 3300009994|Ga0105126_1035271 | Not Available | 601 | Open in IMG/M |
| 3300009994|Ga0105126_1037493 | Not Available | 588 | Open in IMG/M |
| 3300009994|Ga0105126_1044429 | Not Available | 553 | Open in IMG/M |
| 3300009994|Ga0105126_1054637 | Not Available | 511 | Open in IMG/M |
| 3300009995|Ga0105139_1010782 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1186 | Open in IMG/M |
| 3300009995|Ga0105139_1018677 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1012 | Open in IMG/M |
| 3300009995|Ga0105139_1055181 | Not Available | 708 | Open in IMG/M |
| 3300009995|Ga0105139_1076452 | Not Available | 627 | Open in IMG/M |
| 3300010281|Ga0134090_1079959 | Not Available | 612 | Open in IMG/M |
| 3300010371|Ga0134125_12525740 | Not Available | 558 | Open in IMG/M |
| 3300010373|Ga0134128_11967085 | Not Available | 644 | Open in IMG/M |
| 3300010396|Ga0134126_12205254 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 601 | Open in IMG/M |
| 3300010396|Ga0134126_12490289 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 563 | Open in IMG/M |
| 3300010396|Ga0134126_12942572 | Not Available | 515 | Open in IMG/M |
| 3300010400|Ga0134122_12899040 | Not Available | 533 | Open in IMG/M |
| 3300012521|Ga0134099_1107324 | Not Available | 564 | Open in IMG/M |
| 3300014326|Ga0157380_11731615 | Not Available | 683 | Open in IMG/M |
| 3300014968|Ga0157379_10873568 | Not Available | 852 | Open in IMG/M |
| 3300014968|Ga0157379_11869201 | Not Available | 591 | Open in IMG/M |
| 3300015270|Ga0182183_1026649 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 744 | Open in IMG/M |
| 3300015270|Ga0182183_1050671 | Not Available | 616 | Open in IMG/M |
| 3300015270|Ga0182183_1061608 | Not Available | 580 | Open in IMG/M |
| 3300015270|Ga0182183_1085311 | Not Available | 521 | Open in IMG/M |
| 3300015273|Ga0182102_1015990 | Not Available | 670 | Open in IMG/M |
| 3300015278|Ga0182099_1019362 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 727 | Open in IMG/M |
| 3300015278|Ga0182099_1051655 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 559 | Open in IMG/M |
| 3300015280|Ga0182100_1068289 | Not Available | 575 | Open in IMG/M |
| 3300015284|Ga0182101_1046335 | Not Available | 655 | Open in IMG/M |
| 3300015290|Ga0182105_1006789 | Not Available | 1184 | Open in IMG/M |
| 3300015290|Ga0182105_1022914 | Not Available | 839 | Open in IMG/M |
| 3300015290|Ga0182105_1075008 | Not Available | 575 | Open in IMG/M |
| 3300015290|Ga0182105_1094042 | Not Available | 530 | Open in IMG/M |
| 3300015293|Ga0182103_1041156 | Not Available | 678 | Open in IMG/M |
| 3300015293|Ga0182103_1072944 | Not Available | 567 | Open in IMG/M |
| 3300015293|Ga0182103_1084421 | Not Available | 541 | Open in IMG/M |
| 3300015293|Ga0182103_1091994 | Not Available | 525 | Open in IMG/M |
| 3300015297|Ga0182104_1045251 | Not Available | 708 | Open in IMG/M |
| 3300015297|Ga0182104_1077875 | Not Available | 590 | Open in IMG/M |
| 3300015301|Ga0182184_1018165 | Not Available | 885 | Open in IMG/M |
| 3300015301|Ga0182184_1062381 | Not Available | 595 | Open in IMG/M |
| 3300015301|Ga0182184_1069489 | Not Available | 574 | Open in IMG/M |
| 3300015306|Ga0182180_1037050 | Not Available | 704 | Open in IMG/M |
| 3300015309|Ga0182098_1095994 | Not Available | 559 | Open in IMG/M |
| 3300015309|Ga0182098_1096917 | Not Available | 557 | Open in IMG/M |
| 3300015310|Ga0182162_1021318 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 932 | Open in IMG/M |
| 3300015310|Ga0182162_1120839 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 517 | Open in IMG/M |
| 3300015311|Ga0182182_1016044 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 983 | Open in IMG/M |
| 3300015311|Ga0182182_1059034 | Not Available | 653 | Open in IMG/M |
| 3300015311|Ga0182182_1077640 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 594 | Open in IMG/M |
| 3300015311|Ga0182182_1080360 | Not Available | 587 | Open in IMG/M |
| 3300015312|Ga0182168_1017742 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1019 | Open in IMG/M |
| 3300015312|Ga0182168_1111399 | Not Available | 546 | Open in IMG/M |
| 3300015313|Ga0182164_1042663 | Not Available | 773 | Open in IMG/M |
| 3300015313|Ga0182164_1044052 | Not Available | 765 | Open in IMG/M |
| 3300015313|Ga0182164_1049814 | Not Available | 734 | Open in IMG/M |
| 3300015313|Ga0182164_1049978 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 733 | Open in IMG/M |
| 3300015315|Ga0182120_1133574 | Not Available | 511 | Open in IMG/M |
| 3300015316|Ga0182121_1059055 | Not Available | 720 | Open in IMG/M |
| 3300015317|Ga0182136_1070477 | Not Available | 655 | Open in IMG/M |
| 3300015317|Ga0182136_1076872 | Not Available | 635 | Open in IMG/M |
| 3300015317|Ga0182136_1078941 | Not Available | 629 | Open in IMG/M |
| 3300015317|Ga0182136_1137377 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 508 | Open in IMG/M |
| 3300015317|Ga0182136_1137705 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 507 | Open in IMG/M |
| 3300015318|Ga0182181_1060763 | Not Available | 629 | Open in IMG/M |
| 3300015318|Ga0182181_1070248 | Not Available | 599 | Open in IMG/M |
| 3300015319|Ga0182130_1126612 | Not Available | 519 | Open in IMG/M |
| 3300015320|Ga0182165_1032168 | Not Available | 880 | Open in IMG/M |
| 3300015325|Ga0182148_1030757 | Not Available | 870 | Open in IMG/M |
| 3300015325|Ga0182148_1125337 | Not Available | 534 | Open in IMG/M |
| 3300015327|Ga0182114_1048482 | Not Available | 805 | Open in IMG/M |
| 3300015327|Ga0182114_1067360 | Not Available | 715 | Open in IMG/M |
| 3300015327|Ga0182114_1068736 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 710 | Open in IMG/M |
| 3300015327|Ga0182114_1114831 | Not Available | 581 | Open in IMG/M |
| 3300015327|Ga0182114_1135702 | Not Available | 542 | Open in IMG/M |
| 3300015328|Ga0182153_1084897 | Not Available | 633 | Open in IMG/M |
| 3300015328|Ga0182153_1126848 | Not Available | 542 | Open in IMG/M |
| 3300015329|Ga0182135_1075336 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 666 | Open in IMG/M |
| 3300015329|Ga0182135_1106276 | Not Available | 585 | Open in IMG/M |
| 3300015329|Ga0182135_1151398 | Not Available | 507 | Open in IMG/M |
| 3300015329|Ga0182135_1154264 | Not Available | 503 | Open in IMG/M |
| 3300015330|Ga0182152_1146217 | Not Available | 515 | Open in IMG/M |
| 3300015331|Ga0182131_1061402 | Not Available | 722 | Open in IMG/M |
| 3300015331|Ga0182131_1088291 | Not Available | 632 | Open in IMG/M |
| 3300015331|Ga0182131_1115880 | Not Available | 568 | Open in IMG/M |
| 3300015331|Ga0182131_1143168 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 521 | Open in IMG/M |
| 3300015331|Ga0182131_1147809 | Not Available | 514 | Open in IMG/M |
| 3300015332|Ga0182117_1014472 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1236 | Open in IMG/M |
| 3300015333|Ga0182147_1037070 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 897 | Open in IMG/M |
| 3300015333|Ga0182147_1076727 | Not Available | 693 | Open in IMG/M |
| 3300015333|Ga0182147_1106849 | Not Available | 609 | Open in IMG/M |
| 3300015333|Ga0182147_1110293 | Not Available | 602 | Open in IMG/M |
| 3300015333|Ga0182147_1138597 | Not Available | 547 | Open in IMG/M |
| 3300015333|Ga0182147_1150309 | Not Available | 529 | Open in IMG/M |
| 3300015334|Ga0182132_1045553 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 840 | Open in IMG/M |
| 3300015334|Ga0182132_1119298 | Not Available | 584 | Open in IMG/M |
| 3300015334|Ga0182132_1144509 | Not Available | 538 | Open in IMG/M |
| 3300015335|Ga0182116_1033103 | Not Available | 976 | Open in IMG/M |
| 3300015335|Ga0182116_1133944 | Not Available | 573 | Open in IMG/M |
| 3300015336|Ga0182150_1021044 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1050 | Open in IMG/M |
| 3300015336|Ga0182150_1118930 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 577 | Open in IMG/M |
| 3300015337|Ga0182151_1035164 | Not Available | 895 | Open in IMG/M |
| 3300015337|Ga0182151_1088937 | Not Available | 646 | Open in IMG/M |
| 3300015337|Ga0182151_1149957 | Not Available | 525 | Open in IMG/M |
| 3300015337|Ga0182151_1159067 | Not Available | 512 | Open in IMG/M |
| 3300015338|Ga0182137_1171553 | Not Available | 512 | Open in IMG/M |
| 3300015339|Ga0182149_1099913 | Not Available | 634 | Open in IMG/M |
| 3300015339|Ga0182149_1175583 | Not Available | 500 | Open in IMG/M |
| 3300015340|Ga0182133_1128178 | Not Available | 600 | Open in IMG/M |
| 3300015340|Ga0182133_1141134 | Not Available | 576 | Open in IMG/M |
| 3300015348|Ga0182115_1147052 | Not Available | 754 | Open in IMG/M |
| 3300015348|Ga0182115_1161461 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 718 | Open in IMG/M |
| 3300015348|Ga0182115_1203389 | Not Available | 634 | Open in IMG/M |
| 3300015348|Ga0182115_1258599 | Not Available | 553 | Open in IMG/M |
| 3300015348|Ga0182115_1296584 | Not Available | 510 | Open in IMG/M |
| 3300015349|Ga0182185_1100376 | Not Available | 831 | Open in IMG/M |
| 3300015349|Ga0182185_1161399 | Not Available | 670 | Open in IMG/M |
| 3300015349|Ga0182185_1197287 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 608 | Open in IMG/M |
| 3300015349|Ga0182185_1232141 | Not Available | 561 | Open in IMG/M |
| 3300015349|Ga0182185_1237700 | Not Available | 554 | Open in IMG/M |
| 3300015349|Ga0182185_1245140 | Not Available | 545 | Open in IMG/M |
| 3300015349|Ga0182185_1251585 | Not Available | 538 | Open in IMG/M |
| 3300015350|Ga0182163_1074633 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 999 | Open in IMG/M |
| 3300015352|Ga0182169_1171524 | Not Available | 709 | Open in IMG/M |
| 3300015352|Ga0182169_1239459 | Not Available | 591 | Open in IMG/M |
| 3300015352|Ga0182169_1246552 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 581 | Open in IMG/M |
| 3300015352|Ga0182169_1268030 | Not Available | 554 | Open in IMG/M |
| 3300015353|Ga0182179_1187043 | Not Available | 656 | Open in IMG/M |
| 3300015353|Ga0182179_1205860 | Not Available | 627 | Open in IMG/M |
| 3300015354|Ga0182167_1051508 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1414 | Open in IMG/M |
| 3300015354|Ga0182167_1182073 | Not Available | 772 | Open in IMG/M |
| 3300015354|Ga0182167_1188213 | Not Available | 757 | Open in IMG/M |
| 3300015354|Ga0182167_1208267 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 714 | Open in IMG/M |
| 3300015354|Ga0182167_1261354 | Not Available | 622 | Open in IMG/M |
| 3300015354|Ga0182167_1291829 | Not Available | 580 | Open in IMG/M |
| 3300015354|Ga0182167_1356939 | Not Available | 510 | Open in IMG/M |
| 3300015354|Ga0182167_1358445 | Not Available | 508 | Open in IMG/M |
| 3300017408|Ga0182197_1106507 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 576 | Open in IMG/M |
| 3300017408|Ga0182197_1109966 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 569 | Open in IMG/M |
| 3300017408|Ga0182197_1125048 | Not Available | 541 | Open in IMG/M |
| 3300017408|Ga0182197_1134867 | Not Available | 526 | Open in IMG/M |
| 3300017408|Ga0182197_1145000 | Not Available | 511 | Open in IMG/M |
| 3300017412|Ga0182199_1098726 | Not Available | 669 | Open in IMG/M |
| 3300017412|Ga0182199_1139949 | Not Available | 585 | Open in IMG/M |
| 3300017412|Ga0182199_1161062 | Not Available | 554 | Open in IMG/M |
| 3300017414|Ga0182195_1080348 | Not Available | 750 | Open in IMG/M |
| 3300017414|Ga0182195_1171868 | Not Available | 559 | Open in IMG/M |
| 3300017421|Ga0182213_1244182 | Not Available | 515 | Open in IMG/M |
| 3300017422|Ga0182201_1057867 | Not Available | 689 | Open in IMG/M |
| 3300017422|Ga0182201_1068137 | Not Available | 652 | Open in IMG/M |
| 3300017422|Ga0182201_1110073 | Not Available | 554 | Open in IMG/M |
| 3300017432|Ga0182196_1043957 | Not Available | 776 | Open in IMG/M |
| 3300017435|Ga0182194_1066704 | Not Available | 687 | Open in IMG/M |
| 3300017445|Ga0182198_1021187 | Not Available | 1123 | Open in IMG/M |
| 3300017446|Ga0182217_1065125 | Not Available | 848 | Open in IMG/M |
| 3300017446|Ga0182217_1107117 | Not Available | 656 | Open in IMG/M |
| 3300017691|Ga0182212_1162549 | Not Available | 510 | Open in IMG/M |
| 3300017693|Ga0182216_1129443 | Not Available | 627 | Open in IMG/M |
| 3300017693|Ga0182216_1138148 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 611 | Open in IMG/M |
| 3300017694|Ga0182211_1121263 | Not Available | 617 | Open in IMG/M |
| 3300020033|Ga0182146_104736 | Not Available | 562 | Open in IMG/M |
| 3300025315|Ga0207697_10360475 | Not Available | 646 | Open in IMG/M |
| 3300025885|Ga0207653_10059655 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1284 | Open in IMG/M |
| 3300025918|Ga0207662_10433869 | Not Available | 896 | Open in IMG/M |
| 3300025925|Ga0207650_10409834 | Not Available | 1123 | Open in IMG/M |
| 3300026088|Ga0207641_11869854 | Not Available | 602 | Open in IMG/M |
| 3300026095|Ga0207676_12266005 | Not Available | 541 | Open in IMG/M |
| 3300028049|Ga0268322_1039596 | Not Available | 570 | Open in IMG/M |
| 3300028050|Ga0268328_1053119 | Not Available | 563 | Open in IMG/M |
| 3300028051|Ga0268344_1013819 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 614 | Open in IMG/M |
| 3300028053|Ga0268346_1014016 | Not Available | 721 | Open in IMG/M |
| 3300028053|Ga0268346_1021295 | Not Available | 637 | Open in IMG/M |
| 3300028054|Ga0268306_1030644 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 527 | Open in IMG/M |
| 3300028058|Ga0268332_1017136 | Not Available | 849 | Open in IMG/M |
| 3300028058|Ga0268332_1035019 | Not Available | 676 | Open in IMG/M |
| 3300028058|Ga0268332_1038893 | Not Available | 653 | Open in IMG/M |
| 3300028061|Ga0268314_1032290 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 607 | Open in IMG/M |
| 3300028061|Ga0268314_1044929 | Not Available | 539 | Open in IMG/M |
| 3300028064|Ga0268340_1057269 | Not Available | 588 | Open in IMG/M |
| 3300028064|Ga0268340_1086256 | Not Available | 503 | Open in IMG/M |
| 3300028262|Ga0268310_1046141 | Not Available | 525 | Open in IMG/M |
| 3300028379|Ga0268266_11496398 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 651 | Open in IMG/M |
| 3300028473|Ga0268319_1014352 | Not Available | 594 | Open in IMG/M |
| 3300028473|Ga0268319_1020734 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 530 | Open in IMG/M |
| 3300028526|Ga0268339_1010146 | Not Available | 621 | Open in IMG/M |
| 3300028527|Ga0268335_1018140 | Not Available | 510 | Open in IMG/M |
| 3300032465|Ga0214493_1071931 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 823 | Open in IMG/M |
| 3300032469|Ga0214491_1138322 | Not Available | 573 | Open in IMG/M |
| 3300032502|Ga0214490_1112105 | Not Available | 622 | Open in IMG/M |
| 3300032551|Ga0321339_1123132 | Not Available | 581 | Open in IMG/M |
| 3300032551|Ga0321339_1155859 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 500 | Open in IMG/M |
| 3300032625|Ga0214501_1178692 | Not Available | 676 | Open in IMG/M |
| 3300032689|Ga0214497_1109810 | Not Available | 593 | Open in IMG/M |
| 3300032821|Ga0314719_1036119 | Not Available | 610 | Open in IMG/M |
| 3300032821|Ga0314719_1045922 | Not Available | 530 | Open in IMG/M |
| 3300032823|Ga0314723_1046505 | Not Available | 832 | Open in IMG/M |
| 3300032890|Ga0314747_1009878 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1380 | Open in IMG/M |
| 3300032916|Ga0314734_1083557 | Not Available | 638 | Open in IMG/M |
| 3300032976|Ga0314752_1078491 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 634 | Open in IMG/M |
| 3300032976|Ga0314752_1115030 | Not Available | 516 | Open in IMG/M |
| 3300033523|Ga0314768_1359428 | Not Available | 506 | Open in IMG/M |
| 3300033530|Ga0314760_1111286 | Not Available | 675 | Open in IMG/M |
| 3300033530|Ga0314760_1156768 | Not Available | 555 | Open in IMG/M |
| 3300033533|Ga0314770_1232682 | Not Available | 577 | Open in IMG/M |
| 3300033534|Ga0314757_1054607 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 955 | Open in IMG/M |
| 3300033538|Ga0314755_1063749 | Not Available | 928 | Open in IMG/M |
| 3300033538|Ga0314755_1158569 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 576 | Open in IMG/M |
| 3300033542|Ga0314769_1285243 | Not Available | 554 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 72.12% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 9.29% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 7.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.21% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Switchgrass Degrading | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009971 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_174 metaG | Host-Associated | Open in IMG/M |
| 3300009975 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG | Host-Associated | Open in IMG/M |
| 3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
| 3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
| 3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
| 3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
| 3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
| 3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010281 | Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 1_4_20_6_A1 metaG | Engineered | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012521 | Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 10_41_5_180_A2 metaG | Engineered | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015273 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017446 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017691 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300020033 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12JUL2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028051 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028473 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028526 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028527 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032469 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032551 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032625 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032821 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032823 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032890 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032916 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032976 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033523 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033530 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033533 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033534 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033538 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033542 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0068864_1008142662 | 3300005618 | Switchgrass Rhizosphere | YMIKISGLEHLTASKQTEVLEGPLDVSEGRTRSNQKDVLST* |
| Ga0068858_1011947841 | 3300005842 | Switchgrass Rhizosphere | MIKISGLEHLTASKQMEVLEGLLDVSEGRIRSNQKDVLTT* |
| Ga0068860_1020833411 | 3300005843 | Switchgrass Rhizosphere | MIKISGFEHLTTLKKPQVLGRLVDVLEGRTRSNQKDVLTT* |
| Ga0105250_105220271 | 3300009092 | Switchgrass Rhizosphere | LEHLTASKQPEVLGRLLEAFDGRLRSTQKDVQSTRST* |
| Ga0105247_105710561 | 3300009101 | Switchgrass Rhizosphere | MIKISGLEHLTVSKQTEVLEGLLDVFEGRTRSNQKDVLNT* |
| Ga0105247_109570612 | 3300009101 | Switchgrass Rhizosphere | MIKISGLEHLTASKLTEVLEGLLDVFEGRTRSNQKDVL |
| Ga0105127_106841 | 3300009971 | Switchgrass Associated | MIKILGLEHLTASKKPEVLGGLLDVTEERPRSNLKDVLTT* |
| Ga0105129_1025941 | 3300009975 | Switchgrass Associated | MIKISGLEHLTASEQPEVLGGLLDEFEGRPRRNQKDVLTT* |
| Ga0105135_1132961 | 3300009980 | Switchgrass Associated | MIKILGLEHLTASEQPEVLGRLLDVFEGRHRSNQKDVLTA* |
| Ga0105135_1171931 | 3300009980 | Switchgrass Associated | MIKILGLEHLTASEQPQLLGGLLDASEGRPRNNQKDVLTT* |
| Ga0105135_1211971 | 3300009980 | Switchgrass Associated | LRAPYMIKISGLQHLTASEQPEVFGGLLDESEGRPGSNQKDVLTT* |
| Ga0105135_1222921 | 3300009980 | Switchgrass Associated | LEHLTVLEQPEVLGGLLDVPEGRTRSNQKDVLTT* |
| Ga0105135_1268241 | 3300009980 | Switchgrass Associated | VYMIKISGLEHLIASEQPEVLGRLLDVLEGRPRSNHKDVRTT* |
| Ga0105135_1278681 | 3300009980 | Switchgrass Associated | MIKISGLEHLTASKQLDEFGRLLDVLEERPRSNQKDVLT |
| Ga0105135_1295731 | 3300009980 | Switchgrass Associated | MIKISELEHLTASKQPEVLGGLLDVSEGRLRNNQEDVLTT* |
| Ga0105133_1073761 | 3300009981 | Switchgrass Associated | MIKISGLEHLTASEQPQVLGGLLGASEGRPRSNRKGVLTTRS |
| Ga0105131_1216221 | 3300009989 | Switchgrass Associated | MIKISGLEHLTASKQMEVLEGLLDVFEGRTRSNQKDVLTA* |
| Ga0105132_1419831 | 3300009990 | Switchgrass Associated | ATPYGVRVLRAPYMIEISGLEHLTASKQPEVLGGLLGVSEGRPRSHQKDVLTT* |
| Ga0105120_10339001 | 3300009992 | Switchgrass Associated | LVLRAPYMIKISGLEHLTASKQTGVLGGLLDEVEGRSRSSLKDILTN* |
| Ga0105126_10352711 | 3300009994 | Switchgrass Associated | MIKISGLEHLTASKQPQVLGGLLDVSEGRFRNNEEDILIT* |
| Ga0105126_10374932 | 3300009994 | Switchgrass Associated | MIKILGHEHLTASEQPEVRGRLLEVLEGRPGSNQMDVL |
| Ga0105126_10444291 | 3300009994 | Switchgrass Associated | VPYMIKNSELEHLTASKQPEVLGELLGVSEGMPRSNQKDVLTT* |
| Ga0105126_10546371 | 3300009994 | Switchgrass Associated | MEREYFEHLTASEQPEELGRLLNVLKGRPRSNQKDVLTT* |
| Ga0105139_10107822 | 3300009995 | Switchgrass Associated | MIKISRLEHLTASGHPEVLGRLLDVPEGRPRSNQKDVLTT* |
| Ga0105139_10186772 | 3300009995 | Switchgrass Associated | MIKISELEHLTASEQPEELGRLLDVSEGRPRSNQKDVLTT* |
| Ga0105139_10551812 | 3300009995 | Switchgrass Associated | MIKISRLEHLTASKKTEVLEGLLDISEGRVRSNQKDVLTT |
| Ga0105139_10764521 | 3300009995 | Switchgrass Associated | LRAPYIIKISGLEHLTTLKQLEVLEGLLDVSEGRTRSNHEEVLNT* |
| Ga0134090_10799591 | 3300010281 | Switchgrass Degrading | MIKISGLEHLTASKQMEVLEGLLDISERRVRSKQDVLT |
| Ga0134125_125257402 | 3300010371 | Terrestrial Soil | MIKISGHEHLTASEQPEALGRLLDVLEGRPRSNQEEILII* |
| Ga0134128_119670851 | 3300010373 | Terrestrial Soil | KISGLEHLTASKQMEVLGGLLDIPGGRPRSSQKDILTT* |
| Ga0134126_122052542 | 3300010396 | Terrestrial Soil | MIKISGLEHLTASEQPEVLEGLLDVFEGRPRSNQEDALTT* |
| Ga0134126_124902891 | 3300010396 | Terrestrial Soil | LRAPYMIKISGFEHLTVSKQPQVLKELLNIPEGRPRSNQKDVQTT* |
| Ga0134126_129425721 | 3300010396 | Terrestrial Soil | MIKILGLEHLTALEQPEVLGGLLDVSDGRPRSNEKDVLTT* |
| Ga0134122_128990401 | 3300010400 | Terrestrial Soil | MIKMSGLEHLTASKQMEVFEGLLDVSEERTRRNQKDVLTI |
| Ga0134099_11073242 | 3300012521 | Switchgrass Degrading | MIKISGLEHLTASEQPKVLGGLLDVSEGKPRSNQKDVLTT* |
| Ga0157380_117316152 | 3300014326 | Switchgrass Rhizosphere | MIKISGLENLTASKQMGVLEGLLDVSEGRTRSNQKDVLTT* |
| Ga0157379_108735681 | 3300014968 | Switchgrass Rhizosphere | MIKISGLEHLTASKQTEVLEGLLDVFEGRTRSNQKDVLT |
| Ga0157379_118692011 | 3300014968 | Switchgrass Rhizosphere | PYGARILHAPYMIKISRLEHLTASKQPEVLGGLLDVFEGRPRRMF* |
| Ga0182183_10266491 | 3300015270 | Switchgrass Phyllosphere | MIKILGLEHLAASKQTEVLEGLLDVSEGRTRSNQKDVLTT |
| Ga0182183_10506711 | 3300015270 | Switchgrass Phyllosphere | LRAPYKIKISGLEHLTASKQPGELGRLLDVLKGRPRGNQKDVLTI* |
| Ga0182183_10616081 | 3300015270 | Switchgrass Phyllosphere | MIKISGLEHLIVSKQLEELGRLLDVLEGRPRSNQKDVLTT* |
| Ga0182183_10853111 | 3300015270 | Switchgrass Phyllosphere | MIKISGLEHLTASKQMEVLEALLDVPEGRTRSNRKDVLTTRNTQRR |
| Ga0182102_10159902 | 3300015273 | Switchgrass Phyllosphere | ATPYRARVLRAPYMLKISGYEHLTASKQPEVPGGLLDVFEGRHRNNQGQE* |
| Ga0182099_10193622 | 3300015278 | Switchgrass Phyllosphere | MIKISGLEHLTASRQPEVLGGLLDVSEGRTRSNQEEVLIT* |
| Ga0182099_10516551 | 3300015278 | Switchgrass Phyllosphere | MIKISGLEHLTASEQPEVLGGLLDESEGRPRINQKIF* |
| Ga0182100_10682892 | 3300015280 | Switchgrass Phyllosphere | MIKILGLEHLTALEQPEVLERLLDVLHGRPRSNQRDVLTT* |
| Ga0182101_10463351 | 3300015284 | Switchgrass Phyllosphere | MIKNSGLEHLIASEQPEELGRLLDVLEGRPRNNQKDVLIT* |
| Ga0182105_10067892 | 3300015290 | Switchgrass Phyllosphere | MIKISELEHLIASKQPEVLEELLDVSEGRPRSNQEDVLTT* |
| Ga0182105_10229141 | 3300015290 | Switchgrass Phyllosphere | MIKISGLEHLTASKQTEVLEGLLDVYEGRVRSNRK |
| Ga0182105_10750081 | 3300015290 | Switchgrass Phyllosphere | ARVLRALYMIKISGLEHLTASKQSEVLEELLDVSKGRTRSNKKDVLTT* |
| Ga0182105_10940421 | 3300015290 | Switchgrass Phyllosphere | MIKISGLEHLTASKQTEELEGLLDVSEGRTKSNQKDVLTT* |
| Ga0182103_10411563 | 3300015293 | Switchgrass Phyllosphere | MINILGLEHLTASKQTEVLEGLLDVSEGRVRSNQKDVL |
| Ga0182103_10729441 | 3300015293 | Switchgrass Phyllosphere | MIKISRLEHLTASKQMEVLEELLDVSEGRTRRMF* |
| Ga0182103_10844212 | 3300015293 | Switchgrass Phyllosphere | IKISGLEHLTASEQPEVHGGLLDVSEGRLRSNRKGVLTT* |
| Ga0182103_10919941 | 3300015293 | Switchgrass Phyllosphere | YGARVLRAPYINKNSGLEHLTASEQLEELGRLLNVLEGRPRSNQKDVLTI* |
| Ga0182104_10452511 | 3300015297 | Switchgrass Phyllosphere | MIKISGHEHLTASEQPEELGKLLAVLE*RSRGNHKDVLTT |
| Ga0182104_10778751 | 3300015297 | Switchgrass Phyllosphere | GARVLHAPYMIKISRLEHLTTSEQPEVLGGLLDISEERPRSNQKDVLTT* |
| Ga0182184_10181651 | 3300015301 | Switchgrass Phyllosphere | MIKISGLEHLTASKQPQVLEELLDVPVGRPRSDQKDVQVT* |
| Ga0182184_10623811 | 3300015301 | Switchgrass Phyllosphere | GARVLRTPYMIKISGLEHLTASEQPEVLGGLLDISEGRPRSNQKDVLTT* |
| Ga0182184_10694891 | 3300015301 | Switchgrass Phyllosphere | MIKISGLEHLTASKQTEVLEGLLNVSEGRVRSNQKDILTTRRT |
| Ga0182180_10370502 | 3300015306 | Switchgrass Phyllosphere | GLEHLTASKQPEVLGGLLDVSEGRPRGNQKHVLTT* |
| Ga0182098_10959941 | 3300015309 | Switchgrass Phyllosphere | PYGARVLCAPYMIKISRLEHLTVSEKLEVLGRLLDVSKGRPRSNQKDVLTT* |
| Ga0182098_10969171 | 3300015309 | Switchgrass Phyllosphere | IKISGLEHLTASKQPEVLGGLLDVSEGRPRGNQKHVLTT* |
| Ga0182162_10213181 | 3300015310 | Switchgrass Phyllosphere | YGTRVLHAPYMIKISGLEHLTASEQLEVLGGILDVSEGRIRSNQEDVLTT* |
| Ga0182162_11208391 | 3300015310 | Switchgrass Phyllosphere | LRAPYMIKISGLEHLTASKQTEVLEGLLNVSKGRTRSNQEEVLIT* |
| Ga0182182_10160441 | 3300015311 | Switchgrass Phyllosphere | MIKISGLEHLTASEQPEVLGGLLDVSEGRPKSDLEDILT |
| Ga0182182_10590341 | 3300015311 | Switchgrass Phyllosphere | IKISVLEHLTASKQLQVLGGLLDVFEGRLRSSQKKVLTT* |
| Ga0182182_10776401 | 3300015311 | Switchgrass Phyllosphere | ATPYGARVLRAPYMIKISGLEHLTASKQPEVLGRLLDVSEERPRSNQKYFLTT* |
| Ga0182182_10803601 | 3300015311 | Switchgrass Phyllosphere | GARVLRAPYMIKILGLEHLTASKQTEVLEGLLDVTEGRTRSNQKDVLTT* |
| Ga0182168_10177421 | 3300015312 | Switchgrass Phyllosphere | MIKISGLEHLTASKQTEVLEGLLDVYEGRTRRNQEEVLII* |
| Ga0182168_11113991 | 3300015312 | Switchgrass Phyllosphere | MIKISGLEHLTASKQPEVLGELLDVSEGRLRNNQEDVLTT* |
| Ga0182164_10426632 | 3300015313 | Switchgrass Phyllosphere | MIKISGLEHLTALKQPEVLGGLLDVSEGRPRSNHKDVLTT* |
| Ga0182164_10440522 | 3300015313 | Switchgrass Phyllosphere | MIKISELEHLTASKQPEELGRLLDVLEGRPRSNQKDVRTT* |
| Ga0182164_10498142 | 3300015313 | Switchgrass Phyllosphere | MIKISGLEHLTASEQLEVLGGLLDVPEGRPRSNQKDV* |
| Ga0182164_10499781 | 3300015313 | Switchgrass Phyllosphere | MIKISGLEHLTVSEHPEVLGRLLDVPEGRPRNNQKDVLIT* |
| Ga0182120_11335741 | 3300015315 | Switchgrass Phyllosphere | MIKILGLEHLTASEQPEVLEGLLDVSKGRPRSNQKDVLTV* |
| Ga0182121_10590552 | 3300015316 | Switchgrass Phyllosphere | MIKILGLEHLIASKQMEVLERLLDIPGGRPRSSQKDILTT* |
| Ga0182136_10704771 | 3300015317 | Switchgrass Phyllosphere | MIKILGFEHLTASKQPEVLEGLLDVSKGRLRNNREDVL |
| Ga0182136_10768722 | 3300015317 | Switchgrass Phyllosphere | MIKILGLEHLTALDQPEVLGGLLDVSEGRLRNNQEDVLTT* |
| Ga0182136_10789412 | 3300015317 | Switchgrass Phyllosphere | MIKNSGLEHLIASEQPEELGRLLDVLEGRPRNNQK |
| Ga0182136_11373771 | 3300015317 | Switchgrass Phyllosphere | LRAPYMTKISGLEHLTALEQPEVLGGLLDVPEENNQKDDPTT* |
| Ga0182136_11377051 | 3300015317 | Switchgrass Phyllosphere | MIKISGLEHLTASEQPEVLGGLLDVSEGSPRSNQKDVLTI |
| Ga0182181_10607632 | 3300015318 | Switchgrass Phyllosphere | MIKISGLEHLTASKQMGVLGGLLDEVEGRSKSNQKDVLTI* |
| Ga0182181_10702481 | 3300015318 | Switchgrass Phyllosphere | MIKISGLEHLTASEQPEIYGGLLDVSEGRLRRCSDCMKY |
| Ga0182130_11266121 | 3300015319 | Switchgrass Phyllosphere | GLEHLTASKQSEVLGELLDVPEGRTRSNLTDVPTT* |
| Ga0182165_10321682 | 3300015320 | Switchgrass Phyllosphere | MIKISGLEHLTASKQPEVLGGLLDVSEGRPRSNQKDVQIT* |
| Ga0182148_10307572 | 3300015325 | Switchgrass Phyllosphere | MLKISEHDHLTASKQPEVPGGLLDVSEERLRNNQEEVLIT* |
| Ga0182148_11253372 | 3300015325 | Switchgrass Phyllosphere | MIKISGLEHLTASEQPEVLAGLLDKSEGRPRINQKIF* |
| Ga0182114_10484822 | 3300015327 | Switchgrass Phyllosphere | MIKISGLEHLTGSKQSEVLGRLLDVSEERPRSNQKDVL |
| Ga0182114_10673601 | 3300015327 | Switchgrass Phyllosphere | MIKISGLEHLTASEQPEVLGRLLDVSERRPRSNQK |
| Ga0182114_10687361 | 3300015327 | Switchgrass Phyllosphere | MIKISGLEHLTVSKQMEVLEGLLDISEGRTRSNQEEVLIT* |
| Ga0182114_11148311 | 3300015327 | Switchgrass Phyllosphere | QVLRAPYMIKISGLEHLIASKQPEVLGGLLDVFEGRPRSNQKDVLTT* |
| Ga0182114_11357022 | 3300015327 | Switchgrass Phyllosphere | MIKISGLEHLTASELPEVIGRLLDVSEGRPRSNQRDVLTI* |
| Ga0182153_10848971 | 3300015328 | Switchgrass Phyllosphere | KISRLEHLTASEQPKVLGGLLDVSEGRPRSNQKDVLTT* |
| Ga0182153_11268481 | 3300015328 | Switchgrass Phyllosphere | MIKISGIEHLTASMQMEVLEGLIDVSEGRTRSNQKDVL |
| Ga0182135_10753361 | 3300015329 | Switchgrass Phyllosphere | MIKISGLEHLAASEQPKVLGGLLDVFEGKPRSNQKDV |
| Ga0182135_11062762 | 3300015329 | Switchgrass Phyllosphere | MFKISGLEHLTASKQPEVLGGLLDVSKKKTKSNQKDVLIT* |
| Ga0182135_11513981 | 3300015329 | Switchgrass Phyllosphere | MIKILGLEHLTASKQPEVLGGLLDVSEGRFRNNQEDVLTT* |
| Ga0182135_11542642 | 3300015329 | Switchgrass Phyllosphere | MIKILGLEHLTASKQPEVLGRLLDVSEGKPRNNQKDVLTT* |
| Ga0182152_11462171 | 3300015330 | Switchgrass Phyllosphere | MIKISGHEHLIASEQPEELGGLLDILEGRLRSNQKDVLTT* |
| Ga0182131_10614021 | 3300015331 | Switchgrass Phyllosphere | MIRISGLEHLTALEQPEVLEGLLDVSEGRPRSNQKDVLTT |
| Ga0182131_10882911 | 3300015331 | Switchgrass Phyllosphere | MIKISGLEHLTASEQLEELGRLLDVLEGRPRSNQKDVLTT* |
| Ga0182131_11158801 | 3300015331 | Switchgrass Phyllosphere | CDSTYGSGATSYGARVLRALYMIRISGLEHLTASKQLEVLEGLLDVSEGRSRSNPE* |
| Ga0182131_11431682 | 3300015331 | Switchgrass Phyllosphere | MIKISGLEHLTASKQPEVLRGLLDVSKKKTKSNQKDVLIT* |
| Ga0182131_11478092 | 3300015331 | Switchgrass Phyllosphere | MIKISGLEHLTASKQMEVLEGLLDISEERTRSNQKDVLTT* |
| Ga0182117_10144722 | 3300015332 | Switchgrass Phyllosphere | MIKISELEHLIVSKQPEVLEGLLDVSKGRPRSSQKDVLTT |
| Ga0182147_10370701 | 3300015333 | Switchgrass Phyllosphere | MIKISALEHLIASKQPKILGGLLDISEGRPKSNRK |
| Ga0182147_10767271 | 3300015333 | Switchgrass Phyllosphere | MIKISGLEHHTASEQPKVLGGLLYMSEGRRRSNQK |
| Ga0182147_11068491 | 3300015333 | Switchgrass Phyllosphere | PYMIKISELEHLTASEQLEEVGRLLDVLKGRPRSNQKDVLTT* |
| Ga0182147_11102931 | 3300015333 | Switchgrass Phyllosphere | KISGLEHLTASEQPEVLGILLDVFRGRPRSNQKY* |
| Ga0182147_11385971 | 3300015333 | Switchgrass Phyllosphere | MIKISGLEHLTALKQMEVLGGLLDEAGGRTRSNQKDILTT* |
| Ga0182147_11503091 | 3300015333 | Switchgrass Phyllosphere | ILGHEHLTASVQPGVLGRLLEVFEGRLRSNQKDVLTT* |
| Ga0182132_10455531 | 3300015334 | Switchgrass Phyllosphere | MIKISGLEHLTTSEQMEVLGGQLDVSEGRIRCNQNN |
| Ga0182132_11192981 | 3300015334 | Switchgrass Phyllosphere | TPYGARVLRAPYMIKISGLEHLTASEQPGVLGGLLDVFEGRPRSNQKDVLTT* |
| Ga0182132_11445091 | 3300015334 | Switchgrass Phyllosphere | MIKISGLEHLTASKQTEVLEGLLDVSEGRTRSNQKDV |
| Ga0182116_10331032 | 3300015335 | Switchgrass Phyllosphere | MIKISGLEHLTASEQPEVLGGLLDVSEGRPKSDPE |
| Ga0182116_11339441 | 3300015335 | Switchgrass Phyllosphere | MIKILGLEHLTASKQPEVLGGLLDVFEGKPGSNQKDVLTT* |
| Ga0182150_10210443 | 3300015336 | Switchgrass Phyllosphere | APYMIKISWLEHLTASKQTEVLEGLLDIFEGRTRSNQKDVLTT* |
| Ga0182150_11189302 | 3300015336 | Switchgrass Phyllosphere | MIKISGLEHLTASKQMEVLEGLLDVFEGRTRSNQKDVLTT* |
| Ga0182151_10351642 | 3300015337 | Switchgrass Phyllosphere | MIKISGLEHLTASKQMEVLGGLLDIPGGRPRSSQKDILTT* |
| Ga0182151_10889371 | 3300015337 | Switchgrass Phyllosphere | GATPYGARVLPAPYIIKIPGLEHLTTSEQPEVLGGLLDVSEGRPRSNQKDVQIT* |
| Ga0182151_11499572 | 3300015337 | Switchgrass Phyllosphere | MIKISGLEHLTALKKPQVLEELLDVPEGRPRSKQKDVQTT* |
| Ga0182151_11590671 | 3300015337 | Switchgrass Phyllosphere | GATPYGARVLRAPYMIKISGLEHLTASKQPEVLGGLLDMSEGRPISN* |
| Ga0182137_11715531 | 3300015338 | Switchgrass Phyllosphere | MIKILGLEHLTALKQTEVLEGLLDVTEGITNSNQKEILDN* |
| Ga0182149_10999131 | 3300015339 | Switchgrass Phyllosphere | IIKISGLEHLTALEQLEVLGRLLDVFEGRPKSSLKDVLTT* |
| Ga0182149_11755831 | 3300015339 | Switchgrass Phyllosphere | MIKISGLEHLIASKQPKVLGRLLDVPKGKLGSDQKDVLTT* |
| Ga0182133_11281781 | 3300015340 | Switchgrass Phyllosphere | MIKNLGLVHLTASKQPEELVRLLDVLEERPRRNQKDVLTT* |
| Ga0182133_11411341 | 3300015340 | Switchgrass Phyllosphere | YMIKILGYEHLKASEQPEVLGGLLDVPKRKLRSNQKDILTT* |
| Ga0182115_11470521 | 3300015348 | Switchgrass Phyllosphere | ARVLRAPYMIKILGLEYLTASEQTEVLGRLLDVLKGRPRSDQKHILTT* |
| Ga0182115_11614612 | 3300015348 | Switchgrass Phyllosphere | MIKISGLEHLTASEQPEELRGLLDVSEGRQEATRRMF* |
| Ga0182115_12033891 | 3300015348 | Switchgrass Phyllosphere | MIKISGLEHLTASEQLEVLGGLLDVSEGRPKSDLEDILTT* |
| Ga0182115_12585991 | 3300015348 | Switchgrass Phyllosphere | YMIKISGLEHLTASEQLEVLGGLLDVSEGRPRSNQKDVLTT* |
| Ga0182115_12965841 | 3300015348 | Switchgrass Phyllosphere | RVLHASYMIKISGLEHLTASKQLKEHGRLLDVLEGRPRSSQKDVLTT* |
| Ga0182185_11003762 | 3300015349 | Switchgrass Phyllosphere | MIRISGIEHLTASKQLEVLEGPLDISEGRSRRKQKDI |
| Ga0182185_11613991 | 3300015349 | Switchgrass Phyllosphere | MIKISGLEHLTTLKQLEVLGRLLDVLEGRTRSNQKDVRTT* |
| Ga0182185_11972872 | 3300015349 | Switchgrass Phyllosphere | MIRISGLEHLTASKKPEVLEGLLDVSEGRPRINQKDVLTT* |
| Ga0182185_12321411 | 3300015349 | Switchgrass Phyllosphere | LVLRTPYMIKISGLEHLTASKQMEVLEGLLDVSEGRTRSNQVDVLST* |
| Ga0182185_12377001 | 3300015349 | Switchgrass Phyllosphere | MIKISGLEHLTTSKQMEVLGGLLDVSEGRIRCNQNNV |
| Ga0182185_12451401 | 3300015349 | Switchgrass Phyllosphere | MIKISELEHLTASKQPEVLGGLLDELEGRPRSNQ* |
| Ga0182185_12515852 | 3300015349 | Switchgrass Phyllosphere | MIKILGLEHLTASKQTEVLEGLLDVFEGRIRSNQKDVLTT* |
| Ga0182163_10746331 | 3300015350 | Switchgrass Phyllosphere | MIKNLGLVHLTASKQPEELGRLLDVLEERPRRNQKDVLTT* |
| Ga0182169_11715241 | 3300015352 | Switchgrass Phyllosphere | MIKISELEYLTASKQPEVLGGLLDELEGRPRSNQK |
| Ga0182169_12394591 | 3300015352 | Switchgrass Phyllosphere | TPYGARVLRAPYMIKISGLEHLTASEQTEVLEGLLDVSEGRTRSNQKDVLIT* |
| Ga0182169_12465521 | 3300015352 | Switchgrass Phyllosphere | LRAPYMIKISGLEHLIASEQPGVLGRLLDVSEGRPRSNQKNIQTT* |
| Ga0182169_12680301 | 3300015352 | Switchgrass Phyllosphere | APYMIKISGLEHLTASKQPEVIGGLLDVSEERTRSNQKDILNT* |
| Ga0182179_11870432 | 3300015353 | Switchgrass Phyllosphere | MIKISELEHLTTSMLMEVLEELLDVSEGRTRSNQEEVLII* |
| Ga0182179_12058602 | 3300015353 | Switchgrass Phyllosphere | VLCAPYMIKISGLEHLTASEQSEVLGGLLDISEGRPRSNQKDVLTT* |
| Ga0182167_10515083 | 3300015354 | Switchgrass Phyllosphere | MIKISGLEHLTASELPEVIGRLLDVSEGRPRSNQKDVLTI* |
| Ga0182167_11820732 | 3300015354 | Switchgrass Phyllosphere | MIEISGLEHLIASEQPQVLGRLFYVLEGRPRSNQKDVQTTGSTRR |
| Ga0182167_11882132 | 3300015354 | Switchgrass Phyllosphere | APYMIKISGLEHLTASKKTEVLEGLLDIFEGRTRRNQKDVLTT* |
| Ga0182167_12082672 | 3300015354 | Switchgrass Phyllosphere | VLRAPYMNKISGLEHLTTSEQTEELGGLIDVSKGRTRSNQKDVLTT* |
| Ga0182167_12613541 | 3300015354 | Switchgrass Phyllosphere | MIKISGLEHLTVSEQLGVLGRLLDVFEGRPRSNQKNIQTT* |
| Ga0182167_12918291 | 3300015354 | Switchgrass Phyllosphere | IKISGLEHLTASKQPEVLGGLLDVSKRKTRSNQKDVLIT* |
| Ga0182167_13569391 | 3300015354 | Switchgrass Phyllosphere | MIKNLGLVHLTASKQPEELGRLLDVLKERPRRNQKDVLTT* |
| Ga0182167_13584451 | 3300015354 | Switchgrass Phyllosphere | MIKISGLEHLTALKQPEVFGGLLDVSEGRTRSNQKDVLIT* |
| Ga0182197_11065071 | 3300017408 | Switchgrass Phyllosphere | MIKNSGLEHLTASEQPEVLGILLDVSKRRPRSNQKDVLTA |
| Ga0182197_11099661 | 3300017408 | Switchgrass Phyllosphere | IKISGLEHLTASEQPEVLGGLLDVPEGRTRSILKKVLTT |
| Ga0182197_11250481 | 3300017408 | Switchgrass Phyllosphere | VRVLRAPYMIKILGLEHLTASEQPQVLGGLLDASEGRLRSNQKDVLIT |
| Ga0182197_11348671 | 3300017408 | Switchgrass Phyllosphere | MNKISGLEHLTASRQPEVLGRLLDVLEGKPRSNQKDVLTT |
| Ga0182197_11450001 | 3300017408 | Switchgrass Phyllosphere | GLEHLTASKKPEVPGGLLDVSEGRPGSDQKDVLTT |
| Ga0182199_10987261 | 3300017412 | Switchgrass Phyllosphere | MIKILGHEHLIASEQLEVLGRLLKVFDRRPRSNQKDVLHTLST |
| Ga0182199_11399491 | 3300017412 | Switchgrass Phyllosphere | MIKNLGLVHLTVSKQPEELGRLLDVLEERPRRNQKDVLTT |
| Ga0182199_11610621 | 3300017412 | Switchgrass Phyllosphere | IKISGLEHLTASKQTEVLEGLLDVSEGRTRSNRKDVLTT |
| Ga0182195_10803482 | 3300017414 | Switchgrass Phyllosphere | MIKISGLEHLTTSKQMEVLEGLLDVSEGRTRSNQVDVLTA |
| Ga0182195_11718681 | 3300017414 | Switchgrass Phyllosphere | VLRAPYMIKISGLEHLTASEQLQVLGRLLDVLEGRLRSNEKDVHTA |
| Ga0182213_12441821 | 3300017421 | Switchgrass Phyllosphere | MIKISGLEHLTALKQPEVLGGLLDVSEGRLISNQKDVLTT |
| Ga0182201_10578672 | 3300017422 | Switchgrass Phyllosphere | MIKISGLEHLTASEQPEVLGRLLDVLEGRPRSNQKD |
| Ga0182201_10681371 | 3300017422 | Switchgrass Phyllosphere | MIKISVLEHLTASGQPEELGRLLDVLEGRPRNNQKDVLTT |
| Ga0182201_11100731 | 3300017422 | Switchgrass Phyllosphere | MNKISGLEHLTASEQPEVLGRLLEVLEGRPGSNQMDVLTT |
| Ga0182196_10439572 | 3300017432 | Switchgrass Phyllosphere | MIKSSGLEHLTALKQTEVLGGLLDEVAGRSRSNQKDVLTT |
| Ga0182194_10667041 | 3300017435 | Switchgrass Phyllosphere | YGARVLRAPYMIQISGLEHLTASKQPEVLGGLLDVLEGRTRSNLKDVLTT |
| Ga0182198_10211871 | 3300017445 | Switchgrass Phyllosphere | MIKNSGLEHLIASEQPEELGRLLDVLEGRHRNNQKDVLTT |
| Ga0182217_10651251 | 3300017446 | Switchgrass Phyllosphere | MIKISGLEHLTASEQLEELEGLLDVSEGRSRSNQKDALTT |
| Ga0182217_11071171 | 3300017446 | Switchgrass Phyllosphere | PYGARVLRAPYMIKISELEHLIVSKQPEVLEGLLDISKGRPRSSQKDVLTT |
| Ga0182212_11625491 | 3300017691 | Switchgrass Phyllosphere | MIKISELEHLTAAEQLEEVGRLLDVLKGRPRSNQKDVLTTYLKKLH |
| Ga0182216_11294431 | 3300017693 | Switchgrass Phyllosphere | MIKISGLEHLIASKQLEVLGRLLDERKPGSNQKDLLTT |
| Ga0182216_11381482 | 3300017693 | Switchgrass Phyllosphere | MIKILGHEYLIASEQPEVLGRLLDVPEGRPRSNQDDVLAT |
| Ga0182211_11212631 | 3300017694 | Switchgrass Phyllosphere | MIKISGLEHLTASKQLEVLGELLDVPEGRTRSNLK |
| Ga0182146_1047362 | 3300020033 | Switchgrass Phyllosphere | MIKISGLEHLTASKQTEVLEGLLDVFEGRTRSNQKDVL |
| Ga0207697_103604751 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKISGLEHLTASKQTDVLEGLLDVFEGRTRSNQKD |
| Ga0207653_100596552 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKISGLEHLTASKQMEVLEGLLDIFEGRTRSNQKDVLTT |
| Ga0207662_104338691 | 3300025918 | Switchgrass Rhizosphere | FRTPYMIKILGLEHLTTSEQPEVLGGLLDVFEGRPRINQKDVLTT |
| Ga0207650_104098342 | 3300025925 | Switchgrass Rhizosphere | MIKISGLEHLTASKQMEVLEGLLDVSEGKTRSNQEEVLIT |
| Ga0207641_118698541 | 3300026088 | Switchgrass Rhizosphere | MIKNLGLVHLTASKQPEELGRLLDVLEERPRRNQKDVLTT |
| Ga0207676_122660052 | 3300026095 | Switchgrass Rhizosphere | MIKISGLEHLTASKQMEVLEGLLDVSEGMTRSNQKDVLTA |
| Ga0268322_10395961 | 3300028049 | Phyllosphere | GATPYGARVLRAPYMINISGLEHLTASKQTKVLGELLDVPEGRSRSNQKDVLTT |
| Ga0268328_10531191 | 3300028050 | Phyllosphere | MIKISGLDYLIASKQMEVLGGLLDISKGMTRSNQKDVLT |
| Ga0268344_10138192 | 3300028051 | Phyllosphere | MIKISGLEYLTASEQPEVNGRLFDVSEERPRSNQKEVLAT |
| Ga0268346_10140162 | 3300028053 | Phyllosphere | MIKISRLEHLTASKQTEVLEELLDVSEGRTRSNQKDV |
| Ga0268346_10212952 | 3300028053 | Phyllosphere | MIKISGLEHLTASKQPEVLEGLLDVSKGRLRNNQEDVLTT |
| Ga0268306_10306441 | 3300028054 | Phyllosphere | VLRAPYMIKISGLEHLTASEQLQVLGGFLGASEGRPRSNQKDVLTT |
| Ga0268332_10171362 | 3300028058 | Phyllosphere | MIKISGLEHLTVSKQPEVLGGLLDVSEGRLRSNQKDILTT |
| Ga0268332_10350191 | 3300028058 | Phyllosphere | PTPYGARVLRAPYMIEISGLEHLTVSKQTEVLEGLLDVSEGRTRSNQEEVLIT |
| Ga0268332_10388931 | 3300028058 | Phyllosphere | MIKILGHEHLTASEQPEVLGRLLEVLEGRPGSNQMDVLTT |
| Ga0268314_10322901 | 3300028061 | Phyllosphere | MIKISGLEHLTASKQMEVLEGLLDVSEGRTRSNQKDVPTT |
| Ga0268314_10449291 | 3300028061 | Phyllosphere | TPYGARVLRAPYTIKISGLEHLTASEQLEVLGGLLDVSEGRPRSNQKDVLTT |
| Ga0268340_10572691 | 3300028064 | Phyllosphere | MIKNLGLVHLTASKQPEELGRLLDVLEERPRKNQKDVLTT |
| Ga0268340_10862561 | 3300028064 | Phyllosphere | MIKISGLEHLTSLKQPEVLEGLLDVTKGRPRSNQKDVLT |
| Ga0268310_10461412 | 3300028262 | Phyllosphere | MIKISGLEHLTASKQMEVLEGLLDVSEGRTRSNQEEVLII |
| Ga0268266_114963981 | 3300028379 | Switchgrass Rhizosphere | MIKISGLEHLTASKQTEVLEGLLDVSEGRTRNNQE |
| Ga0268319_10143521 | 3300028473 | Phyllosphere | SGATPYGARVLCAPYMIKILGLEHLTASEQPQVLGGLLDISKGKPRSNQKDVLTT |
| Ga0268319_10207341 | 3300028473 | Phyllosphere | ISGLEHLTASEQPRVLGGLLGASERRPRSNQKDVLTI |
| Ga0268339_10101461 | 3300028526 | Phyllosphere | GSGATPYGVRVLRTPYMIKISGLEHLTTSKQMGVLGGLLDEVEGRSKSNQKDVLTI |
| Ga0268335_10181401 | 3300028527 | Phyllosphere | RTYMIKISGHEQMKVLEGLLDVSEGRTRSNQKDVLTT |
| Ga0214493_10719312 | 3300032465 | Switchgrass Phyllosphere | MIKISGLEHLTASEQPEVLGRLLDVPEGRLGSNQKDVL |
| Ga0214491_11383221 | 3300032469 | Switchgrass Phyllosphere | MIKISGLEHLTASKQTEVFEGLLDVSEERTRSNQKDVLTI |
| Ga0214490_11121051 | 3300032502 | Switchgrass Phyllosphere | LRAPYMIKISGLEHLTASKQLEVLGGLLDVSEGRQRSNQKDILTS |
| Ga0321339_11231321 | 3300032551 | Switchgrass Phyllosphere | MLKISGHEHLTASKQPEVPGGLLDVSEGRLRNNQEDILTTWSTQRHP |
| Ga0321339_11558591 | 3300032551 | Switchgrass Phyllosphere | FSYEGTLHTPYGARVLRAPYMIKISGLGTSLPRSNQKYLERLLDVSEGRLRNNQKDVLTT |
| Ga0214501_11786922 | 3300032625 | Switchgrass Phyllosphere | MIKISRLEHLTASKQMEVLEGLLDVSEGRTKSNQEEVLII |
| Ga0214497_11098101 | 3300032689 | Switchgrass Phyllosphere | SGATPYGARILRAYMMKISGLEHLTASKQTKVLGRLLDVSEGRPRSNQKDVLTT |
| Ga0314719_10361191 | 3300032821 | Switchgrass Phyllosphere | MIKISGLEHLIVSKQLEELGRLLDVLEGRPRSNQKDVLTT |
| Ga0314719_10459221 | 3300032821 | Switchgrass Phyllosphere | MIRILGLEHLTASEQPEVLEGLLDVSEGRPRSNQKDVLTT |
| Ga0314723_10465052 | 3300032823 | Switchgrass Phyllosphere | MIKILGLEHLRASEQPQVLGGLLDASEGRLRSNQKD |
| Ga0314747_10098781 | 3300032890 | Switchgrass Phyllosphere | TPYGARVLRAPYMIKISGLEHLTASKQMEVLEGLLDISEGRVRSK |
| Ga0314734_10835571 | 3300032916 | Switchgrass Phyllosphere | KISGLEHLTALKQPEVLGGLLDVSGGRPRSNQKHVLTT |
| Ga0314752_10784911 | 3300032976 | Switchgrass Phyllosphere | ATPYGARVLRAPYMIKISGLEHLTASKQMEVLEGLLDISEGRVRSK |
| Ga0314752_11150301 | 3300032976 | Switchgrass Phyllosphere | VPYMIKILGHEHLTVSEQTEVLEGLLDVPEARTRSNQKDILTT |
| Ga0314768_13594281 | 3300033523 | Switchgrass Phyllosphere | LRAPYMIKISGLEHLTASEQPEVLEGLLDVSEGRPRSNQKDVLTT |
| Ga0314760_11112861 | 3300033530 | Switchgrass Phyllosphere | MIKISGLEHLTALKQMEVLEGLLGASEGRSRSNQKDVLTT |
| Ga0314760_11567681 | 3300033530 | Switchgrass Phyllosphere | KISRLEHLTASKQMKVLEGLLDISEGRTRSNQKDVLTA |
| Ga0314770_12326821 | 3300033533 | Switchgrass Phyllosphere | IKISLLEHLTASEQPEVLEGLLDISEGRPRSNQKDVLTT |
| Ga0314757_10546071 | 3300033534 | Switchgrass Phyllosphere | MIKISGLEHLTGSKQSEVLGRLLDVSEGRPRSNQKD |
| Ga0314755_10637491 | 3300033538 | Switchgrass Phyllosphere | MFKISGFEHLTASKQQEVLGRLLDVLDRRTRSNQKDVLII |
| Ga0314755_11585691 | 3300033538 | Switchgrass Phyllosphere | GARLLRAPYRIKISGLVHLIVSEQPEILGGLHDVSKGRPRSDQKDVLTT |
| Ga0314769_12852431 | 3300033542 | Switchgrass Phyllosphere | MIKISGLEHLTASKKPEVPGGLLDVSEGRPGSDQKDVLTT |
| ⦗Top⦘ |