Metagenome / Metatranscriptome Family F019942

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F019942
Family Type	Metagenome / Metatranscriptome
Number of Sequences	226
Average Sequence Length	41 residues
Representative Sequence	YMIKISGLEHLTASEQLEVLGGLLDVSEGRPRSNQKDVLTT
Number of Associated Samples	113
Number of Associated Scaffolds	226

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	1.77 %
% of genes near scaffold ends (potentially truncated)	59.73 %
% of genes from short scaffolds (< 2000 bps)	100.00 %
Associated GOLD sequencing projects	112
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (79.646 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (72.124 % of family members)
Environment Ontology (ENVO)	Unclassified (90.708 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (79.646 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 43.48% β-sheet: 0.00% Coil/Unstructured: 56.52%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.34
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 226 Family Scaffolds
PF04195	Transposase_28	3.98
PF14223	Retrotran_gag_2	0.44
PF00078	RVT_1	0.44

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
All Organisms	root	All Organisms	20.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
cellular organisms	root	All Organisms → cellular organisms	20.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	20.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	20.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	20.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	20.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	20.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	19.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	19.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	19.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	19.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	19.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	19.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	19.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	19.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	19.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	19.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	18.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	18.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	18.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	18.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	18.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	18.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	15.49 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	2.21 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.65 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	15.49 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	2.21 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005618\|Ga0068864_100814266	Not Available	918	Open in IMG/M
3300005842\|Ga0068858_101194784	Not Available	747	Open in IMG/M
3300005843\|Ga0068860_102083341	Not Available	589	Open in IMG/M
3300009092\|Ga0105250_10522027	Not Available	541	Open in IMG/M
3300009101\|Ga0105247_10571056	Not Available	834	Open in IMG/M
3300009101\|Ga0105247_10957061	Not Available	665	Open in IMG/M
3300009971\|Ga0105127_10684	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	819	Open in IMG/M
3300009975\|Ga0105129_102594	Not Available	907	Open in IMG/M
3300009980\|Ga0105135_113296	Not Available	660	Open in IMG/M
3300009980\|Ga0105135_117193	Not Available	614	Open in IMG/M
3300009980\|Ga0105135_121197	Not Available	575	Open in IMG/M
3300009980\|Ga0105135_122292	Not Available	565	Open in IMG/M
3300009980\|Ga0105135_126824	Not Available	530	Open in IMG/M
3300009980\|Ga0105135_127868	Not Available	523	Open in IMG/M
3300009980\|Ga0105135_129573	Not Available	512	Open in IMG/M
3300009981\|Ga0105133_107376	Not Available	767	Open in IMG/M
3300009989\|Ga0105131_121622	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	640	Open in IMG/M
3300009990\|Ga0105132_141983	Not Available	517	Open in IMG/M
3300009992\|Ga0105120_1033900	Not Available	614	Open in IMG/M
3300009994\|Ga0105126_1035271	Not Available	601	Open in IMG/M
3300009994\|Ga0105126_1037493	Not Available	588	Open in IMG/M
3300009994\|Ga0105126_1044429	Not Available	553	Open in IMG/M
3300009994\|Ga0105126_1054637	Not Available	511	Open in IMG/M
3300009995\|Ga0105139_1010782	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1186	Open in IMG/M
3300009995\|Ga0105139_1018677	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1012	Open in IMG/M
3300009995\|Ga0105139_1055181	Not Available	708	Open in IMG/M
3300009995\|Ga0105139_1076452	Not Available	627	Open in IMG/M
3300010281\|Ga0134090_1079959	Not Available	612	Open in IMG/M
3300010371\|Ga0134125_12525740	Not Available	558	Open in IMG/M
3300010373\|Ga0134128_11967085	Not Available	644	Open in IMG/M
3300010396\|Ga0134126_12205254	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	601	Open in IMG/M
3300010396\|Ga0134126_12490289	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	563	Open in IMG/M
3300010396\|Ga0134126_12942572	Not Available	515	Open in IMG/M
3300010400\|Ga0134122_12899040	Not Available	533	Open in IMG/M
3300012521\|Ga0134099_1107324	Not Available	564	Open in IMG/M
3300014326\|Ga0157380_11731615	Not Available	683	Open in IMG/M
3300014968\|Ga0157379_10873568	Not Available	852	Open in IMG/M
3300014968\|Ga0157379_11869201	Not Available	591	Open in IMG/M
3300015270\|Ga0182183_1026649	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	744	Open in IMG/M
3300015270\|Ga0182183_1050671	Not Available	616	Open in IMG/M
3300015270\|Ga0182183_1061608	Not Available	580	Open in IMG/M
3300015270\|Ga0182183_1085311	Not Available	521	Open in IMG/M
3300015273\|Ga0182102_1015990	Not Available	670	Open in IMG/M
3300015278\|Ga0182099_1019362	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	727	Open in IMG/M
3300015278\|Ga0182099_1051655	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	559	Open in IMG/M
3300015280\|Ga0182100_1068289	Not Available	575	Open in IMG/M
3300015284\|Ga0182101_1046335	Not Available	655	Open in IMG/M
3300015290\|Ga0182105_1006789	Not Available	1184	Open in IMG/M
3300015290\|Ga0182105_1022914	Not Available	839	Open in IMG/M
3300015290\|Ga0182105_1075008	Not Available	575	Open in IMG/M
3300015290\|Ga0182105_1094042	Not Available	530	Open in IMG/M
3300015293\|Ga0182103_1041156	Not Available	678	Open in IMG/M
3300015293\|Ga0182103_1072944	Not Available	567	Open in IMG/M
3300015293\|Ga0182103_1084421	Not Available	541	Open in IMG/M
3300015293\|Ga0182103_1091994	Not Available	525	Open in IMG/M
3300015297\|Ga0182104_1045251	Not Available	708	Open in IMG/M
3300015297\|Ga0182104_1077875	Not Available	590	Open in IMG/M
3300015301\|Ga0182184_1018165	Not Available	885	Open in IMG/M
3300015301\|Ga0182184_1062381	Not Available	595	Open in IMG/M
3300015301\|Ga0182184_1069489	Not Available	574	Open in IMG/M
3300015306\|Ga0182180_1037050	Not Available	704	Open in IMG/M
3300015309\|Ga0182098_1095994	Not Available	559	Open in IMG/M
3300015309\|Ga0182098_1096917	Not Available	557	Open in IMG/M
3300015310\|Ga0182162_1021318	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	932	Open in IMG/M
3300015310\|Ga0182162_1120839	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	517	Open in IMG/M
3300015311\|Ga0182182_1016044	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	983	Open in IMG/M
3300015311\|Ga0182182_1059034	Not Available	653	Open in IMG/M
3300015311\|Ga0182182_1077640	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	594	Open in IMG/M
3300015311\|Ga0182182_1080360	Not Available	587	Open in IMG/M
3300015312\|Ga0182168_1017742	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1019	Open in IMG/M
3300015312\|Ga0182168_1111399	Not Available	546	Open in IMG/M
3300015313\|Ga0182164_1042663	Not Available	773	Open in IMG/M
3300015313\|Ga0182164_1044052	Not Available	765	Open in IMG/M
3300015313\|Ga0182164_1049814	Not Available	734	Open in IMG/M
3300015313\|Ga0182164_1049978	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	733	Open in IMG/M
3300015315\|Ga0182120_1133574	Not Available	511	Open in IMG/M
3300015316\|Ga0182121_1059055	Not Available	720	Open in IMG/M
3300015317\|Ga0182136_1070477	Not Available	655	Open in IMG/M
3300015317\|Ga0182136_1076872	Not Available	635	Open in IMG/M
3300015317\|Ga0182136_1078941	Not Available	629	Open in IMG/M
3300015317\|Ga0182136_1137377	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	508	Open in IMG/M
3300015317\|Ga0182136_1137705	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	507	Open in IMG/M
3300015318\|Ga0182181_1060763	Not Available	629	Open in IMG/M
3300015318\|Ga0182181_1070248	Not Available	599	Open in IMG/M
3300015319\|Ga0182130_1126612	Not Available	519	Open in IMG/M
3300015320\|Ga0182165_1032168	Not Available	880	Open in IMG/M
3300015325\|Ga0182148_1030757	Not Available	870	Open in IMG/M
3300015325\|Ga0182148_1125337	Not Available	534	Open in IMG/M
3300015327\|Ga0182114_1048482	Not Available	805	Open in IMG/M
3300015327\|Ga0182114_1067360	Not Available	715	Open in IMG/M
3300015327\|Ga0182114_1068736	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	710	Open in IMG/M
3300015327\|Ga0182114_1114831	Not Available	581	Open in IMG/M
3300015327\|Ga0182114_1135702	Not Available	542	Open in IMG/M
3300015328\|Ga0182153_1084897	Not Available	633	Open in IMG/M
3300015328\|Ga0182153_1126848	Not Available	542	Open in IMG/M
3300015329\|Ga0182135_1075336	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	666	Open in IMG/M
3300015329\|Ga0182135_1106276	Not Available	585	Open in IMG/M
3300015329\|Ga0182135_1151398	Not Available	507	Open in IMG/M
3300015329\|Ga0182135_1154264	Not Available	503	Open in IMG/M
3300015330\|Ga0182152_1146217	Not Available	515	Open in IMG/M
3300015331\|Ga0182131_1061402	Not Available	722	Open in IMG/M
3300015331\|Ga0182131_1088291	Not Available	632	Open in IMG/M
3300015331\|Ga0182131_1115880	Not Available	568	Open in IMG/M
3300015331\|Ga0182131_1143168	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	521	Open in IMG/M
3300015331\|Ga0182131_1147809	Not Available	514	Open in IMG/M
3300015332\|Ga0182117_1014472	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1236	Open in IMG/M
3300015333\|Ga0182147_1037070	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	897	Open in IMG/M
3300015333\|Ga0182147_1076727	Not Available	693	Open in IMG/M
3300015333\|Ga0182147_1106849	Not Available	609	Open in IMG/M
3300015333\|Ga0182147_1110293	Not Available	602	Open in IMG/M
3300015333\|Ga0182147_1138597	Not Available	547	Open in IMG/M
3300015333\|Ga0182147_1150309	Not Available	529	Open in IMG/M
3300015334\|Ga0182132_1045553	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	840	Open in IMG/M
3300015334\|Ga0182132_1119298	Not Available	584	Open in IMG/M
3300015334\|Ga0182132_1144509	Not Available	538	Open in IMG/M
3300015335\|Ga0182116_1033103	Not Available	976	Open in IMG/M
3300015335\|Ga0182116_1133944	Not Available	573	Open in IMG/M
3300015336\|Ga0182150_1021044	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1050	Open in IMG/M
3300015336\|Ga0182150_1118930	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	577	Open in IMG/M
3300015337\|Ga0182151_1035164	Not Available	895	Open in IMG/M
3300015337\|Ga0182151_1088937	Not Available	646	Open in IMG/M
3300015337\|Ga0182151_1149957	Not Available	525	Open in IMG/M
3300015337\|Ga0182151_1159067	Not Available	512	Open in IMG/M
3300015338\|Ga0182137_1171553	Not Available	512	Open in IMG/M
3300015339\|Ga0182149_1099913	Not Available	634	Open in IMG/M
3300015339\|Ga0182149_1175583	Not Available	500	Open in IMG/M
3300015340\|Ga0182133_1128178	Not Available	600	Open in IMG/M
3300015340\|Ga0182133_1141134	Not Available	576	Open in IMG/M
3300015348\|Ga0182115_1147052	Not Available	754	Open in IMG/M
3300015348\|Ga0182115_1161461	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	718	Open in IMG/M
3300015348\|Ga0182115_1203389	Not Available	634	Open in IMG/M
3300015348\|Ga0182115_1258599	Not Available	553	Open in IMG/M
3300015348\|Ga0182115_1296584	Not Available	510	Open in IMG/M
3300015349\|Ga0182185_1100376	Not Available	831	Open in IMG/M
3300015349\|Ga0182185_1161399	Not Available	670	Open in IMG/M
3300015349\|Ga0182185_1197287	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	608	Open in IMG/M
3300015349\|Ga0182185_1232141	Not Available	561	Open in IMG/M
3300015349\|Ga0182185_1237700	Not Available	554	Open in IMG/M
3300015349\|Ga0182185_1245140	Not Available	545	Open in IMG/M
3300015349\|Ga0182185_1251585	Not Available	538	Open in IMG/M
3300015350\|Ga0182163_1074633	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	999	Open in IMG/M
3300015352\|Ga0182169_1171524	Not Available	709	Open in IMG/M
3300015352\|Ga0182169_1239459	Not Available	591	Open in IMG/M
3300015352\|Ga0182169_1246552	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	581	Open in IMG/M
3300015352\|Ga0182169_1268030	Not Available	554	Open in IMG/M
3300015353\|Ga0182179_1187043	Not Available	656	Open in IMG/M
3300015353\|Ga0182179_1205860	Not Available	627	Open in IMG/M
3300015354\|Ga0182167_1051508	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1414	Open in IMG/M
3300015354\|Ga0182167_1182073	Not Available	772	Open in IMG/M
3300015354\|Ga0182167_1188213	Not Available	757	Open in IMG/M
3300015354\|Ga0182167_1208267	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	714	Open in IMG/M
3300015354\|Ga0182167_1261354	Not Available	622	Open in IMG/M
3300015354\|Ga0182167_1291829	Not Available	580	Open in IMG/M
3300015354\|Ga0182167_1356939	Not Available	510	Open in IMG/M
3300015354\|Ga0182167_1358445	Not Available	508	Open in IMG/M
3300017408\|Ga0182197_1106507	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	576	Open in IMG/M
3300017408\|Ga0182197_1109966	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	569	Open in IMG/M
3300017408\|Ga0182197_1125048	Not Available	541	Open in IMG/M
3300017408\|Ga0182197_1134867	Not Available	526	Open in IMG/M
3300017408\|Ga0182197_1145000	Not Available	511	Open in IMG/M
3300017412\|Ga0182199_1098726	Not Available	669	Open in IMG/M
3300017412\|Ga0182199_1139949	Not Available	585	Open in IMG/M
3300017412\|Ga0182199_1161062	Not Available	554	Open in IMG/M
3300017414\|Ga0182195_1080348	Not Available	750	Open in IMG/M
3300017414\|Ga0182195_1171868	Not Available	559	Open in IMG/M
3300017421\|Ga0182213_1244182	Not Available	515	Open in IMG/M
3300017422\|Ga0182201_1057867	Not Available	689	Open in IMG/M
3300017422\|Ga0182201_1068137	Not Available	652	Open in IMG/M
3300017422\|Ga0182201_1110073	Not Available	554	Open in IMG/M
3300017432\|Ga0182196_1043957	Not Available	776	Open in IMG/M
3300017435\|Ga0182194_1066704	Not Available	687	Open in IMG/M
3300017445\|Ga0182198_1021187	Not Available	1123	Open in IMG/M
3300017446\|Ga0182217_1065125	Not Available	848	Open in IMG/M
3300017446\|Ga0182217_1107117	Not Available	656	Open in IMG/M
3300017691\|Ga0182212_1162549	Not Available	510	Open in IMG/M
3300017693\|Ga0182216_1129443	Not Available	627	Open in IMG/M
3300017693\|Ga0182216_1138148	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	611	Open in IMG/M
3300017694\|Ga0182211_1121263	Not Available	617	Open in IMG/M
3300020033\|Ga0182146_104736	Not Available	562	Open in IMG/M
3300025315\|Ga0207697_10360475	Not Available	646	Open in IMG/M
3300025885\|Ga0207653_10059655	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1284	Open in IMG/M
3300025918\|Ga0207662_10433869	Not Available	896	Open in IMG/M
3300025925\|Ga0207650_10409834	Not Available	1123	Open in IMG/M
3300026088\|Ga0207641_11869854	Not Available	602	Open in IMG/M
3300026095\|Ga0207676_12266005	Not Available	541	Open in IMG/M
3300028049\|Ga0268322_1039596	Not Available	570	Open in IMG/M
3300028050\|Ga0268328_1053119	Not Available	563	Open in IMG/M
3300028051\|Ga0268344_1013819	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	614	Open in IMG/M
3300028053\|Ga0268346_1014016	Not Available	721	Open in IMG/M
3300028053\|Ga0268346_1021295	Not Available	637	Open in IMG/M
3300028054\|Ga0268306_1030644	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	527	Open in IMG/M
3300028058\|Ga0268332_1017136	Not Available	849	Open in IMG/M
3300028058\|Ga0268332_1035019	Not Available	676	Open in IMG/M
3300028058\|Ga0268332_1038893	Not Available	653	Open in IMG/M
3300028061\|Ga0268314_1032290	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	607	Open in IMG/M
3300028061\|Ga0268314_1044929	Not Available	539	Open in IMG/M
3300028064\|Ga0268340_1057269	Not Available	588	Open in IMG/M
3300028064\|Ga0268340_1086256	Not Available	503	Open in IMG/M
3300028262\|Ga0268310_1046141	Not Available	525	Open in IMG/M
3300028379\|Ga0268266_11496398	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	651	Open in IMG/M
3300028473\|Ga0268319_1014352	Not Available	594	Open in IMG/M
3300028473\|Ga0268319_1020734	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	530	Open in IMG/M
3300028526\|Ga0268339_1010146	Not Available	621	Open in IMG/M
3300028527\|Ga0268335_1018140	Not Available	510	Open in IMG/M
3300032465\|Ga0214493_1071931	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	823	Open in IMG/M
3300032469\|Ga0214491_1138322	Not Available	573	Open in IMG/M
3300032502\|Ga0214490_1112105	Not Available	622	Open in IMG/M
3300032551\|Ga0321339_1123132	Not Available	581	Open in IMG/M
3300032551\|Ga0321339_1155859	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	500	Open in IMG/M
3300032625\|Ga0214501_1178692	Not Available	676	Open in IMG/M
3300032689\|Ga0214497_1109810	Not Available	593	Open in IMG/M
3300032821\|Ga0314719_1036119	Not Available	610	Open in IMG/M
3300032821\|Ga0314719_1045922	Not Available	530	Open in IMG/M
3300032823\|Ga0314723_1046505	Not Available	832	Open in IMG/M
3300032890\|Ga0314747_1009878	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1380	Open in IMG/M
3300032916\|Ga0314734_1083557	Not Available	638	Open in IMG/M
3300032976\|Ga0314752_1078491	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	634	Open in IMG/M
3300032976\|Ga0314752_1115030	Not Available	516	Open in IMG/M
3300033523\|Ga0314768_1359428	Not Available	506	Open in IMG/M
3300033530\|Ga0314760_1111286	Not Available	675	Open in IMG/M
3300033530\|Ga0314760_1156768	Not Available	555	Open in IMG/M
3300033533\|Ga0314770_1232682	Not Available	577	Open in IMG/M
3300033534\|Ga0314757_1054607	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	955	Open in IMG/M
3300033538\|Ga0314755_1063749	Not Available	928	Open in IMG/M
3300033538\|Ga0314755_1158569	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	576	Open in IMG/M
3300033542\|Ga0314769_1285243	Not Available	554	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	95.58%
Environmental	Environmental	3.54%
Engineered	Engineered	0.89%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	95.58%
Terrestrial	Environmental → Terrestrial	3.54%
Bioreactor	Engineered → Bioreactor	0.89%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	80.09%
Unclassified	Host-Associated → Plants → Unclassified	9.29%
Soil	Environmental → Terrestrial → Soil	3.54%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.54%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.65%
Unclassified	Engineered → Bioreactor → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	80.09%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	9.29%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	2.65%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.65%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.65%
Loam	Environmental → Terrestrial → Soil → Loam	0.89%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.89%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	80.09%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	9.29%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	2.65%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.65%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.65%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.89%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.89%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	72.12%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	9.29%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	7.96%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.65%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.21%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.33%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.33%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.44%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.44%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.44%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.89%
Switchgrass Degrading	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading	0.89%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009971	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_174 metaG	Host-Associated	Open in IMG/M
3300009975	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG	Host-Associated	Open in IMG/M
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated	Open in IMG/M
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated	Open in IMG/M
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated	Open in IMG/M
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated	Open in IMG/M
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated	Open in IMG/M
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated	Open in IMG/M
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated	Open in IMG/M
3300010281	Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 1_4_20_6_A1 metaG	Engineered	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300012521	Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 10_41_5_180_A2 metaG	Engineered	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015273	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015278	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017408	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017446	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017691	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017694	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300020033	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12JUL2016_LD2 MG	Host-Associated	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028051	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028053	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028054	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028061	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028262	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028473	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028526	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028527	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032469	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032502	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032551	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032625	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032689	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032821	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032823	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032890	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032916	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032976	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033523	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033530	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033533	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033534	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033538	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033542	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068864_1008142662	3300005618	Switchgrass Rhizosphere	YMIKISGLEHLTASKQTEVLEGPLDVSEGRTRSNQKDVLST*
Ga0068858_1011947841	3300005842	Switchgrass Rhizosphere	MIKISGLEHLTASKQMEVLEGLLDVSEGRIRSNQKDVLTT*
Ga0068860_1020833411	3300005843	Switchgrass Rhizosphere	MIKISGFEHLTTLKKPQVLGRLVDVLEGRTRSNQKDVLTT*
Ga0105250_105220271	3300009092	Switchgrass Rhizosphere	LEHLTASKQPEVLGRLLEAFDGRLRSTQKDVQSTRST*
Ga0105247_105710561	3300009101	Switchgrass Rhizosphere	MIKISGLEHLTVSKQTEVLEGLLDVFEGRTRSNQKDVLNT*
Ga0105247_109570612	3300009101	Switchgrass Rhizosphere	MIKISGLEHLTASKLTEVLEGLLDVFEGRTRSNQKDVL
Ga0105127_106841	3300009971	Switchgrass Associated	MIKILGLEHLTASKKPEVLGGLLDVTEERPRSNLKDVLTT*
Ga0105129_1025941	3300009975	Switchgrass Associated	MIKISGLEHLTASEQPEVLGGLLDEFEGRPRRNQKDVLTT*
Ga0105135_1132961	3300009980	Switchgrass Associated	MIKILGLEHLTASEQPEVLGRLLDVFEGRHRSNQKDVLTA*
Ga0105135_1171931	3300009980	Switchgrass Associated	MIKILGLEHLTASEQPQLLGGLLDASEGRPRNNQKDVLTT*
Ga0105135_1211971	3300009980	Switchgrass Associated	LRAPYMIKISGLQHLTASEQPEVFGGLLDESEGRPGSNQKDVLTT*
Ga0105135_1222921	3300009980	Switchgrass Associated	LEHLTVLEQPEVLGGLLDVPEGRTRSNQKDVLTT*
Ga0105135_1268241	3300009980	Switchgrass Associated	VYMIKISGLEHLIASEQPEVLGRLLDVLEGRPRSNHKDVRTT*
Ga0105135_1278681	3300009980	Switchgrass Associated	MIKISGLEHLTASKQLDEFGRLLDVLEERPRSNQKDVLT
Ga0105135_1295731	3300009980	Switchgrass Associated	MIKISELEHLTASKQPEVLGGLLDVSEGRLRNNQEDVLTT*
Ga0105133_1073761	3300009981	Switchgrass Associated	MIKISGLEHLTASEQPQVLGGLLGASEGRPRSNRKGVLTTRS
Ga0105131_1216221	3300009989	Switchgrass Associated	MIKISGLEHLTASKQMEVLEGLLDVFEGRTRSNQKDVLTA*
Ga0105132_1419831	3300009990	Switchgrass Associated	ATPYGVRVLRAPYMIEISGLEHLTASKQPEVLGGLLGVSEGRPRSHQKDVLTT*
Ga0105120_10339001	3300009992	Switchgrass Associated	LVLRAPYMIKISGLEHLTASKQTGVLGGLLDEVEGRSRSSLKDILTN*
Ga0105126_10352711	3300009994	Switchgrass Associated	MIKISGLEHLTASKQPQVLGGLLDVSEGRFRNNEEDILIT*
Ga0105126_10374932	3300009994	Switchgrass Associated	MIKILGHEHLTASEQPEVRGRLLEVLEGRPGSNQMDVL
Ga0105126_10444291	3300009994	Switchgrass Associated	VPYMIKNSELEHLTASKQPEVLGELLGVSEGMPRSNQKDVLTT*
Ga0105126_10546371	3300009994	Switchgrass Associated	MEREYFEHLTASEQPEELGRLLNVLKGRPRSNQKDVLTT*
Ga0105139_10107822	3300009995	Switchgrass Associated	MIKISRLEHLTASGHPEVLGRLLDVPEGRPRSNQKDVLTT*
Ga0105139_10186772	3300009995	Switchgrass Associated	MIKISELEHLTASEQPEELGRLLDVSEGRPRSNQKDVLTT*
Ga0105139_10551812	3300009995	Switchgrass Associated	MIKISRLEHLTASKKTEVLEGLLDISEGRVRSNQKDVLTT
Ga0105139_10764521	3300009995	Switchgrass Associated	LRAPYIIKISGLEHLTTLKQLEVLEGLLDVSEGRTRSNHEEVLNT*
Ga0134090_10799591	3300010281	Switchgrass Degrading	MIKISGLEHLTASKQMEVLEGLLDISERRVRSKQDVLT
Ga0134125_125257402	3300010371	Terrestrial Soil	MIKISGHEHLTASEQPEALGRLLDVLEGRPRSNQEEILII*
Ga0134128_119670851	3300010373	Terrestrial Soil	KISGLEHLTASKQMEVLGGLLDIPGGRPRSSQKDILTT*
Ga0134126_122052542	3300010396	Terrestrial Soil	MIKISGLEHLTASEQPEVLEGLLDVFEGRPRSNQEDALTT*
Ga0134126_124902891	3300010396	Terrestrial Soil	LRAPYMIKISGFEHLTVSKQPQVLKELLNIPEGRPRSNQKDVQTT*
Ga0134126_129425721	3300010396	Terrestrial Soil	MIKILGLEHLTALEQPEVLGGLLDVSDGRPRSNEKDVLTT*
Ga0134122_128990401	3300010400	Terrestrial Soil	MIKMSGLEHLTASKQMEVFEGLLDVSEERTRRNQKDVLTI
Ga0134099_11073242	3300012521	Switchgrass Degrading	MIKISGLEHLTASEQPKVLGGLLDVSEGKPRSNQKDVLTT*
Ga0157380_117316152	3300014326	Switchgrass Rhizosphere	MIKISGLENLTASKQMGVLEGLLDVSEGRTRSNQKDVLTT*
Ga0157379_108735681	3300014968	Switchgrass Rhizosphere	MIKISGLEHLTASKQTEVLEGLLDVFEGRTRSNQKDVLT
Ga0157379_118692011	3300014968	Switchgrass Rhizosphere	PYGARILHAPYMIKISRLEHLTASKQPEVLGGLLDVFEGRPRRMF*
Ga0182183_10266491	3300015270	Switchgrass Phyllosphere	MIKILGLEHLAASKQTEVLEGLLDVSEGRTRSNQKDVLTT
Ga0182183_10506711	3300015270	Switchgrass Phyllosphere	LRAPYKIKISGLEHLTASKQPGELGRLLDVLKGRPRGNQKDVLTI*
Ga0182183_10616081	3300015270	Switchgrass Phyllosphere	MIKISGLEHLIVSKQLEELGRLLDVLEGRPRSNQKDVLTT*
Ga0182183_10853111	3300015270	Switchgrass Phyllosphere	MIKISGLEHLTASKQMEVLEALLDVPEGRTRSNRKDVLTTRNTQRR
Ga0182102_10159902	3300015273	Switchgrass Phyllosphere	ATPYRARVLRAPYMLKISGYEHLTASKQPEVPGGLLDVFEGRHRNNQGQE*
Ga0182099_10193622	3300015278	Switchgrass Phyllosphere	MIKISGLEHLTASRQPEVLGGLLDVSEGRTRSNQEEVLIT*
Ga0182099_10516551	3300015278	Switchgrass Phyllosphere	MIKISGLEHLTASEQPEVLGGLLDESEGRPRINQKIF*
Ga0182100_10682892	3300015280	Switchgrass Phyllosphere	MIKILGLEHLTALEQPEVLERLLDVLHGRPRSNQRDVLTT*
Ga0182101_10463351	3300015284	Switchgrass Phyllosphere	MIKNSGLEHLIASEQPEELGRLLDVLEGRPRNNQKDVLIT*
Ga0182105_10067892	3300015290	Switchgrass Phyllosphere	MIKISELEHLIASKQPEVLEELLDVSEGRPRSNQEDVLTT*
Ga0182105_10229141	3300015290	Switchgrass Phyllosphere	MIKISGLEHLTASKQTEVLEGLLDVYEGRVRSNRK
Ga0182105_10750081	3300015290	Switchgrass Phyllosphere	ARVLRALYMIKISGLEHLTASKQSEVLEELLDVSKGRTRSNKKDVLTT*
Ga0182105_10940421	3300015290	Switchgrass Phyllosphere	MIKISGLEHLTASKQTEELEGLLDVSEGRTKSNQKDVLTT*
Ga0182103_10411563	3300015293	Switchgrass Phyllosphere	MINILGLEHLTASKQTEVLEGLLDVSEGRVRSNQKDVL
Ga0182103_10729441	3300015293	Switchgrass Phyllosphere	MIKISRLEHLTASKQMEVLEELLDVSEGRTRRMF*
Ga0182103_10844212	3300015293	Switchgrass Phyllosphere	IKISGLEHLTASEQPEVHGGLLDVSEGRLRSNRKGVLTT*
Ga0182103_10919941	3300015293	Switchgrass Phyllosphere	YGARVLRAPYINKNSGLEHLTASEQLEELGRLLNVLEGRPRSNQKDVLTI*
Ga0182104_10452511	3300015297	Switchgrass Phyllosphere	MIKISGHEHLTASEQPEELGKLLAVLE*RSRGNHKDVLTT
Ga0182104_10778751	3300015297	Switchgrass Phyllosphere	GARVLHAPYMIKISRLEHLTTSEQPEVLGGLLDISEERPRSNQKDVLTT*
Ga0182184_10181651	3300015301	Switchgrass Phyllosphere	MIKISGLEHLTASKQPQVLEELLDVPVGRPRSDQKDVQVT*
Ga0182184_10623811	3300015301	Switchgrass Phyllosphere	GARVLRTPYMIKISGLEHLTASEQPEVLGGLLDISEGRPRSNQKDVLTT*
Ga0182184_10694891	3300015301	Switchgrass Phyllosphere	MIKISGLEHLTASKQTEVLEGLLNVSEGRVRSNQKDILTTRRT
Ga0182180_10370502	3300015306	Switchgrass Phyllosphere	GLEHLTASKQPEVLGGLLDVSEGRPRGNQKHVLTT*
Ga0182098_10959941	3300015309	Switchgrass Phyllosphere	PYGARVLCAPYMIKISRLEHLTVSEKLEVLGRLLDVSKGRPRSNQKDVLTT*
Ga0182098_10969171	3300015309	Switchgrass Phyllosphere	IKISGLEHLTASKQPEVLGGLLDVSEGRPRGNQKHVLTT*
Ga0182162_10213181	3300015310	Switchgrass Phyllosphere	YGTRVLHAPYMIKISGLEHLTASEQLEVLGGILDVSEGRIRSNQEDVLTT*
Ga0182162_11208391	3300015310	Switchgrass Phyllosphere	LRAPYMIKISGLEHLTASKQTEVLEGLLNVSKGRTRSNQEEVLIT*
Ga0182182_10160441	3300015311	Switchgrass Phyllosphere	MIKISGLEHLTASEQPEVLGGLLDVSEGRPKSDLEDILT
Ga0182182_10590341	3300015311	Switchgrass Phyllosphere	IKISVLEHLTASKQLQVLGGLLDVFEGRLRSSQKKVLTT*
Ga0182182_10776401	3300015311	Switchgrass Phyllosphere	ATPYGARVLRAPYMIKISGLEHLTASKQPEVLGRLLDVSEERPRSNQKYFLTT*
Ga0182182_10803601	3300015311	Switchgrass Phyllosphere	GARVLRAPYMIKILGLEHLTASKQTEVLEGLLDVTEGRTRSNQKDVLTT*
Ga0182168_10177421	3300015312	Switchgrass Phyllosphere	MIKISGLEHLTASKQTEVLEGLLDVYEGRTRRNQEEVLII*
Ga0182168_11113991	3300015312	Switchgrass Phyllosphere	MIKISGLEHLTASKQPEVLGELLDVSEGRLRNNQEDVLTT*
Ga0182164_10426632	3300015313	Switchgrass Phyllosphere	MIKISGLEHLTALKQPEVLGGLLDVSEGRPRSNHKDVLTT*
Ga0182164_10440522	3300015313	Switchgrass Phyllosphere	MIKISELEHLTASKQPEELGRLLDVLEGRPRSNQKDVRTT*
Ga0182164_10498142	3300015313	Switchgrass Phyllosphere	MIKISGLEHLTASEQLEVLGGLLDVPEGRPRSNQKDV*
Ga0182164_10499781	3300015313	Switchgrass Phyllosphere	MIKISGLEHLTVSEHPEVLGRLLDVPEGRPRNNQKDVLIT*
Ga0182120_11335741	3300015315	Switchgrass Phyllosphere	MIKILGLEHLTASEQPEVLEGLLDVSKGRPRSNQKDVLTV*
Ga0182121_10590552	3300015316	Switchgrass Phyllosphere	MIKILGLEHLIASKQMEVLERLLDIPGGRPRSSQKDILTT*
Ga0182136_10704771	3300015317	Switchgrass Phyllosphere	MIKILGFEHLTASKQPEVLEGLLDVSKGRLRNNREDVL
Ga0182136_10768722	3300015317	Switchgrass Phyllosphere	MIKILGLEHLTALDQPEVLGGLLDVSEGRLRNNQEDVLTT*
Ga0182136_10789412	3300015317	Switchgrass Phyllosphere	MIKNSGLEHLIASEQPEELGRLLDVLEGRPRNNQK
Ga0182136_11373771	3300015317	Switchgrass Phyllosphere	LRAPYMTKISGLEHLTALEQPEVLGGLLDVPEENNQKDDPTT*
Ga0182136_11377051	3300015317	Switchgrass Phyllosphere	MIKISGLEHLTASEQPEVLGGLLDVSEGSPRSNQKDVLTI
Ga0182181_10607632	3300015318	Switchgrass Phyllosphere	MIKISGLEHLTASKQMGVLGGLLDEVEGRSKSNQKDVLTI*
Ga0182181_10702481	3300015318	Switchgrass Phyllosphere	MIKISGLEHLTASEQPEIYGGLLDVSEGRLRRCSDCMKY
Ga0182130_11266121	3300015319	Switchgrass Phyllosphere	GLEHLTASKQSEVLGELLDVPEGRTRSNLTDVPTT*
Ga0182165_10321682	3300015320	Switchgrass Phyllosphere	MIKISGLEHLTASKQPEVLGGLLDVSEGRPRSNQKDVQIT*
Ga0182148_10307572	3300015325	Switchgrass Phyllosphere	MLKISEHDHLTASKQPEVPGGLLDVSEERLRNNQEEVLIT*
Ga0182148_11253372	3300015325	Switchgrass Phyllosphere	MIKISGLEHLTASEQPEVLAGLLDKSEGRPRINQKIF*
Ga0182114_10484822	3300015327	Switchgrass Phyllosphere	MIKISGLEHLTGSKQSEVLGRLLDVSEERPRSNQKDVL
Ga0182114_10673601	3300015327	Switchgrass Phyllosphere	MIKISGLEHLTASEQPEVLGRLLDVSERRPRSNQK
Ga0182114_10687361	3300015327	Switchgrass Phyllosphere	MIKISGLEHLTVSKQMEVLEGLLDISEGRTRSNQEEVLIT*
Ga0182114_11148311	3300015327	Switchgrass Phyllosphere	QVLRAPYMIKISGLEHLIASKQPEVLGGLLDVFEGRPRSNQKDVLTT*
Ga0182114_11357022	3300015327	Switchgrass Phyllosphere	MIKISGLEHLTASELPEVIGRLLDVSEGRPRSNQRDVLTI*
Ga0182153_10848971	3300015328	Switchgrass Phyllosphere	KISRLEHLTASEQPKVLGGLLDVSEGRPRSNQKDVLTT*
Ga0182153_11268481	3300015328	Switchgrass Phyllosphere	MIKISGIEHLTASMQMEVLEGLIDVSEGRTRSNQKDVL
Ga0182135_10753361	3300015329	Switchgrass Phyllosphere	MIKISGLEHLAASEQPKVLGGLLDVFEGKPRSNQKDV
Ga0182135_11062762	3300015329	Switchgrass Phyllosphere	MFKISGLEHLTASKQPEVLGGLLDVSKKKTKSNQKDVLIT*
Ga0182135_11513981	3300015329	Switchgrass Phyllosphere	MIKILGLEHLTASKQPEVLGGLLDVSEGRFRNNQEDVLTT*
Ga0182135_11542642	3300015329	Switchgrass Phyllosphere	MIKILGLEHLTASKQPEVLGRLLDVSEGKPRNNQKDVLTT*
Ga0182152_11462171	3300015330	Switchgrass Phyllosphere	MIKISGHEHLIASEQPEELGGLLDILEGRLRSNQKDVLTT*
Ga0182131_10614021	3300015331	Switchgrass Phyllosphere	MIRISGLEHLTALEQPEVLEGLLDVSEGRPRSNQKDVLTT
Ga0182131_10882911	3300015331	Switchgrass Phyllosphere	MIKISGLEHLTASEQLEELGRLLDVLEGRPRSNQKDVLTT*
Ga0182131_11158801	3300015331	Switchgrass Phyllosphere	CDSTYGSGATSYGARVLRALYMIRISGLEHLTASKQLEVLEGLLDVSEGRSRSNPE*
Ga0182131_11431682	3300015331	Switchgrass Phyllosphere	MIKISGLEHLTASKQPEVLRGLLDVSKKKTKSNQKDVLIT*
Ga0182131_11478092	3300015331	Switchgrass Phyllosphere	MIKISGLEHLTASKQMEVLEGLLDISEERTRSNQKDVLTT*
Ga0182117_10144722	3300015332	Switchgrass Phyllosphere	MIKISELEHLIVSKQPEVLEGLLDVSKGRPRSSQKDVLTT
Ga0182147_10370701	3300015333	Switchgrass Phyllosphere	MIKISALEHLIASKQPKILGGLLDISEGRPKSNRK
Ga0182147_10767271	3300015333	Switchgrass Phyllosphere	MIKISGLEHHTASEQPKVLGGLLYMSEGRRRSNQK
Ga0182147_11068491	3300015333	Switchgrass Phyllosphere	PYMIKISELEHLTASEQLEEVGRLLDVLKGRPRSNQKDVLTT*
Ga0182147_11102931	3300015333	Switchgrass Phyllosphere	KISGLEHLTASEQPEVLGILLDVFRGRPRSNQKY*
Ga0182147_11385971	3300015333	Switchgrass Phyllosphere	MIKISGLEHLTALKQMEVLGGLLDEAGGRTRSNQKDILTT*
Ga0182147_11503091	3300015333	Switchgrass Phyllosphere	ILGHEHLTASVQPGVLGRLLEVFEGRLRSNQKDVLTT*
Ga0182132_10455531	3300015334	Switchgrass Phyllosphere	MIKISGLEHLTTSEQMEVLGGQLDVSEGRIRCNQNN
Ga0182132_11192981	3300015334	Switchgrass Phyllosphere	TPYGARVLRAPYMIKISGLEHLTASEQPGVLGGLLDVFEGRPRSNQKDVLTT*
Ga0182132_11445091	3300015334	Switchgrass Phyllosphere	MIKISGLEHLTASKQTEVLEGLLDVSEGRTRSNQKDV
Ga0182116_10331032	3300015335	Switchgrass Phyllosphere	MIKISGLEHLTASEQPEVLGGLLDVSEGRPKSDPE
Ga0182116_11339441	3300015335	Switchgrass Phyllosphere	MIKILGLEHLTASKQPEVLGGLLDVFEGKPGSNQKDVLTT*
Ga0182150_10210443	3300015336	Switchgrass Phyllosphere	APYMIKISWLEHLTASKQTEVLEGLLDIFEGRTRSNQKDVLTT*
Ga0182150_11189302	3300015336	Switchgrass Phyllosphere	MIKISGLEHLTASKQMEVLEGLLDVFEGRTRSNQKDVLTT*
Ga0182151_10351642	3300015337	Switchgrass Phyllosphere	MIKISGLEHLTASKQMEVLGGLLDIPGGRPRSSQKDILTT*
Ga0182151_10889371	3300015337	Switchgrass Phyllosphere	GATPYGARVLPAPYIIKIPGLEHLTTSEQPEVLGGLLDVSEGRPRSNQKDVQIT*
Ga0182151_11499572	3300015337	Switchgrass Phyllosphere	MIKISGLEHLTALKKPQVLEELLDVPEGRPRSKQKDVQTT*
Ga0182151_11590671	3300015337	Switchgrass Phyllosphere	GATPYGARVLRAPYMIKISGLEHLTASKQPEVLGGLLDMSEGRPISN*
Ga0182137_11715531	3300015338	Switchgrass Phyllosphere	MIKILGLEHLTALKQTEVLEGLLDVTEGITNSNQKEILDN*
Ga0182149_10999131	3300015339	Switchgrass Phyllosphere	IIKISGLEHLTALEQLEVLGRLLDVFEGRPKSSLKDVLTT*
Ga0182149_11755831	3300015339	Switchgrass Phyllosphere	MIKISGLEHLIASKQPKVLGRLLDVPKGKLGSDQKDVLTT*
Ga0182133_11281781	3300015340	Switchgrass Phyllosphere	MIKNLGLVHLTASKQPEELVRLLDVLEERPRRNQKDVLTT*
Ga0182133_11411341	3300015340	Switchgrass Phyllosphere	YMIKILGYEHLKASEQPEVLGGLLDVPKRKLRSNQKDILTT*
Ga0182115_11470521	3300015348	Switchgrass Phyllosphere	ARVLRAPYMIKILGLEYLTASEQTEVLGRLLDVLKGRPRSDQKHILTT*
Ga0182115_11614612	3300015348	Switchgrass Phyllosphere	MIKISGLEHLTASEQPEELRGLLDVSEGRQEATRRMF*
Ga0182115_12033891	3300015348	Switchgrass Phyllosphere	MIKISGLEHLTASEQLEVLGGLLDVSEGRPKSDLEDILTT*
Ga0182115_12585991	3300015348	Switchgrass Phyllosphere	YMIKISGLEHLTASEQLEVLGGLLDVSEGRPRSNQKDVLTT*
Ga0182115_12965841	3300015348	Switchgrass Phyllosphere	RVLHASYMIKISGLEHLTASKQLKEHGRLLDVLEGRPRSSQKDVLTT*
Ga0182185_11003762	3300015349	Switchgrass Phyllosphere	MIRISGIEHLTASKQLEVLEGPLDISEGRSRRKQKDI
Ga0182185_11613991	3300015349	Switchgrass Phyllosphere	MIKISGLEHLTTLKQLEVLGRLLDVLEGRTRSNQKDVRTT*
Ga0182185_11972872	3300015349	Switchgrass Phyllosphere	MIRISGLEHLTASKKPEVLEGLLDVSEGRPRINQKDVLTT*
Ga0182185_12321411	3300015349	Switchgrass Phyllosphere	LVLRTPYMIKISGLEHLTASKQMEVLEGLLDVSEGRTRSNQVDVLST*
Ga0182185_12377001	3300015349	Switchgrass Phyllosphere	MIKISGLEHLTTSKQMEVLGGLLDVSEGRIRCNQNNV
Ga0182185_12451401	3300015349	Switchgrass Phyllosphere	MIKISELEHLTASKQPEVLGGLLDELEGRPRSNQ*
Ga0182185_12515852	3300015349	Switchgrass Phyllosphere	MIKILGLEHLTASKQTEVLEGLLDVFEGRIRSNQKDVLTT*
Ga0182163_10746331	3300015350	Switchgrass Phyllosphere	MIKNLGLVHLTASKQPEELGRLLDVLEERPRRNQKDVLTT*
Ga0182169_11715241	3300015352	Switchgrass Phyllosphere	MIKISELEYLTASKQPEVLGGLLDELEGRPRSNQK
Ga0182169_12394591	3300015352	Switchgrass Phyllosphere	TPYGARVLRAPYMIKISGLEHLTASEQTEVLEGLLDVSEGRTRSNQKDVLIT*
Ga0182169_12465521	3300015352	Switchgrass Phyllosphere	LRAPYMIKISGLEHLIASEQPGVLGRLLDVSEGRPRSNQKNIQTT*
Ga0182169_12680301	3300015352	Switchgrass Phyllosphere	APYMIKISGLEHLTASKQPEVIGGLLDVSEERTRSNQKDILNT*
Ga0182179_11870432	3300015353	Switchgrass Phyllosphere	MIKISELEHLTTSMLMEVLEELLDVSEGRTRSNQEEVLII*
Ga0182179_12058602	3300015353	Switchgrass Phyllosphere	VLCAPYMIKISGLEHLTASEQSEVLGGLLDISEGRPRSNQKDVLTT*
Ga0182167_10515083	3300015354	Switchgrass Phyllosphere	MIKISGLEHLTASELPEVIGRLLDVSEGRPRSNQKDVLTI*
Ga0182167_11820732	3300015354	Switchgrass Phyllosphere	MIEISGLEHLIASEQPQVLGRLFYVLEGRPRSNQKDVQTTGSTRR
Ga0182167_11882132	3300015354	Switchgrass Phyllosphere	APYMIKISGLEHLTASKKTEVLEGLLDIFEGRTRRNQKDVLTT*
Ga0182167_12082672	3300015354	Switchgrass Phyllosphere	VLRAPYMNKISGLEHLTTSEQTEELGGLIDVSKGRTRSNQKDVLTT*
Ga0182167_12613541	3300015354	Switchgrass Phyllosphere	MIKISGLEHLTVSEQLGVLGRLLDVFEGRPRSNQKNIQTT*
Ga0182167_12918291	3300015354	Switchgrass Phyllosphere	IKISGLEHLTASKQPEVLGGLLDVSKRKTRSNQKDVLIT*
Ga0182167_13569391	3300015354	Switchgrass Phyllosphere	MIKNLGLVHLTASKQPEELGRLLDVLKERPRRNQKDVLTT*
Ga0182167_13584451	3300015354	Switchgrass Phyllosphere	MIKISGLEHLTALKQPEVFGGLLDVSEGRTRSNQKDVLIT*
Ga0182197_11065071	3300017408	Switchgrass Phyllosphere	MIKNSGLEHLTASEQPEVLGILLDVSKRRPRSNQKDVLTA
Ga0182197_11099661	3300017408	Switchgrass Phyllosphere	IKISGLEHLTASEQPEVLGGLLDVPEGRTRSILKKVLTT
Ga0182197_11250481	3300017408	Switchgrass Phyllosphere	VRVLRAPYMIKILGLEHLTASEQPQVLGGLLDASEGRLRSNQKDVLIT
Ga0182197_11348671	3300017408	Switchgrass Phyllosphere	MNKISGLEHLTASRQPEVLGRLLDVLEGKPRSNQKDVLTT
Ga0182197_11450001	3300017408	Switchgrass Phyllosphere	GLEHLTASKKPEVPGGLLDVSEGRPGSDQKDVLTT
Ga0182199_10987261	3300017412	Switchgrass Phyllosphere	MIKILGHEHLIASEQLEVLGRLLKVFDRRPRSNQKDVLHTLST
Ga0182199_11399491	3300017412	Switchgrass Phyllosphere	MIKNLGLVHLTVSKQPEELGRLLDVLEERPRRNQKDVLTT
Ga0182199_11610621	3300017412	Switchgrass Phyllosphere	IKISGLEHLTASKQTEVLEGLLDVSEGRTRSNRKDVLTT
Ga0182195_10803482	3300017414	Switchgrass Phyllosphere	MIKISGLEHLTTSKQMEVLEGLLDVSEGRTRSNQVDVLTA
Ga0182195_11718681	3300017414	Switchgrass Phyllosphere	VLRAPYMIKISGLEHLTASEQLQVLGRLLDVLEGRLRSNEKDVHTA
Ga0182213_12441821	3300017421	Switchgrass Phyllosphere	MIKISGLEHLTALKQPEVLGGLLDVSEGRLISNQKDVLTT
Ga0182201_10578672	3300017422	Switchgrass Phyllosphere	MIKISGLEHLTASEQPEVLGRLLDVLEGRPRSNQKD
Ga0182201_10681371	3300017422	Switchgrass Phyllosphere	MIKISVLEHLTASGQPEELGRLLDVLEGRPRNNQKDVLTT
Ga0182201_11100731	3300017422	Switchgrass Phyllosphere	MNKISGLEHLTASEQPEVLGRLLEVLEGRPGSNQMDVLTT
Ga0182196_10439572	3300017432	Switchgrass Phyllosphere	MIKSSGLEHLTALKQTEVLGGLLDEVAGRSRSNQKDVLTT
Ga0182194_10667041	3300017435	Switchgrass Phyllosphere	YGARVLRAPYMIQISGLEHLTASKQPEVLGGLLDVLEGRTRSNLKDVLTT
Ga0182198_10211871	3300017445	Switchgrass Phyllosphere	MIKNSGLEHLIASEQPEELGRLLDVLEGRHRNNQKDVLTT
Ga0182217_10651251	3300017446	Switchgrass Phyllosphere	MIKISGLEHLTASEQLEELEGLLDVSEGRSRSNQKDALTT
Ga0182217_11071171	3300017446	Switchgrass Phyllosphere	PYGARVLRAPYMIKISELEHLIVSKQPEVLEGLLDISKGRPRSSQKDVLTT
Ga0182212_11625491	3300017691	Switchgrass Phyllosphere	MIKISELEHLTAAEQLEEVGRLLDVLKGRPRSNQKDVLTTYLKKLH
Ga0182216_11294431	3300017693	Switchgrass Phyllosphere	MIKISGLEHLIASKQLEVLGRLLDERKPGSNQKDLLTT
Ga0182216_11381482	3300017693	Switchgrass Phyllosphere	MIKILGHEYLIASEQPEVLGRLLDVPEGRPRSNQDDVLAT
Ga0182211_11212631	3300017694	Switchgrass Phyllosphere	MIKISGLEHLTASKQLEVLGELLDVPEGRTRSNLK
Ga0182146_1047362	3300020033	Switchgrass Phyllosphere	MIKISGLEHLTASKQTEVLEGLLDVFEGRTRSNQKDVL
Ga0207697_103604751	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MIKISGLEHLTASKQTDVLEGLLDVFEGRTRSNQKD
Ga0207653_100596552	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	MIKISGLEHLTASKQMEVLEGLLDIFEGRTRSNQKDVLTT
Ga0207662_104338691	3300025918	Switchgrass Rhizosphere	FRTPYMIKILGLEHLTTSEQPEVLGGLLDVFEGRPRINQKDVLTT
Ga0207650_104098342	3300025925	Switchgrass Rhizosphere	MIKISGLEHLTASKQMEVLEGLLDVSEGKTRSNQEEVLIT
Ga0207641_118698541	3300026088	Switchgrass Rhizosphere	MIKNLGLVHLTASKQPEELGRLLDVLEERPRRNQKDVLTT
Ga0207676_122660052	3300026095	Switchgrass Rhizosphere	MIKISGLEHLTASKQMEVLEGLLDVSEGMTRSNQKDVLTA
Ga0268322_10395961	3300028049	Phyllosphere	GATPYGARVLRAPYMINISGLEHLTASKQTKVLGELLDVPEGRSRSNQKDVLTT
Ga0268328_10531191	3300028050	Phyllosphere	MIKISGLDYLIASKQMEVLGGLLDISKGMTRSNQKDVLT
Ga0268344_10138192	3300028051	Phyllosphere	MIKISGLEYLTASEQPEVNGRLFDVSEERPRSNQKEVLAT
Ga0268346_10140162	3300028053	Phyllosphere	MIKISRLEHLTASKQTEVLEELLDVSEGRTRSNQKDV
Ga0268346_10212952	3300028053	Phyllosphere	MIKISGLEHLTASKQPEVLEGLLDVSKGRLRNNQEDVLTT
Ga0268306_10306441	3300028054	Phyllosphere	VLRAPYMIKISGLEHLTASEQLQVLGGFLGASEGRPRSNQKDVLTT
Ga0268332_10171362	3300028058	Phyllosphere	MIKISGLEHLTVSKQPEVLGGLLDVSEGRLRSNQKDILTT
Ga0268332_10350191	3300028058	Phyllosphere	PTPYGARVLRAPYMIEISGLEHLTVSKQTEVLEGLLDVSEGRTRSNQEEVLIT
Ga0268332_10388931	3300028058	Phyllosphere	MIKILGHEHLTASEQPEVLGRLLEVLEGRPGSNQMDVLTT
Ga0268314_10322901	3300028061	Phyllosphere	MIKISGLEHLTASKQMEVLEGLLDVSEGRTRSNQKDVPTT
Ga0268314_10449291	3300028061	Phyllosphere	TPYGARVLRAPYTIKISGLEHLTASEQLEVLGGLLDVSEGRPRSNQKDVLTT
Ga0268340_10572691	3300028064	Phyllosphere	MIKNLGLVHLTASKQPEELGRLLDVLEERPRKNQKDVLTT
Ga0268340_10862561	3300028064	Phyllosphere	MIKISGLEHLTSLKQPEVLEGLLDVTKGRPRSNQKDVLT
Ga0268310_10461412	3300028262	Phyllosphere	MIKISGLEHLTASKQMEVLEGLLDVSEGRTRSNQEEVLII
Ga0268266_114963981	3300028379	Switchgrass Rhizosphere	MIKISGLEHLTASKQTEVLEGLLDVSEGRTRNNQE
Ga0268319_10143521	3300028473	Phyllosphere	SGATPYGARVLCAPYMIKILGLEHLTASEQPQVLGGLLDISKGKPRSNQKDVLTT
Ga0268319_10207341	3300028473	Phyllosphere	ISGLEHLTASEQPRVLGGLLGASERRPRSNQKDVLTI
Ga0268339_10101461	3300028526	Phyllosphere	GSGATPYGVRVLRTPYMIKISGLEHLTTSKQMGVLGGLLDEVEGRSKSNQKDVLTI
Ga0268335_10181401	3300028527	Phyllosphere	RTYMIKISGHEQMKVLEGLLDVSEGRTRSNQKDVLTT
Ga0214493_10719312	3300032465	Switchgrass Phyllosphere	MIKISGLEHLTASEQPEVLGRLLDVPEGRLGSNQKDVL
Ga0214491_11383221	3300032469	Switchgrass Phyllosphere	MIKISGLEHLTASKQTEVFEGLLDVSEERTRSNQKDVLTI
Ga0214490_11121051	3300032502	Switchgrass Phyllosphere	LRAPYMIKISGLEHLTASKQLEVLGGLLDVSEGRQRSNQKDILTS
Ga0321339_11231321	3300032551	Switchgrass Phyllosphere	MLKISGHEHLTASKQPEVPGGLLDVSEGRLRNNQEDILTTWSTQRHP
Ga0321339_11558591	3300032551	Switchgrass Phyllosphere	FSYEGTLHTPYGARVLRAPYMIKISGLGTSLPRSNQKYLERLLDVSEGRLRNNQKDVLTT
Ga0214501_11786922	3300032625	Switchgrass Phyllosphere	MIKISRLEHLTASKQMEVLEGLLDVSEGRTKSNQEEVLII
Ga0214497_11098101	3300032689	Switchgrass Phyllosphere	SGATPYGARILRAYMMKISGLEHLTASKQTKVLGRLLDVSEGRPRSNQKDVLTT
Ga0314719_10361191	3300032821	Switchgrass Phyllosphere	MIKISGLEHLIVSKQLEELGRLLDVLEGRPRSNQKDVLTT
Ga0314719_10459221	3300032821	Switchgrass Phyllosphere	MIRILGLEHLTASEQPEVLEGLLDVSEGRPRSNQKDVLTT
Ga0314723_10465052	3300032823	Switchgrass Phyllosphere	MIKILGLEHLRASEQPQVLGGLLDASEGRLRSNQKD
Ga0314747_10098781	3300032890	Switchgrass Phyllosphere	TPYGARVLRAPYMIKISGLEHLTASKQMEVLEGLLDISEGRVRSK
Ga0314734_10835571	3300032916	Switchgrass Phyllosphere	KISGLEHLTALKQPEVLGGLLDVSGGRPRSNQKHVLTT
Ga0314752_10784911	3300032976	Switchgrass Phyllosphere	ATPYGARVLRAPYMIKISGLEHLTASKQMEVLEGLLDISEGRVRSK
Ga0314752_11150301	3300032976	Switchgrass Phyllosphere	VPYMIKILGHEHLTVSEQTEVLEGLLDVPEARTRSNQKDILTT
Ga0314768_13594281	3300033523	Switchgrass Phyllosphere	LRAPYMIKISGLEHLTASEQPEVLEGLLDVSEGRPRSNQKDVLTT
Ga0314760_11112861	3300033530	Switchgrass Phyllosphere	MIKISGLEHLTALKQMEVLEGLLGASEGRSRSNQKDVLTT
Ga0314760_11567681	3300033530	Switchgrass Phyllosphere	KISRLEHLTASKQMKVLEGLLDISEGRTRSNQKDVLTA
Ga0314770_12326821	3300033533	Switchgrass Phyllosphere	IKISLLEHLTASEQPEVLEGLLDISEGRPRSNQKDVLTT
Ga0314757_10546071	3300033534	Switchgrass Phyllosphere	MIKISGLEHLTGSKQSEVLGRLLDVSEGRPRSNQKD
Ga0314755_10637491	3300033538	Switchgrass Phyllosphere	MFKISGFEHLTASKQQEVLGRLLDVLDRRTRSNQKDVLII
Ga0314755_11585691	3300033538	Switchgrass Phyllosphere	GARLLRAPYRIKISGLVHLIVSEQPEILGGLHDVSKGRPRSDQKDVLTT
Ga0314769_12852431	3300033542	Switchgrass Phyllosphere	MIKISGLEHLTASKKPEVPGGLLDVSEGRPGSDQKDVLTT

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F019942

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences