NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F019482

Metagenome / Metatranscriptome Family F019482

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F019482
Family Type Metagenome / Metatranscriptome
Number of Sequences 229
Average Sequence Length 134 residues
Representative Sequence MISFLSHSSDIDDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSIIESLEDSGGEGFLDVLDGSGLGNGGITISSGLGSLSRDEGGAELGKEFILTHEVVLVGRDGGDKSGGGEFHF
Number of Associated Samples 175
Number of Associated Scaffolds 229

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 31.70 %
% of genes near scaffold ends (potentially truncated) 70.74 %
% of genes from short scaffolds (< 2000 bps) 97.38 %
Associated GOLD sequencing projects 170
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.380 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(38.865 % of family members)
Environment Ontology (ENVO) Unclassified
(68.122 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(84.279 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.30%    β-sheet: 0.00%    Coil/Unstructured: 67.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 229 Family Scaffolds
PF00504Chloroa_b-bind 0.44
PF07002Copine 0.44
PF00379Chitin_bind_4 0.44



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.82 %
UnclassifiedrootN/A2.18 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003555|Ga0008453J51685_102445All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Erwiniaceae → Erwinia → Erwinia mallotivora522Open in IMG/M
3300003677|Ga0008458J53046_102310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300003683|Ga0008459J53047_1002898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300006355|Ga0075501_1040894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum644Open in IMG/M
3300006366|Ga0075499_1233293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300006373|Ga0075483_1288143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300006393|Ga0075517_1579668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300006641|Ga0075471_10179246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1111Open in IMG/M
3300006875|Ga0075473_10092973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1191Open in IMG/M
3300006917|Ga0075472_10630863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300007552|Ga0102818_1059555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum753Open in IMG/M
3300007558|Ga0102822_1139011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300007715|Ga0102827_1137021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300007715|Ga0102827_1166870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300007953|Ga0105738_1111145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300008834|Ga0103882_10099104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300008919|Ga0103484_1014120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum506Open in IMG/M
3300008929|Ga0103732_1045772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300008929|Ga0103732_1063308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300008930|Ga0103733_1046012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum692Open in IMG/M
3300008930|Ga0103733_1061544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300008930|Ga0103733_1064918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300008931|Ga0103734_1002001All Organisms → cellular organisms → Eukaryota2150Open in IMG/M
3300008931|Ga0103734_1035892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum746Open in IMG/M
3300008931|Ga0103734_1045138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum669Open in IMG/M
3300008931|Ga0103734_1078337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300008932|Ga0103735_1010866All Organisms → cellular organisms → Eukaryota → Sar1149Open in IMG/M
3300008932|Ga0103735_1037685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum699Open in IMG/M
3300008932|Ga0103735_1049473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum621Open in IMG/M
3300008933|Ga0103736_1016349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum919Open in IMG/M
3300008934|Ga0103737_1034484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum648Open in IMG/M
3300008935|Ga0103738_1033195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum712Open in IMG/M
3300008936|Ga0103739_1024142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum805Open in IMG/M
3300008936|Ga0103739_1065988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300008958|Ga0104259_1037579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300008998|Ga0103502_10306119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum586Open in IMG/M
3300009003|Ga0102813_1144272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum744Open in IMG/M
3300009022|Ga0103706_10094267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum683Open in IMG/M
3300009025|Ga0103707_10197780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300009026|Ga0102829_1303072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300009055|Ga0102905_1141035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300009276|Ga0103879_10024897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum617Open in IMG/M
3300009402|Ga0103742_1004921All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1379Open in IMG/M
3300009402|Ga0103742_1057646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum506Open in IMG/M
3300009422|Ga0114998_10598723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300009432|Ga0115005_10766029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum776Open in IMG/M
3300009433|Ga0115545_1141482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum845Open in IMG/M
3300009433|Ga0115545_1314220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300009438|Ga0115559_1299864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum564Open in IMG/M
3300009442|Ga0115563_1172258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum851Open in IMG/M
3300009476|Ga0115555_1463946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum501Open in IMG/M
3300009497|Ga0115569_10228837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum845Open in IMG/M
3300009498|Ga0115568_10401446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300009544|Ga0115006_10309667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1386Open in IMG/M
3300009592|Ga0115101_1138031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum617Open in IMG/M
3300009599|Ga0115103_1081957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum576Open in IMG/M
3300009606|Ga0115102_10628397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300012413|Ga0138258_1371760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300012413|Ga0138258_1399968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300012504|Ga0129347_1217926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300012953|Ga0163179_10808623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum804Open in IMG/M
3300012953|Ga0163179_11757937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300012966|Ga0129341_1320678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300013006|Ga0164294_10509023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum820Open in IMG/M
3300013014|Ga0164295_10593531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum852Open in IMG/M
3300016771|Ga0182082_1328001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300016787|Ga0182080_1588001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300017771|Ga0181425_1087945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum998Open in IMG/M
3300017986|Ga0181569_10513015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum809Open in IMG/M
3300018537|Ga0193019_104693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum589Open in IMG/M
3300018575|Ga0193474_1012068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300018596|Ga0193060_1016011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum621Open in IMG/M
3300018596|Ga0193060_1016569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300018596|Ga0193060_1017021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300018596|Ga0193060_1017058All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300018603|Ga0192881_1022466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300018613|Ga0188872_1012229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300018614|Ga0188846_1032327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum617Open in IMG/M
3300018617|Ga0193133_1018271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300018655|Ga0192846_1025353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum627Open in IMG/M
3300018666|Ga0193159_1041168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300018684|Ga0192983_1039912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300018701|Ga0193405_1045163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300018716|Ga0193324_1048852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300018730|Ga0192967_1063496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300018742|Ga0193138_1057875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300018742|Ga0193138_1059170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300018749|Ga0193392_1044988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300018749|Ga0193392_1046417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300018749|Ga0193392_1047311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum557Open in IMG/M
3300018758|Ga0193058_1076612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300018763|Ga0192827_1073148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum592Open in IMG/M
3300018763|Ga0192827_1076975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300018763|Ga0192827_1083701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300018766|Ga0193181_1058333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300018779|Ga0193149_1061945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum531Open in IMG/M
3300018782|Ga0192832_1043031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum616Open in IMG/M
3300018800|Ga0193306_1057569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300018812|Ga0192829_1096892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300018828|Ga0193490_1076156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300018828|Ga0193490_1080212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300018858|Ga0193413_1091055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300018874|Ga0192977_1084831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300018874|Ga0192977_1085749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum633Open in IMG/M
3300018874|Ga0192977_1085750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum633Open in IMG/M
3300018874|Ga0192977_1097433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300018883|Ga0193276_1098450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300018889|Ga0192901_1132736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum511Open in IMG/M
3300018899|Ga0193090_1125504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300018899|Ga0193090_1149908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300018955|Ga0193379_10192368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300018955|Ga0193379_10195581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300018967|Ga0193178_10063274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300018967|Ga0193178_10063278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300018968|Ga0192894_10319746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300018976|Ga0193254_10160446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300018989|Ga0193030_10285491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300019001|Ga0193034_10128386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300019010|Ga0193044_10208893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum616Open in IMG/M
3300019010|Ga0193044_10209395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum615Open in IMG/M
3300019010|Ga0193044_10233340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300019010|Ga0193044_10252604All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300019010|Ga0193044_10278002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300019010|Ga0193044_10280310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300019012|Ga0193043_10317892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300019012|Ga0193043_10324614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300019021|Ga0192982_10278760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300019023|Ga0193561_10324994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300019025|Ga0193545_10115161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300019027|Ga0192909_10180991All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum615Open in IMG/M
3300019036|Ga0192945_10231331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum588Open in IMG/M
3300019039|Ga0193123_10294110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300019039|Ga0193123_10376860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300019045|Ga0193336_10469642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300019045|Ga0193336_10566436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300019045|Ga0193336_10620280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300019048|Ga0192981_10279590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300019065|Ga0192831_103295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300019065|Ga0192831_103362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum557Open in IMG/M
3300019065|Ga0192831_103491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300019097|Ga0193153_1025695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300019102|Ga0194243_1007199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum592Open in IMG/M
3300019103|Ga0192946_1066493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300019112|Ga0193106_1038017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum579Open in IMG/M
3300019117|Ga0193054_1055901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300019118|Ga0193157_1031927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300019129|Ga0193436_1057599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum598Open in IMG/M
3300019129|Ga0193436_1057771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300019139|Ga0193047_1083963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum647Open in IMG/M
3300019139|Ga0193047_1111007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum564Open in IMG/M
3300019139|Ga0193047_1123044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300019141|Ga0193364_10130726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300019150|Ga0194244_10078980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum592Open in IMG/M
3300019274|Ga0182073_1050452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300019283|Ga0182058_1127474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300019459|Ga0181562_10614954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum506Open in IMG/M
3300020555|Ga0208358_1056856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum567Open in IMG/M
3300020595|Ga0206126_10246908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum817Open in IMG/M
3300021342|Ga0206691_1754974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300021345|Ga0206688_10815407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300021353|Ga0206693_1339496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300021353|Ga0206693_1950515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300021373|Ga0213865_10435820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300021912|Ga0063133_1003763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300021912|Ga0063133_1008190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300021913|Ga0063104_1002190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300021923|Ga0063091_1045902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300021928|Ga0063134_1018480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum592Open in IMG/M
3300021950|Ga0063101_1037043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300022353|Ga0210292_114353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300022905|Ga0255756_1291280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300022934|Ga0255781_10455994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300023683|Ga0228681_1035204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300024297|Ga0228658_1172093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300024320|Ga0233398_1123044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum591Open in IMG/M
3300024321|Ga0228626_1103152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum616Open in IMG/M
3300025640|Ga0209198_1110856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum832Open in IMG/M
3300025816|Ga0209193_1113198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum663Open in IMG/M
3300025892|Ga0209630_10404758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum589Open in IMG/M
3300025897|Ga0209425_10509846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300026443|Ga0247559_1126770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300026495|Ga0247571_1135345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum579Open in IMG/M
3300026495|Ga0247571_1135894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300027225|Ga0208025_1074112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300027308|Ga0208796_1076914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300027308|Ga0208796_1125748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300027714|Ga0209815_1260113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300027752|Ga0209192_10324686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300027833|Ga0209092_10568600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300028119|Ga0247561_118572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300028137|Ga0256412_1291605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300028137|Ga0256412_1363341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum531Open in IMG/M
3300028282|Ga0256413_1291283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum576Open in IMG/M
3300028334|Ga0247597_1042187All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum614Open in IMG/M
3300028335|Ga0247566_1078030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum558Open in IMG/M
3300030670|Ga0307401_10225507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum848Open in IMG/M
3300030720|Ga0308139_1054866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300030724|Ga0308138_1048596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300030724|Ga0308138_1052095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300030728|Ga0308136_1134808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum560Open in IMG/M
3300030780|Ga0073988_10022327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum579Open in IMG/M
3300031032|Ga0073980_10009994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300031496|Ga0308130_1059203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300031579|Ga0308134_1120128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum603Open in IMG/M
3300031622|Ga0302126_10158687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum834Open in IMG/M
3300031750|Ga0307389_11048158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300031775|Ga0315326_10303445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1045Open in IMG/M
3300032470|Ga0314670_10475877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum653Open in IMG/M
3300032481|Ga0314668_10401739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum707Open in IMG/M
3300032519|Ga0314676_10735437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300032617|Ga0314683_10749736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum591Open in IMG/M
3300032666|Ga0314678_10373596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum644Open in IMG/M
3300032707|Ga0314687_10650483All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia586Open in IMG/M
3300032708|Ga0314669_10267883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum907Open in IMG/M
3300032711|Ga0314681_10572355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300032725|Ga0314702_1339266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300032729|Ga0314697_10425076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum589Open in IMG/M
3300032732|Ga0314711_10438520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum674Open in IMG/M
3300032732|Ga0314711_10627214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300032743|Ga0314707_10442014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum678Open in IMG/M
3300032746|Ga0314701_10459479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300032747|Ga0314712_10478544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300032747|Ga0314712_10488532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum579Open in IMG/M
3300032750|Ga0314708_10196402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum978Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine38.86%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine10.92%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica8.30%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater7.42%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater6.11%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.80%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.93%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.93%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.93%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.49%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.31%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.87%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.87%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.87%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.44%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.44%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.44%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.44%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.44%
Bay WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water0.44%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003555Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_17_M020 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003677Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_66_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003683Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006366Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006373Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300007953Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_3umEnvironmentalOpen in IMG/M
3300008834Eukaryotic communities of water from the North Atlantic ocean - ACM26EnvironmentalOpen in IMG/M
3300008919Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - NA1EnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008932Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2AEnvironmentalOpen in IMG/M
3300008933Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2BEnvironmentalOpen in IMG/M
3300008934Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2CEnvironmentalOpen in IMG/M
3300008935Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3AEnvironmentalOpen in IMG/M
3300008936Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3BEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009055Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3EnvironmentalOpen in IMG/M
3300009276Eukaryotic communities of water from the North Atlantic ocean - ACM57EnvironmentalOpen in IMG/M
3300009402Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4BEnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009438Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506EnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300016771Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016787Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071411AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018537Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_139 - TARA_N000003035 (ERX1789644-ERR1719455)EnvironmentalOpen in IMG/M
3300018575Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782379-ERR1712162)EnvironmentalOpen in IMG/M
3300018596Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002183 (ERX1782364-ERR1711927)EnvironmentalOpen in IMG/M
3300018603Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782239-ERR1711906)EnvironmentalOpen in IMG/M
3300018613Metatranscriptome of marine microbial communities from Baltic Sea - GS846_ls3EnvironmentalOpen in IMG/M
3300018614Metatranscriptome of marine microbial communities from Baltic Sea - GS678_3p0_dTEnvironmentalOpen in IMG/M
3300018617Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000604 (ERX1782236-ERR1711896)EnvironmentalOpen in IMG/M
3300018655Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000522 (ERX1782387-ERR1711943)EnvironmentalOpen in IMG/M
3300018666Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000398 (ERX1782307-ERR1712184)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018701Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789579-ERR1719459)EnvironmentalOpen in IMG/M
3300018716Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001728 (ERX1789726-ERR1719299)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018749Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002036 (ERX1789662-ERR1719448)EnvironmentalOpen in IMG/M
3300018758Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002171 (ERX1782363-ERR1712059)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018782Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000570 (ERX1782313-ERR1712019)EnvironmentalOpen in IMG/M
3300018800Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001650 (ERX1789422-ERR1719172)EnvironmentalOpen in IMG/M
3300018812Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000065 (ERX1789716-ERR1719392)EnvironmentalOpen in IMG/M
3300018828Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002925 (ERX1789466-ERR1719252)EnvironmentalOpen in IMG/M
3300018858Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002021 (ERX1789628-ERR1719293)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018883Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001582 (ERX1789446-ERR1719492)EnvironmentalOpen in IMG/M
3300018889Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000728 (ERX1789501-ERR1719269)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018955Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001972 (ERX1789369-ERR1719393)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019012Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809764-ERR1740129)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019023Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_145 - TARA_N000003231EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019043Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001784 (ERX1782103-ERR1712098)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019065Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_047 - TARA_N000000278 (ERX1782424-ERR1711901)EnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019102Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782448-ERR1712220)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019112Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000836 (ERX1782266-ERR1711948)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019139Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001430 (ERX1809743-ERR1740120)EnvironmentalOpen in IMG/M
3300019141Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001937 (ERX1789668-ERR1719463)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019274Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019283Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020555Freshwater microbial communities from Lake Mendota, WI - 10AUG2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021923Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-8M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022353Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R8.37A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022905Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaGEnvironmentalOpen in IMG/M
3300022934Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaGEnvironmentalOpen in IMG/M
3300023683Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 22R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024297Seawater microbial communities from Monterey Bay, California, United States - 71DEnvironmentalOpen in IMG/M
3300024320Seawater microbial communities from Monterey Bay, California, United States - 38DEnvironmentalOpen in IMG/M
3300024321Seawater microbial communities from Monterey Bay, California, United States - 31DEnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025816Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026443Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 4R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027225Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027308Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 (SPAdes)EnvironmentalOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028119Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 9R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030724Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_949_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030728Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_940_32.3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031496Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1105_33.1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031775Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032725Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032729Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0008453J51685_10244513300003555SeawaterMKCQIYKSVVGSGRWSSLGNISFLSHSSDVNDLLEGLDGVLEDWLDRLHDTESSLHIVDLWLHAFDGLHLSGDFDEWLSIIKSLEDSGGKGFLDVLDGSGLGNGGVSISSGLGHLSGGKVGSELGKELILGHEVVLVGSNGGDKGAGEFHL*
Ga0008458J53046_10231013300003677SeawaterLEGFDGVLKDWLDRLHDTESSLHIVNLWLHAFDGLHLSGDLNEWLSIIKSLEDSSGKGFLDVLDGSSLGNGGITISSGLGSLSGVEVGGELGQKIILVHVLEGDSLGDSDESAEFHFK
Ga0008459J53047_100289813300003683SeawaterLEGFDGVLEDWLDRLHDTESSLHIVDLWLHAFDGLHLSGDLDEWLSIIKSLEDSSGKGFLDVFDGSSLGNGGITISSGLGSLSGVEVGGELGQKIILVHVLEGDSLGDSDESAEFHFK
Ga0075501_104089413300006355AqueousVQCKQVSLTSSWDIKHVEKYSLLAHASDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNQGLSIIESLEDSGGQRLLDVLDGSGLGNGGITISTGLRLEGRGQGVGQRDEELIFGHVVVLGG
Ga0075499_123329313300006366AqueousVQCKQVSLTSSWDIKHVEKYSLLAHASDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNQGLSIIESLEDSGGQRLLDVLDGSGLGNGGITISTGLRLEGRGQGVGQRDEELIFGHVVVLGGRDGCDESEGEFHC
Ga0075483_128814313300006373AqueousMVGERHSQSSLLAHASDIDDLLEGLDGVLEDGLDRLHDTKSTLHVVNLGLHALDGLHLSSDLDEGLTVIESLENSSGKSLLDVLDSSGLGDGGISITTGLGGEGGGELALEGHEEIVLVHVLVADGGGSGDKGSGGEFH
Ga0075517_157966813300006393AqueousMRGSLLAHASDVNDLLEGLDGVLENWLDGLHDTESSLHVVDLWLHALDGLHFSGDLNEWLSIVESLEDSSGEGLLDVLDGGGLGNGGIRISHGLGFHGGLQVGGELGKELILVHVLE
Ga0075471_1017924613300006641AqueousVQCKQVSLTSSWDIKHVEKYSLLAHASDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNQGLSIIESLEDSGGQRLLDVLDGSGLGNGGITISTGLRLEGRGQGVGQRDEELIFGHVVVLGGRDGCDESEGEFH
Ga0075473_1009297313300006875AqueousVQCKQVSLTSSWDIKHVEKYSLLAHASDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNQGLSIIESLEDSGGQRLLDVLDGSGLGNGGITISTGLRLEGRGQGVGQRDEELIFGHVVVLGGRDGCDESEGEFH*
Ga0075472_1063086313300006917AqueousLLASCVKTCSHHGESSSLLAHASDVNDLLEGLDGVLEHWLNGLHDTESSLHVVDLWLHALDGLHLSGDLNEWLSVIKSLEDSSSEGLLDVLDGSSLGNGGVSISSGLGSLSRDEGAGQLGQQLILSHEVVLVGSNGGNDCVGEFPSLKF*
Ga0102818_105955513300007552EstuarineLEGLDGVLKDWLDRLHDSESSFHIVDLWLHAFDGLHLSGNFDEWLSVIESLEDSGSQRLLDVLDGSGLGNSGVSVTSGFGHLSGFQMGGELGEELIFVHVLELGSSDGGNSKGEEFHV*
Ga0102822_113901113300007558EstuarineLEGLDGVLEDWLDRLHDTESSLHIVDLWLHAFDGFHLSGDLNEWLTVIESLEDSSGEGFLDVLDGSGLGNGGITISSGLGSLSGDEGGAELGKELILTHEVVLVGSNGGDKSDGEFHF*
Ga0102827_113702113300007715EstuarineMISFLSHSSDVNDLLEGLDGVLEDWLDRLHDTESSLHIVDLWLHAFDGLHLSGDFNEWLTVIESLEDSSGKGFLDVLDGSGLGNGGVSISSGLGHLSGRKVGGELGKELILGHEVVLVGSNGGDKGAGEFHL*
Ga0102827_116687013300007715EstuarineDDLLEGLDGVLEDWLDGLHDTESSLHIVNLWLHAFDGFHLSGDLNEWLSVIESLEDSSGEGFLDVLDGSGLGNGGISISSGFGSLSRDEGGGKLGEELILTHEVVLVGSDGGNKSAGEFHF*
Ga0105738_111114513300007953Estuary WaterDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSVIESLEDSSGEGFLDVLDGSGLGNGGITISSGFGSLSRDEGGGKLGKELILTHEVVLVGGDGSDKSAGEFHFDFFYLFIF*
Ga0103882_1009910413300008834Surface Ocean WaterLEGLDGVLEDWLDGLHDTESSFHIVDLWLHAFDGLHLSGNFDEWLSIIESLEDSGGEGFLDVLDGSGLGNGGITITSGLGVESGGESGGEVDEEFIFVH
Ga0103484_101412013300008919Bay WaterVCSFLTHTSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSGGQGLLDVLDGSGLGNSGVSVTSGLGLESGGEGVGERDEEFVFGHVVVLGGSDGGGESKG
Ga0103732_104577213300008929Ice Edge, Mcmurdo Sound, AntarcticaLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNSGVTISSGLAGESGGEVGLEVDEEFVFVHGLELVGRDGSNGGDSEEFHFDLIYSYNLLCF*
Ga0103732_106330813300008929Ice Edge, Mcmurdo Sound, AntarcticaVSSGNAFRRSSFLAHTSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNGGVSISSGLGLLGRFDGGAELSKELVFSHEVEGVGRDGSNGGGGEEFHL*
Ga0103733_104601213300008930Ice Edge, Mcmurdo Sound, AntarcticaLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNSGVTISSGLAGESGGEVGLEVDEEFVFVHGLELVGRDGSNGGDSEEFHFDLIYY*
Ga0103733_106154413300008930Ice Edge, Mcmurdo Sound, AntarcticaEDWLNGLHDTESSLHIVNLWLHTFDGLHLSGDLDEWLSVIKSLEDSSGKGLLDVLNGSGLGNSGVTITSGLAGESGGEGGLEVDEELVFVHGLELVGRDGSNGGDGKEFHVDSLHLIGFIRLIIIHIISFGAKGIS*
Ga0103733_106491813300008930Ice Edge, Mcmurdo Sound, AntarcticaLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNGGVSISSGLGLLGRFDGGAELSKELVFSHEVEGVGRDGSNGGGGEEFHL*
Ga0103734_100200133300008931Ice Edge, Mcmurdo Sound, AntarcticaLEGLDGVLKNWLDRLHDTESSLHIVDLWLHTLDGLHLSSNFDEWLSIIESLEDSSGKGFLDVLDSGGFGNSSISITSVLGGKGGLEVYGKLSEELVFVHLLEFEGGDGGNKSAIFHLLYYILI*
Ga0103734_103589223300008931Ice Edge, Mcmurdo Sound, AntarcticaSSLHIVNLWLHTFDGLHLSGDLDEWLSVIKSLEDSSGKGLLDVLNGSGLGNSGVTITSGLAGESGGEGGLEVDEELVFVHGLELVGRDGSNGGDGKEFHVDFVKFNL*
Ga0103734_104513813300008931Ice Edge, Mcmurdo Sound, AntarcticaLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNSGVTISSGLAGESGGEVGLEVDEEFVFVHGLELVGRDGSNGGDSEEFHFDLIYF*
Ga0103734_107833723300008931Ice Edge, Mcmurdo Sound, AntarcticaLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNGGVSISSGLGLLGRFDGGAELSKELVFSHEVEGVGRDGMQP*
Ga0103735_101086623300008932Ice Edge, Mcmurdo Sound, AntarcticaLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNKWLSIIESLKDSSGKGFLDVLDGSGLGNSGVSITSGLGSLSRDEGGGELGEEFIFTHEVVLVGRDGGDKSDGEFHF*
Ga0103735_103768513300008932Ice Edge, Mcmurdo Sound, AntarcticaVSSGNAFRRSSFLAHTSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNGGVSISSGLGLLGRFDGGAELSKELVFSHEVEGVGRDGMQP*
Ga0103735_104947323300008932Ice Edge, Mcmurdo Sound, AntarcticaLEGLDGVLEDWLNGLHDTESSLHIVNLWLHTFDGLHLSGDLDEWLSVIKSLEDSSGKGLLDVLNGSGLGNSGVTITSGLAGESGGEGGLEVDEELVFVHGLELVGRDGSNGGDGKEFHVDFVKFNL*
Ga0103736_101634913300008933Ice Edge, Mcmurdo Sound, AntarcticaLEGLDGVLEDWLNGLHDTESSLHIVNLWLHTFDGLHLSGDLDEWLSVIKSLEDSSGKGLLDVLNGSGLGNSGVTITSGLAGESGGEGGLEVDEELVFVHGLELVGRDGSNGGDGKEFHVEVARKMKAIEGMQP*
Ga0103737_103448413300008934Ice Edge, Mcmurdo Sound, AntarcticaHTSDIDDLLEGLDGVLEDWLNGLHDTESSLHIVNLWLHTFDGLHLSGDLDEWLSVIKSLEDSSGKGLLDVLNGSGLGNSGVTITSGLAGESGGEGGLEVDEEFVFVHGLVLVGRDGSKGGEGMQP*
Ga0103738_103319513300008935Ice Edge, Mcmurdo Sound, AntarcticaMICGSNSHLECSFLTHTSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSIIESLEDSGGKGLLDVLDGSGLGNSGVTVSSGLGHLGGREGGFELGEELILRTPSRPSKRS*
Ga0103739_102414213300008936Ice Edge, Mcmurdo Sound, AntarcticaLEGLDGVLEDWLNGLHDTESSLHIVNLWLHTFDGLHLSGDLDEWLSVIKSLEDSSGKGLLDVLNGSGLGNSGVTITSGLAGESGGEGGLEVDEEFVFVHGLVLVGREMKAIEGMQP*
Ga0103739_106598823300008936Ice Edge, Mcmurdo Sound, AntarcticaLEGLDGVLENWLNRLHDTESSLHIVNLWLHAFNGLHFSGNFNEWLSIIESLEDSSGKRFLDVFDSGGLGNGGITISSGLRFLSRAEVGCKLGQKLVLVHVFERDSLGSGDESNGEFHF
Ga0104259_103757913300008958Ocean WaterLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNGGVTISSGLAGESGGEVGLEVDEEFVFVHGLELVGRDGSKGGDSEEF
Ga0103502_1030611913300008998MarineMHAACSSLSSIVKGIDKWYQPSRSSLLAHASNINDLLEGLDGVLEDWFDGLHDTESSFHIVDLWLHALDGLHLSGNFDEWLSIIKSLEDSGGKGLLDVLDGSGLGNGGVSISFSFTLLSGFKGNLELGKKLVFTHEVEHVGGGGGNEKAEFHLK
Ga0102813_114427223300009003EstuarineVVSFLSHSSDINDLLEGLDGVLEDWFNRLHDTESSFHVVDLWLHSFDGLHLSGNFDEWLSIIKSLEDSGSKGFLDVLDGSGLGNGGITISSGLGHLSGGKVGGELGKELILGHEVVLVGSNGGDKGAGEFHL*
Ga0103706_1009426713300009022Ocean WaterLEGLDGVLENWLDGLHDTESSLHIVDLWLHSFDGLHLSGNFDEWLSVIESLEDSSGEGFLDVLDGSGLGNGGIRVTSGLGSLGRVKGGGELSEELIFVHGLEVNSGNKSKNSGEFHVEKLINYKACEFVKKSLHEPSATKM*
Ga0103707_1019778013300009025Ocean WaterLHDTKSSFHIVDLWLHSFDGFHLSGNFNEWLSVIESLKDSSSKSFLDVLDGSSLGNGGITISSGLRSLGRVEGGLEVDEEIIFSHGVVLVGRDSGDKGDGEFHFKEL
Ga0102829_130307213300009026EstuarineKKSSYSFLAHSSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHAFDGLHLSGNFDEWLSVIESLEDSGSQGFLDVLDGSGLGNSGVSVTSGLRFEGGGEVGGEVDEEFVFVHGVVFVGGNSSNEKGTEFHVERGFNY*
Ga0102905_114103513300009055EstuarineDLLEGLDGVLEDWLDGLHDTESSLHIVNLWLHALDGLHLSGDLNEWLSVIESLEDSSGEGFLDVFDGSGLGNGGVSISSGFGSLSRDEGGGELGEEFILTHEVVLVGRDGGDKSGDGEFHF*
Ga0103879_1002489713300009276Surface Ocean WaterLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSGGEGLLDVLDGSGLGNSGVTITSGLGSLGGLKSGGKLRKELILTHEVVGVGSGGGDEKGSGNKW*
Ga0103742_100492123300009402Ice Edge, Mcmurdo Sound, AntarcticaLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNSGVTISSGLAGESGGEVGLEVDEEFVFVHGLELVGRDGSNGGDSEEFHFD
Ga0103742_105764613300009402Ice Edge, Mcmurdo Sound, AntarcticaVSSGNAFRRSSFLAHTSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNGGVSISSGLGLLGRFDGGAELSKELVFSHEVEGVGRDGSNGGDGEEFH
Ga0114998_1059872313300009422MarineGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNGGVTISSGLAGESGGEVGLEVDEEFVFVHGLELVGRDGSKGGDSEEFHVDFVKFNY*
Ga0115005_1076602923300009432MarineLEGLDGVLENWLDGLHDSESSLHVVDLWLHALDGLHLSGDLDEWLTIIKSLEDSSGQGLLDVLDGSGLGNSGVSVTSGLTIESGGEGGGELSEELIFNLSG*
Ga0115545_114148213300009433Pelagic MarineVVGSGRWSSLGNISFLSHSSDVNDLLEGLDGVLEDWLDRLHDTESSLHIVDLWLHAFDGLHLSGNFDEWLSIIKSLEDSGSKGFLDVLDGSGLGNGGITISSGLGHLSGGKVGGELGKELILGHEVVLVGSNGGDKGAGEFHL*
Ga0115545_131422013300009433Pelagic MarineSDIDDLLEGLDGVLEDWLNRLHDTESSLHIVNLWLHAFDGFHLSGDLNEWLSVIESLEDSSGEGFLDVLDGSGLGNGGISISSGFGSLSRDEGGGKLGEELILTHEVVLVGSDGGNKSAGEFHF*
Ga0115559_129986413300009438Pelagic MarineLEGLDGVLEDWLDRLHDTESSLHIVDLWLHAFDGLHLSGDLDEWLSVIKSLEDSSGKGFLDVLDGSGLGNGGVSISSGLRHLSGRKVGGELGKELILGHEVVLVGGNGGDKGAGEFHL*
Ga0115563_117225813300009442Pelagic MarineLEGLDGVLENWLDGLHDTESSLHIVDLWLHAFNGLHLSGDLNEWLSIIESLEDSSGKGFLDVLDGSGLGNGGVVITLRLGGHGGVEVGGELDEEFVFVHLGELEGRDGGDGGEGEEFHDKFISYYYNKFAN*
Ga0115555_146394613300009476Pelagic MarineSSLHIVDLWLHAFDGLHLSGDLDEWLSVIKSLEDSGGKGLLDVLDGSGLGNGGVTISSGLAGESGGEVGLEVDEEFVFVHGLELVGRDGSKGGDSEEFHVDFVKFNY*
Ga0115569_1022883713300009497Pelagic MarineVVGSGRWSSLGNISFLSHSSDVNDLLEGLDGVLEDWLDRLHDTESSLHIVDLWLHAFDGLHLSGDFDEWLSVIKSLEDSSGKGFLDVLDGSGLGNGGVSISSGLGHLSGGKVGSELGKELILGHEVVLVGSNGGDKGAGEFHL*
Ga0115568_1040144613300009498Pelagic MarineGFTHSSDINNFLEGLDSILKDWFNRLHDTESSLHIVNLWLHAFNGLHFSSNFNKWLSIIESLKDSCGKSFLDVLDGSGLGNGGVTISSGLAGESGGEVGLEVDEEFVFVHGLELVGRDGSKGGDSEEFHVDFVKFNY*
Ga0115006_1030966713300009544MarineLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNGGVTISSGLAGESGGEVGLEVDEEFVFVHGLELVGRDGSKGGDSEEFHVDFVKFNY*
Ga0115101_113803113300009592MarineLEGLDGVLKNWLDGLHDTESSLHIVDLWLHAFDGLHLSGDFNEWLSIIESLEDSSGKGFLDVLDGSGLGNGGVVITLRLGGHGGVEVGGELDEEFVFVHLGELEGRDGGNGGEG
Ga0115103_108195713300009599MarineLEGLDGVLKNWLDGLHDTESSLHIVDLWLHAFNGLHLSGDFNEWLSIIESLEDSSGKGFLDVLDGSGLGNGGVVITLRLGGHGGVEVGGELDEEFVFVHLGELEGRDGGNGGEGEEFH
Ga0115102_1062839713300009606MarineLEGFDGVLKDWLDRLHDTESSLHIVNLWLHAFDGLHLSGDLDEWLSIIKSLKDSSGKGFLDVFDGSSLGNGGITISSGLGSLSGVEVGGELGQKIILVHVLEGDSLGDSDESAEFHFK
Ga0138258_137176013300012413Polar MarineVKSASAGNRSFLAHASDINDLLEGLNGVLENWLNRLHDTESSLHIVDLWLHAFDGLHLSGDLNKGLSIIESLKDSRGKGFLDVLNGGSLGNGGIIISHRLGGHGGVEVGGKLDEEFIFVHLGELDGG
Ga0138258_139996813300012413Polar MarineLEGLDGVLENWLDGLHDTESSLHIVDLWLHSLDGLHLSGDLNKGLSIIKSLKDSSGKSLLDVLDGSGLGNSGVTVSLGLGVKGGSELGLEGDEKLVSFMAS*
Ga0129347_121792613300012504AqueousLEGFDGILKNWLNGLHDTESSLHIIDLWLHALDGLHLSGDLNKWLSIIESLEDSSGEGFLDVLDGSGLGNGGIRITSRLRGHGGFEVRRELGEELVFVHLGELSSGGSGD
Ga0163179_1080862313300012953SeawaterLFVDNLSIRIVVGLTESSSFLSHSTDIDDLLEGLDGVFEDWLNRLHDTESSLHIIDLWLHALDGLHLSGNFNKWLSIIESLEDSGSKSFLDVLDGGGLGNGGVSITSGFRLLGGSQFNLELGKELVFSHKVVGVSGNSGGESEEFHL*
Ga0163179_1175793713300012953SeawaterMGSSLLAHSSDIDDLLEGLDGVLKDWLDRLHNTKSSLHIVNLWLHSLDGFHFSSNFDEWLSIIKSLKDSGSKGFLDILNSGGLGNSGVTISSGLRLLGVSESDLELGEELVLVHV
Ga0129341_132067813300012966AqueousLEGFDGILKNWLNGLHDTESSLHIIDLWLHALDGLHLSGDLNKWLSIIESLEDSSGEGFLDVLDGSGLGNGGIRITSRLRGHGGFEVRRELGEELVFVHLGELSSGGSGDKGEEF
Ga0164294_1050902323300013006FreshwaterVIYSLLSHSTDINDLLEGLDGVLEDGLDGLHDTESSLHIVDLGLHSLDGLHLSGDLNKGLSIIESLEDSGSEGFLDVLDGSGLGDGGISITARFRGESRVEGRLKVNEEFIFVHGFVHVGVGSSEECGGGEFHFKVNNLL*
Ga0164295_1059353113300013014FreshwaterVIYSLLSHSTDINDLLEGLDGVLEDGLDGLHDTESSLHIVDLGLHSLDGLHLSGDLNKGLTIIESLEDSGSEGFLDVLDGSGLGDGGISITARFRGESRVEGRLKVNEEFIFVHGFVHVGVGSSEECGGGEFHFKVNNLL*
Ga0182082_132800113300016771Salt MarshMLGKSFNSLLSHSSDVDDLLESLDSVLKNGLDGLHDSESSLHIVDLGLHSLDGLHLSGNLDEGLSIIESLEDSSGESLLDVLDGSGLGNSGVSISSGLGGESGREGGLKVNKELILVHGVVSVGGEGLIVD
Ga0182080_158800113300016787Salt MarshMESGCSFLSHSSDINDLLEGLDGVLEDWLNRLHDSESSLHIVDLWLHALDGLHLSGNFDEWLSIIESLEDSSGQGFLDVLDGSGLGNSGISVTSGLGLESGGEGVGEGDEELIFGHVVVLGG
Ga0181425_108794513300017771SeawaterMLVGSAVKKSGDSWCSFLAHTSDINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGNLDEWLSVIESLEDSGGEGLLDVLDGSGLGNGGVGITSGLAGESGVEVGLEGNEEVVFVHGLELVGGHNGDESGGEFHF
Ga0181569_1051301513300017986Salt MarshMNHFREESDCNINHDGVASGGSSFLAHSSDINDLLEGLDGVLEDWLDGLHDTESSLHIVNLWLHALDGLHLSGDLNEWLSVIESLEDSSGKGLLDVLDGSGLGNGGVTITSGLGSLCGGEGGLEVDEELILGHGVVLGGGNSGDKGEEFHVKS
Ga0193019_10469313300018537MarineMQEGAFKVSQSDACRISFHLKSDFRWCSFLSHSSDIDDLLEGLDGVLKDWLDGLHDSESSLHIVDLWLHALDGLHLSGDLNKGLSIVESLEDSGGEGLLDVLNGGGLSNGGISVTSGLGLESGREGRGEVDEELIFVHVVVLGGSDGGDKGEFHGLI
Ga0193474_101206813300018575MarineMGWVLQFSLLIIKCFSSSFLSHSSDIDDLLEGLDGVLKDWLDGLHNTKSSFHIVDLWLHTLNSFHFSSDLDEWLSVVKSLKDSGSQCFLNVLDGSGLGNGGGLIVSSLSFEGGVEG
Ga0193060_101601113300018596MarineMSDQLSHVVSVVRVRWCSFLSHTSDINDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSIIESLEDSGGEGLLDVLDGSGLGNGGIGITSGLAGEGRVEVGLEGDKEVILVHGLELVGRDSGDKSDGEFHFKELSLDFKLPM
Ga0193060_101656913300018596MarineMLVGSAVKSDGLWQCSFLAHTSDIDDLLEGLDGVLEDWLNGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSIIESLEDSGGEGLLDVLDGSGLGNGGIGITSGLAGEGRVEVGLEGDKEVILVHGLELVGRDSGDKSDGEFHFKELSLDFKLPM
Ga0193060_101702113300018596MarineVHFDSIHLVRGCSFLSHSSNINDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSIIESLEDSGGEGLLDVLDGSGLGNGGIGITSGLAGEGRVEVGLEGDKEVILVHGLELVGRDSGDKSDGEFHFKELSLDFKLPM
Ga0193060_101705813300018596MarineMGVQTKSVLDSRRELNELRCSFLSHSSDINDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSIIESLEDSGGEGLLDVLDGSGLGNGGIGITSGLAGEGRVEVGLEGDKEVILVHGLELVGRDSGDKSDGEFHFKELSLDFKLPM
Ga0192881_102246613300018603MarineVRSSLLSHTSDVNDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHAFDGLHLSGNFDEGLSIIESLKDSSGQGFLDVLDSGGLGNGGISVSHGLGSLGRDEGGRELGEELILTHEVVLVGSDGGDKSEFHFKCFNSPC
Ga0188872_101222913300018613Freshwater LakeVCSLLAHSSDINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSIIESLEDSSGEGFLDVLDGSGLGNGGISISSGLGSLSGDEGAGELGEELILVEGVVLVGRGGSNKGNSGE
Ga0188846_103232713300018614Freshwater LakeVNKTRNKKSSAGRLIRCRTISLLAHASDINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHAFDGLHLSGNFNEGLSVIESLEDSSGEGFLDVLDGSGLGNGGVSISSGLAHLSGGEVGSELGEELIIGHMVVLVSGNGGNEGKGEFH
Ga0193133_101827123300018617MarineMGISFLAHASDINDLLEGLDGVLENGLDGLHDTESSLHIVDLGLHALDGLHLSGDLNEGLSVIESLEDSSGKGFLDVLDGSGLGNSGIRVTSGLGGESRREGGLEVDKEVIFVHGVVSVGSNGGEDSSELHCNFNYSPC
Ga0192846_102535323300018655MarineMSSFLAHSSNIDDLLEGLDGVLEDWLDGLHDTESSLHIVNLWLHSLDGLHLSGDLNEWLSIIESLEDSSGKGLLDVLDGSGLGNSGITITSGLGSLGGDELGGKLSEELIISHEVIGVGGDGGDESEEFHFCFNYLSPC
Ga0193159_104116813300018666MarineMGISFLAHASDINDLLEGLDGVLENGLDRLHDTKSALHVVDLGLHALDGLHLSGNLDEGLTVIKSLEDSGGEGLLDVLDGSGLGNSGIRVTSSLGSLGRVKGGGELSEELVFVHGLEVNSGGNSKNSGEFHV
Ga0192983_103991213300018684MarineLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNSGVTISSGLAGESGGEVGLEVDEEFVFVHGLELVGRDGSNGGDSEEFHFDLIYSPCTLR
Ga0193405_104516313300018701MarineLRSLWSDVVCSFLAHASDIDDLLEGLDGVLKDWLDGLHDSESSLHIVDLWLHALNGLHLSGNFNEGLSVIESLKDSSGQGFLDVLDSGGLGNGGISVSHGLGSLGRDEGGRELREELVLTHEVVLVGSNGGDESE
Ga0193324_104885213300018716MarineMQEGAFKVSQSDACRISFHLKSDFRWCSFLSHSSDIDDLLEGLDGVLKDWLDGLHDTESSLHIVDLWLHSLDGLHLSGDLNEWLSIIKSLKDSSGKGFLDVLDGSGLGNGGVSVSHGLGSLGRDEGGRELREELVLTHEVVLVGSDGGDKSEFH
Ga0192967_106349613300018730MarineVLSEDELRVRRSDSKAGTSSPICSFLAHSTDIDDLLEGLDGVLEDWLDRLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSIIKSLKDSSGKSFLDVLDGSGLGNGGVSISSGLGSLSRDEGGGKLGEEFIFTHEVVLVGRDGGDKSGG
Ga0193138_105787513300018742MarineLSISFLAHTSDIDNLLEGLDGVFEDWLNGLHDTESSLHIVNLWLHSLDGFHLSGDLNKWLSIIESLKDSSGKGFLDVLDGSGLGNGGVGITLRLGGEGGFEVGGELSEELIFVHLGELSGGGSGDKCE
Ga0193138_105917013300018742MarineVSGRCSFLAHSSDINDLLESLNGVLKDWLDRLHDSESSLHVVDLWLHALNGLHLSGNFDEGLSVIESLKDSSGQGLLDVLDSGGLGNGGVSVSHGLGSLGRDEGGRELGEELVLTHEVVLVGSNGGDESEFH
Ga0193392_104498813300018749MarineMVYQTSDSEGERLISLYEQTCSLDISFLAHATDIDDLLEGLDGVLEDGLDRLHDTESALHVVDLGLHALDGLHLPGDLDEGLSVIESLEDSGGEGLLDVLDGSGLGNSGIRVTSGLGGESGREGGLEVDKEVIFVHGVVSVGSNNGEDSSELH
Ga0193392_104641713300018749MarineMGCSFLAHASDIDDLLEGLDGVLENGLDGLHDTESSLHIVDLGLHALDGLHLSGDLNEGLSVIESLEDSSGKGFLDVLDGSGLGNSGIRVTSGLGGESGREGGLEVDKEVIFVHGVVSVGSNNGEDSSELH
Ga0193392_104731113300018749MarineMQRLVVNVDELEGSLRISFLAHAADIDDLLEGLDGVLEDGLDRLHDTESALHVVDLGLHALDGLHLPGDLDEGLSVIESLEDSGGEGLLDVLDGSGLGNSGIRVTSGLGGESGREGGLEVDKEVIFVHGVVSVGSNNGEDSSELH
Ga0193058_107661213300018758MarineVIQVSSNGLCCSFLAHSSDIDDLLEGLDGVLEDWLNGLHDSESSLHIVNLWLHALNGLHLPGNFNEGLSIIESLKDSSGQGFLDVLDSGGLGNGGVSVSHGLGSLGRDEGGRELGEELVLTHEVVLVGSDGGDKSEFHSNFLIPH
Ga0192827_107314813300018763MarineMGISFLAHASDINDLLEGLDGVLENGLDRLHDTKSALHVVDLGLHALDGLHLSGNLDEGLSVIESLENSSGESFLDVLDSGGLGNSGIRVTSGLGGLSGREGGLKGDKEVILVHGLVSVGSDGGNDGSEFHY
Ga0192827_107697513300018763MarineMGVHTNSLCILIHLEAFRSRCSFLTHSSDIDDLLEGLDGVLEDWLDGLHDSESSLHIVDLWLHSLDGLHLSGDLNEWLSIIESLEDSGGEGLLDVLDGSGLGNSGVSISSGLGHLGGLEGGSELGEELILTHEVVGVGRDGGKSDGEEFHC
Ga0192827_108370113300018763MarineMSSFGEVTGLSDSSFLSHSSDIDDLLEGLDGVLEDWLDGLHDSESSLHIVDLWLHSLDGLHLSGDLNEWLSIIESLEDSGGEGLLDVLDGSGLGNSGVSISSGLGHLGGLEGGSELGEELILTHEVVGVGRDGGKSDGEEFHC
Ga0193181_105833313300018766MarineLLCFSLVIINHHSTRGCSFLSHSSNIDDLLEGLDGVLKDWLDGLHDSESSLHIVDLWLHALNSLHLSSDLNKGLSVIESLEDSSGEGFLDVLDSGGLGNSGISITSGLGGESGREGRGEVDEELILVHVVVSVGSDGGDKGEFHLK
Ga0193149_106194513300018779MarineMCSLLSHSSDIDNLLEGLDGVLKDWLDRLHDSESSLHVVDLGLHALDGLHLSGNLNEGLSVIESLEDSGGEGLLDVLNGGGLSNGGISVTSGLGLESGREGRGEVDEELIFVHVVVLGGSDGGDKGEFHGLII
Ga0192832_104303123300018782MarineMGCSFLAHASDIDDLLEGLDGVLENGLDGLHDTESSLHIVDLGLHALDGLHLSGDLNEGLSVIESLEDSSGKGLLDVLDGSGLGNGGIRVTSGLGGESRREGGLEVDKEVIFVHGVVSVGSNNGEDSSELHCNFNYSPCTLRYHCFPC
Ga0193306_105756913300018800MarineMVECVALRVLRTCDYQSLEVSFLAHATDIDDLLEGLDGVLENGLDGLHDTESSLHIIDLGLHALDGLHLSGDLNKGLSIVESLEDSGGEGLLDVLNGGGLSNGGISVTSGLGLESGREGRGEVDEELIFVHVVVLGGSDGGDKGEFH
Ga0192829_109689213300018812MarineMLVGSAVKSDGLWQCSFLAHTSDIDDLLEGLDGVLKDWLDGLHDTESSLHIVNLWLHALDGLHLSGNFDEWLSVIESLEDSGGEGLLDVLDGSGLGNGSVGITSGLELLSLVELVLEGNEELVLIHGLISLHG
Ga0193490_107615613300018828MarineMVHYACRIGVQVVRRLSWCSFLAHTSDIDDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKGLLDVLDGSGLGNSGVTISSGLGHLGGREGGSELGEELILTHEVVG
Ga0193490_108021213300018828MarineMDLGKAYELRSLWSDVVCSFLAHASDIDDLLEGLDGVLKDWLDGLHDSESSLHIVDLWLHALDGLHLSGDLNKGLSIVESLEDSGGEGLLDVLNGGGLSNGGISVTSGLGLESGREGRGEVDEELIFVHVVVLGGSDGGDKGE
Ga0193413_109105513300018858MarineCRLSVAKLIITITHGGSNQFFVHLIHLLSASRRSCSFLAHTSDINDLLEGLDGVLEDWLNGLHDTKSSLHIVDLWLHSLDGLHLSGNLDEWLSIIKSLEDSGSEGLLDVLNGSGLGNGGISITSGLAGEGRVEVGLEGDKEIILVHGLELVGRDSGDKGDGEFHFKEL
Ga0192977_108483113300018874MarineMNHSYVYAGWRGRCSFLSHSSDINDLLEGLDGVLKDWLDRLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSIIESLEDSGGEGFLDVLDGSGLGNGGITITSGLGLLGGDEGGLEVDEEFVFSHGVVLGGGDGGDKGEEFHLLKSF
Ga0192977_108574913300018874MarineMNHSYVYAGWRGRCSFLSHSSDINDLLEGLDGVLKDWLDRLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSIIESLEDSSGEGFLDVLDGSGLGNGGVSISSGLGSLSRDEGGGKLGEEFIFTHEVVLVGRDGGDKSGGGEFHFL
Ga0192977_108575013300018874MarineMNHSYVYAGWRGRCSFLSHSSDINDLLEGLDGVLKDWLDRLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSIIESLEDSSGKGFLDVLDGSGLGNSGVSITSGLGSLSRDEGGGELGEEFIFTHEVVLVGRDGGDKSGGGEFHFL
Ga0192977_109743313300018874MarineVQAQWSTPLQSLRMTSGSCSFLAHTSDIDDLLEGLDGVLEDWLNGLHDTESSLHIVNLWLHTFDGLHLSGDLDEWLSVIKSLEDSSGKGLLDVLNGSGLGNSGVTITSGLAGESGGEGGLEVDEELVFVHGLELVGRDGSNGGDGKEFHVDFVKFNF
Ga0193276_109845013300018883MarineVPQACSLLAHATDIDDLLEGLDGVLEDGLDRLHDTESSLHIVDLGLHALDGLHLSGDLNEGLSIIESLEDSSGEGLLDVLDGSGLGNGGIRVTSGLGGESRREGGLEVDKEVIFVHGIVSVGSSNGEDS
Ga0192901_113273613300018889MarineMESECSYSLLAHASDIDDLLEGLDGVLKDWLDGLHDSESSLHVVDLWLHALDGLHLSGDLNKGLSVIESLEDSGSEGLLDVLDGSGLGNSGIRVTSGLGGESRREGGLEVDKEVIFVHGVVSVGSNGGDDSSEFH
Ga0193090_112550413300018899MarineVQAQWSTPLQSLRMTSGSCSFLAHTSDIDDLLEGLDGVLEDWLNGLHDTESSLHIVNLWLHSLDGLHLSGDLDKGLSVIKSLEDSSGKGLLDVLNGSGLGNSGVTITSGLAGESGGEGGLEVDEELVFVHGLELVGRDGSNGGDGKEFHVDF
Ga0193090_114990813300018899MarineLEGLDGVLENWLNRLHDTESSLHIIDLWLHALNGLHFSSNLDEGLSIIKSLENSGSEGLLDVLDGSGLGNSGVSISSGLGLEGGVKVGLELGEELIFVHLVELKSGYGGDKGKEF
Ga0193379_1019236813300018955MarineMYRAGSKLTNKMAIRPSSCSFLAHSSDIDDLLEGLDGVLKDWLDGLHDTESSLHIVDLWLHSLDGLHLSGDLNEWLSIIESLEDSGSEGLLDVLDSSGLGNSGVSVSSGLRLEGGREGGGEVDEEFIFVHGVESVGSDGGDKGEGEFHCDL
Ga0193379_1019558113300018955MarineMYRAGSKLTNMMAFLKPSSCSFLAHSSDINDLLEGLDGVLEDWLDGLHDTESSLHIVNLWLHALDGLHLSGDLNEWLSVIESLEDSSGKGLLDVLDGSGLGNGGITITSGLGRESGGEVGLERDEELIFVHGLELVGRDGSKGGDSEEF
Ga0193178_1006327413300018967MarineMGISFLAHASDINDLLEGLDGVLENGLDGLHDTESSLHIVDLGLHALDGLHLSGDLNEGLSVIESLEDSSGEGLLDVLDGSSLGNGGIRVTSGLGGESRREGGLEVDKEVIFVHGIVSVGSSNGEDSSEL
Ga0193178_1006327813300018967MarineMGISFLAHASDINDLLEGLDGVLENGLDRLHDTKSALHVVDLGLHALDGLHLSGNLDEGLTVIKSLEDSGGEGLLDVLDGSGLGNGGIRVTSGLGGLSGREGGLKGDKEVILVHGLVSVGSDGGNDGSEF
Ga0192894_1031974613300018968MarineVCSFLAHTSDINDFLEGLNGVLKDWLDGLHDTKSSLHIVDLWLHAFNGLHLSGYLNEWLSVIESLEDSGGQGFLDVLDGSGFGNSSVSITSGLGLLGRSQGYLELSEELVFTHEVISVGGGGGNESENVFHLKKLNVNSPC
Ga0193254_1016044613300018976MarineMESRVSFLSHSSDINDLLEGLDGVLKDWLDRLHNSESSLHIVDLWLHALNGLHLSGNLNEWLSIIESLEDSSSEGLLDVLDSSGLGNGGITISSGFAHLGGGKVGGELSEEFIIGHVIVLVGSDGGDESKGEFH
Ga0193030_1028549113300018989MarineVLILEPLLEVGQANELADGCSLLAHAADIDDLLEGLDGVLKDGLDGLHDTEAALHVVDLGLHALDGLHLAGDLNEGLAVIESLEDAGGQGLLDVLDGSSLGDGGIGITAGLGSQGAVEGRLKGDKEVVLVHLVVHVGGDGDGEGGELHLYNSPC
Ga0193034_1012838613300019001MarineMSSLSWTGCSLLSHASDINDLLEGLDGVLKDGLDGLHDTESSLHIVDLGLHALNGLHLSGDLNEGLSVIESLEDSSGKGFLDVLDGSGLGNSGIRVTSGLGGESRREGGLEVDKEVIFVHGVVSVGSNNGEDSSELHCNFNYSPM
Ga0193044_1020889313300019010MarineLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSVIESLEDSSGKGLLDVLDGSGLGNGGITISSGLGSLSRDEGGAELGKEFILTHEVVLVGRDGGDKSGG
Ga0193044_1020939513300019010MarineMKGLTKEIRSHHNWWWSAGRFSLLTHSSNINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSVIESLEDSSGKGLLDVLDGSGLGNGGITISSGLGSLSRDEGGAELGKEFILTHEVVLVGRDGGDKSGG
Ga0193044_1023334013300019010MarineMYRAGSKLPNMMALGRPSRCSFLAHSSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSVIESLEDSSGKGLLDVLDGSGLGNGGITISSGLGSLSRDEGGAELGKEFILTHEVVLVGRDGGDKSGG
Ga0193044_1025260413300019010MarineMSKGVYSDLSSSFLAHSSDINDLLEGLDGVLEDWLNRLHDTESSLHIVNLRLHALDGLHLSGDLNEWLSVIESLEDSSGKGLLDVLDGSGLGNSGITITSGLGSLGGGELGGKLSEELIFSHEVIGVGGNGGDKGEEFHVKSFNYFPH
Ga0193044_1027800213300019010MarineVNNWSRRRCSFLAHSSDINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSVIESLEDSSGKGLLDVLDGSGLGNGGITISSGLGSLSRDEGGAELGKEFILTHEVVLVGRDGGDKSGG
Ga0193044_1028031013300019010MarineMYRAGSKLTNMMAYLKPSSCSFLAHSSDINDLLEGLDGVLENWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSVIESLEDSSGKGLLDVLDGSGLGNGGITISSGLGSLSRDEGGAELGKEFILTHEVVLVGRDGGDKSGG
Ga0193043_1031789213300019012MarineLEGLDGVLENWLDGLHDTESSLHIVDLWLHTFDGLHLSSDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNGGVTISSGLAGESGGEVGLEVDEEFVFVHGLELVGRDGSKGGDSEEFHV
Ga0193043_1032461413300019012MarineMNHFREESNYNISHDEVSSTSISFLAHSSDINDLLEGLDGVLENWLDGLHDTESSLHIVDLWLHTFDGLHLSSDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNGGVTISSGLAGESGGEVGLEVDEEFVFVHGLELVGRDGSKGGDSEEFHV
Ga0192982_1027876013300019021MarineMNHFREESNYNISHDEVSSTSISFLAHSSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVNLWLHAFDGLHLSGDLNEWLSIIESLEDSGGEGFLDVLDGSGLGNGGITITSGLGLLGGDEGGLEVDEEFVFSHGVVLGGGDGGDKGEEFHLLKSFVYYYPH
Ga0193561_1032499413300019023MarineVHDWRSAGSSSFLTHTSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSGGKSFLDVLDGSGLGNGGVTISSGLAGESGGEVGLEVDEEFVFVHGLELVGRDGSKGGDSEEF
Ga0193545_1011516113300019025MarineVVQAWSSWCSFLAHASDIDDLLEGLDGVLKDWLDGLHDTESSLHIVDLWLHALNGLHLSGNFNEGLSVIESLKDSSGQGFLDVLDSGGLGNGGISVSHGLGSLGRDEGGRELREELVLTHEVVLVGSNGGDESEFHFSVLI
Ga0192909_1018099123300019027MarineLRGSSFLAHSSDIDDLLEGLDGVLKDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNKGLSIIESLEDSSGQRFLDVLDGGGLGNGGITISSGLGHLGAGEVGSELGEELIIGHMVVSVSSDGGDQGEFHGK
Ga0192945_1023133113300019036MarineLVYGWLSPGGSSLLSHSSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHAFDGLHLSGNFNEWLSIIESLEDSSGKCFLDVLNSGGLGNGGVSITSGLRLLGVSESDLELGKELVLVHVVESVGGGDGGESNEFHLKVYLLFSPC
Ga0193123_1029411013300019039MarineVSCSFLSHTSDIDNLLEGLDGVLEDWFDGLHDTESSFHIVDLWLHAFDGLHLSGNFDEWLSVIESLEDSSSEGFLDVLDGSGLGNSGISVTSGLGSESGGEGAGERSKELVLVHVVELGGRDGGNECGGGEFHLFL
Ga0193123_1037686013300019039MarineMGVHTNSLCILIHLEAFRSRCSFLTHSSDIDDLLEGLDGVLEDWLNGLHDTESSLHIVDLWLHSLDGLHLSGDLNKWLSIIKSLEDSGSEGFLDVLDGSGLGNSGVTITSGLGSLGGGELGGELSEEFIFSHEVIGVGGDGGDESEVFHFVI
Ga0192998_1023095113300019043MarineFKVNLKYKSRPAKGNDINYHINIWGVQTSLILFYDSVKELDSWCSFLAHASNINDLLEGLDCVLEDWLNRLHDTKSSLHIVDLWLHSLDGLHLSGDLNEWLSIIESLEDSGSECLLDVLDGGGLGNGGIGITLGLAVECAGEVALKVNEELVFVHLFELVGGDGGDKCEVFHL
Ga0193336_1046964213300019045MarineMLVTLESVRRSLLSHTSNVNDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGNFNEWLSIIESLEDSGGKGFLDVLDGGGLGNSGVSITSGLGLLGVSEGDLELGEELVLVHVVESVGGGNGGESNEFHLKSFIYYFSPC
Ga0193336_1056643613300019045MarineMFNEIIPDLSSSFLSHSSDINDLLEGLDGVFKDWLDRLHDSESSLHIIDLWLHSLDGLHLSCDLNEWLSIIKSLQDSSSKGLLDVLNCGGLGNGGISISSRFGLHGGVQVGGELNQKLVFIHVLEFRGLNGGGSDNNSS
Ga0193336_1062028023300019045MarineVDSGELKGLGRSFLAHASDVDDLLEGLDGVLQDWLDGLHDTESSLHVVDLWLHALDGLHLSGDLNKGLSIVESLEDSGGKGLLDVLNGSGLSNGGISVTSGLGLESGREGRGEVDEELIFVHVVVLGGSDGGDKGEFHC
Ga0192981_1027959023300019048MarineVQAQWSTPLQSLRMTSGSCSFLAHTSDIDDLLEGLDGVLEDWLNGLHDTESSLHIVDLWLHTFDGLHLSGDLDEWLSVIKSLEDSSGKGLLDVLNGSGLGNSGVTITSGLAGESGGEGGLEVDEELVFVHGLELVGRDGSNGGDGKEFHVDFVKFNFPM
Ga0192831_10329513300019065MarineMYRAGSKLTNMMAFLKPSSCSFLAHSSDINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSIIKSLKDSSGKSLLDVLDGSSLGNGGVTISSGLGSLGRVEGGLEVDEELVFGHGVVLGGGNG
Ga0192831_10336213300019065MarineMNHFREESDCNINHDGVASGGSSFLAHSSDINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSIIKSLKDSSGKSLLDVLDGSSLGNGGVTISSGLGSLGRVEGGLEVDEELVFGHGVVLGGGNG
Ga0192831_10349113300019065MarineMNNYSLGWIRRRRSWCSFLSHSSDINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSIIKSLKDSSGKSLLDVLDGSSLGNGGVTISSGLGSLGRVEGGLEVDEELVFGHGVVLGGGNG
Ga0193153_102569513300019097MarineMSNCSFLSHSSNINDLLEGLDGVLEDWLNGLHDTESSLHIVDLWLHSLDGLHLSGDLNEWLSIIESLEDSGGKSLLDVLDGSGLGNSGVSISSGLGHLGGLEGGSELGEELVLSHEVVGVGRNGSKSDGEEFHC
Ga0194243_100719913300019102MarineMGISFLAHASDINDLLEGLDGVLENGLDGLHDTESSLHIVDLGLHALDGLHLSGDLNEGLSVIESLEDSSGESLLDVLDGSGLGNSGIRVTSGLGGESRREGGLEVDKEVIFVHGVVSVGSNNGEDSSELHCNFNYSPC
Ga0192946_104901623300019103MarineVRSSLLSHTSNVNDLLEGLDGVFKDWLDRLHDTKSSFHIVNLWLHTFDGFHLSSNFNEWLSIIESLKNSSGKGFLDVLNGGGLGNSGVSITSGLRLLGVLEGNLELGKELVLVHVGRKCWRRRRRR
Ga0192946_106649313300019103MarineMCCSYIGSSLLSHTSNINDLLEGLDGVLKDWLDRLHDTESSLHIVNLWLHAFDGLHLSGDLNEWLSIIESLEDSGGEGFLDVLDGSGLGNGGVSISSGLGSLSRDEGGGKLGEEFIFTHEVVLVGRDGGDKSGG
Ga0193106_103801713300019112MarineMQRLVVNVDELEGSLRISFLAHATDIDDLLEGLDGVLEDGLDRLHDTKSALHVVDLGLHALDGLHLSGNLDEGLTVIKSLEDSGGEGLLDVLDGSGLGNSGIRVTSGLGGESRREGGLEVDKEVIFVHGIVSVGSNGGEDSSELHCNFNYSPC
Ga0193054_105590113300019117MarineMFNSGGCSFLSHSSDINDLLEGLDGVLEDWLNGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSGGKSFLDVLDGSGLGNSGISITSHLGHLGGLKGGGELGKELILVHDLVVNSGDGGNKSGGGEEFHGKSVKINYLFPM
Ga0193157_103192713300019118MarineLPSARSLESKIDSRSCSFLTHTSDINDLLEGLDGILKDWLDGLHDTESSLHIVDLWLHAFDGLHLSGNFDEWLSIIKSLEDSSGKSFLDILDCGGFSNSSITISSSFRVESRVKSALEVNKEVIFSHEIVHVG
Ga0193436_105759913300019129MarineLINLNEHGSSLSISFLAHATDIDDLLEGLDGVLEDGLDRLHDTESALHVVDLGLHALDGLHLPGDLDEGLSVIESLEDSGGESLLDVLDGSGLSNSGVTITSGLGSLGGREGRLEVDEEIIFSHGVVLVGRVGGNECEEFHFLIIYFPM
Ga0193436_105777113300019129MarineLINLNEHGSSLSISFLAHATDIDDLLEGLDGVLEDGLDRLHDTESALHVVDLGLHALDGLHLPGDLDEGLSVIESLEDSGGESLLDVLDGSGLSNSGVTITSGLGSLGGREGRLEVDEEIIFSHGVVLVGRDGGNEGEEFHLLIFIFPC
Ga0193047_108396313300019139MarineLEGLDGVLEDGFDGLHDTESSFHIVDLWLHAFDGLHLSGDLNKGLSVIESLEDSSGKGLLDVLDGSGLGNGGIRVTSSLGGESGREGGLEVDKEVIFVHGIVSVGSSNGEDSSELH
Ga0193047_111100713300019139MarineMQSVVNIDELEGSLRISFLAHASDINDLLEGLDGVLKDGLDGLHDTESSLHIVDLGLHALDGLHLSGDLNKGLSVIESLEDSSGKGLLDVLDGSGLGNGGIRVTSSLGGESGREGGLEVDKEVIFVHGIVSVGSSNGEDSSELH
Ga0193047_112304413300019139MarineMNHFREESNYNISHDEVSSTSISFLAHSSDINDLLEGLDGVLENWLDGLHDTESALHIVDLGLHALDGLHLSGNLDEGLTVIKSLEDSGGEGLLDVLDGSGLGNGGIRVTSSLGGESGREGGLEVDKEVIFVHGIVSVGSSNGEDSSELH
Ga0193364_1013072613300019141MarineMQRLVVNVDELEGSLRISFLAHAADIDDLLEGLDGVLEDGLDRLHDTKSALHIVDLGLHALDGLHLPGDLDEGLSVIESLEDSGGEGLLDVLDGSGLGNGGVRVTSSLGSLGGVKGGGELSEELVFVHGLEVNSGSNSKNSGE
Ga0194244_1007898013300019150MarineMGISFLAHASDINDLLEGLDGVLENGLDGLHDTESSLHIVDLGLHALDGLHLSGDLNEGLSVIESLEDSSGESLLDVLDGSGLGNSGIRVTSGLGGESGREGGLEVDKEVIFVHGVVSVGSNGGEDSSELHCNFNYSPC
Ga0182073_105045213300019274Salt MarshMVSFLAHSSDVNDLLEGLDGVLKDWLDRLHNSESSLHIVDLWLHALDGLHLSGNLNKWLSIIESLEDSSSEGLLDVLDSSGLGNSGVSISSGFAHLGGGKVGGELSEEFIIGHVVVFVGSDGGDESKGEFHRKKF
Ga0182058_112747413300019283Salt MarshMTSGMCSFLAHASDVNDLLEGLDGVFENWLDGLHDTESSLHIVDLWLHAFDGLHLSGDLNKWLSVIESLEDSGGQGLLDVLNGSGLGNSSVTITSGLGSLSGGEGGSELSEEFIFVH
Ga0181562_1061495413300019459Salt MarshLEGLDGVLKDWLDGLHDSESSLHIIDLWLHSLDSLHLSGNLDEWLSVIKSLEDSCGEGFLDVLDGSGLGNGGISISLGLGSEGGLKVGVEGNKELILVHVAELSSRSDGDKSEVFHFCFLKIIINRKNGVLGFWGFG
Ga0208358_105685613300020555FreshwaterMLKKFSLLSHSTDINDLLEGLDGVLEDGLDGLHDTESSLHIVNLWLHSFDGFHLSGNFNEWLSIIESLEDSGSEGFLDVLDGSGLGDGGISITARFRGESRVEGRLKVNEEFIFVHGFVHVGVGSSEECGGGEFHFKVNNLL
Ga0206126_1024690813300020595SeawaterVTRKQVIDCSFFTHSSDINDFLEGLDGILENWLNRLHDTESSLHIVNLWLHAFNGLHFSGNLNKWLSIIESLEDSSGKRFLDVFDSSGLGNGGITISSGLRFLSGAEVGCKLGQKLVLVHVFEGDGLGSGDKSAGGEFHFKIIFFNYNIYHLQII
Ga0206691_175497413300021342SeawaterMYSFLAHSSDINDLLEGLDGVLEDWLYGLHDTESSFHIVDLWLHAFNGLHLSGDLNKWLSIIESLQDSSSKGFLDVLNGSGLSNGGVTITSGFGHLSGGEIACELGKELIIRHMVVSVGGNGGNEECEFHWV
Ga0206688_1081540713300021345SeawaterMRSFLAHSSDIDDLLEGLDGVLEDWLNGLHDTESSLHIVDLWLHALDGLHFSGDLNEWLSIIESLEDSGGKGFLDVFDGSSLGNSGISVTSGLGSESGGEGAGEGSKELVLVHVIELGGRDGGNECGGGEFH
Ga0206693_133949613300021353SeawaterLEGLDGVLKDWLDGLHDSESSFHVVDLWLHAFDGLHLSGDLDEWLSIIKSLEDSGSQGFLDVLNGGGLSNGGVTVTSGLGSLGRLEGGGELCKELVFVHVIKIKSGGGSDECKGSEFH
Ga0206693_195051513300021353SeawaterMRLWKRSFLTHSSNIDNLLEGLDGVLEDWLNGLHYTESSFHIIDLWLHSFDGLHLSGNFNEWLSVIKSLQDSGSESFLDVFNGSGLGNGGVSISSGFGCESRVKGALEVDKEIIFSHEVVHVS
Ga0213865_1043582013300021373SeawaterMESRVSFLSHSSDINDLLEGLDGVLEDWLNRLHDSESSLHIVDLWLHSLDGLHLSGNFDEWLSIIESLEDSSGKGFLDVLDGSGLGNSGISVTSGLGLESGGEGVGEGDEEFIFGHVVVFGG
Ga0063133_100376313300021912MarineMSDQLSHHVRLVGVRWCSFLSHTSDINDLLEGLDGVLEDWLNGLHDTKSSLHIVDLWLHTLNGLHLSSDLDEWLSIIKSLEDSGGESLLDVLNGGGLGNGGISITSGLAGEGRVEVGLEGDKEIILVHGLELVGRDNGDKGDGEFHFKN
Ga0063133_100819013300021912MarineMLVGSAVTKSRDSWCSFLAHTSDINDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHTLDGLHLSGNLDEWLSIIESLEDSGGEGLLDVLDGGGLGNGGISITSGLAGESRVEVGLEGDEEVIFVHGLELVGGNDGDESGVFHFKEL
Ga0063104_100219013300021913MarineMKYQIYKSVVGSGRWSSLGNISFLTHSSDVNDLLEGLDGVLEDWLDRLHDTESSLHIVDLWLHAFDGLHLSGNFDEWLSVIKSLEDSGSKGFLDVFDGSGLGNGGVSISSGLGHLSGGKVGSELGKELILGHEVVLVGSNGGDKGAGEFH
Ga0063091_104590213300021923MarineVNIKVNWSQSDLRISFLSHSSDINDLLEGLDGVLENWLDGLHDTESSLHIVDLWLHTFDGLHLSGDLNKWLSIIESLKDSSGKSFLDVLDGSGLSNGGITITSGLGSLGGGELGGELSEEFIFSHEVIGVGGDGGDESEEF
Ga0063134_101848013300021928MarineMSDQLSHVVSVVRVRWCSFLSHTSDINDLLEGLDGVLEDWLNRLHDTESSLHIIDLWLHTLNGLHLSGNLDEWLSIIKSLKDSGGEGLLDVLDGSGLGNGGIGITSGLAGEGRVEVGLEGDKEVILVHGLELVGRDSGDKSDGEFHFKELSL
Ga0063101_103704313300021950MarineVTRKRVIDCSFFTHSSDINDFLEGLDGILENWLNRLHDTESSLHIVNLWLHAFNGLHFSGNLNKWLSIIESLEDSSGKRFLDVFDSSGLGNGGITISSGLRFLSGAEVGCKLGQKLVLVHVFEGDGLGSGDKSAGGEFHFK
Ga0210292_11435313300022353EstuarineVCSLLAHSSDINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLDEWLSIIKSLEDSSGKSLLDVLDGSGLGNGGITITSGLGLLGGGEGRSELSKELILSHGVVLGGGGDGDNLVCASVSCIASEVAVPSVGATR
Ga0255756_129128023300022905Salt MarshMFSFLAHSSNINDLLEGLDGVLKDWLDGLHDSESSLHIIDLWLHSLDSLHLSGNLDEWLSVIKSLEDSCGEGFLDVLDGSGLGNGGISISLGLGSEGGLKVGVEGNKELILVHVAELSSRSDGDKSEVFHFCFLKIIINRKNGVLGFW
Ga0255781_1045599423300022934Salt MarshMFSFLAHSSNINDLLEGLDGVLKDWLDGLHDSESSLHIIDLWLHSLDSLHLSGNLDEWLSVIKSLEDSCGEGFLDVLDGSGLGNGGISISLGLGSEGGLKVGVEGNKELILVHVAELSSRSDGDKSEVFHFCFLKIIINRKNGGFGVLG
Ga0228681_103520413300023683SeawaterVVHYACRIGVQVVRRLSWCSFLAHTSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGNLDEWLSVIKSLEDSGGEGLLDVLDGSGLGNGGIGITSGLAGESGVEVGLEGNEEVVFVHGLELVGGHNGDKSGGEFHF
Ga0228658_117209313300024297SeawaterDDLLEGLDGVLEDWLNGLHDTESSLHIVDLWLHAFDGFHLSGDLNEWLSVIESLEDSSGEGFLDVLDGSGLGNGGITISSGLGSLSRDEGGAELGKEFILTHEVVLVGRDGGDKSGGGEFHF
Ga0233398_112304413300024320SeawaterMISFLSHSSDIDDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSIIESLEDSGGEGFLDVLDGSGLGNGGITISSGLGSLSRDEGGAELGKEFILTHEVVLVGRDGGDKSGGGEFHF
Ga0228626_110315213300024321SeawaterLEGLDGVLEDWLNRLHDTESSLHIVDLWLHAFDGLHLSGDFNEWLSIIESLEDSGGEGFLDVLDGSGLGNGGITISSGLGVESGRKGGGEVDEEFIFVHV
Ga0209198_111085613300025640Pelagic MarineMNNDSLICLRGWRGRCSFLSHSSDINDLLEGLDGVLKDWLDRLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSVIESLEDSGSKGFLDVLDGSGLGNGGVSISSGLGHLSGGKVRGELGKELILGHEVVLVGGNGGDKGAGEFHL
Ga0209193_111319813300025816Pelagic MarineMKCQIYKSVVGSGRWSSLGNISFLSHSSDVNDLLEGLDGVLEDWLDRLHDTESSLHIVDLWLHAFDGLHLSGNFDEWLSIIKSLEDSGSKGFLDVLDGSGLGNGGITISSGLGHLSGGKVGGELGKELILGHEVVLVGSNGGDKGAGEFHL
Ga0209630_1040475813300025892Pelagic MarineMKNQIYKSVVGSGRWSSLGNISFLSHSSDVNDLLEGLDGVLEDWLDRLHDTESSLHIVDLWLHAFDGLHLSGNFDEWLSIIKSLEDSGSKGFLDVLDGSGLGNGGITISSGLGHLSGGKVGGELGKELILGHEVVLVGSNGGDKGAGEFHL
Ga0209425_1050984613300025897Pelagic MarineMRSFLAHSSDINDLLEGLDGVLKNWLDRLHDSESSLHIVNLWLHALNGLHLSGNLNEWLSIIKSLENSSGQRFLDVLDGSGLGNGGISISLGLGSKSGLEVGAEGNEELVFVHLVKFGSGSGGDKSDGEFHFYYKLITRARGFGVLG
Ga0247559_112677013300026443SeawaterVTRRRIINCSFLSHSSDINDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSIIESLEDSGGEGFLDVLDGSGLGNGGITISSGLGVESGRKGGGEVDEEFIFVHVLVSVGGDGGDKGKGEFH
Ga0247571_113534513300026495SeawaterLEGLDGVLEDWLDRLHDTESSLHIVDLWLHAFDGFHLSGDLNEWLSVIESLEDSSGEGFLDVLDGSGLGNGGITISSGLGSLSRDEGGAELGKEFILTHEVVLVGRDGGDKSGGGEFLKI
Ga0247571_113589413300026495SeawaterLEGLDGVLKNWLDGLHDTKSSLHIVDLWLHSLDGLHFSGNLNKWLSIIKSLKDSSGEGFLDVLDSSSLVNGGIVVTLRLGGHGGVEVGGELGEELFFVHLGELGGGSSGDKGKEF
Ga0208025_107411213300027225EstuarineLKSRRSSLLAHSSDINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSVIESLEDSSGKGLLDVLDGSGLGNGGITITSGLGLLGGGEGRSELSKELILSHGVVLGGGGDGDKGEEFHLLI
Ga0208796_107691423300027308EstuarineMVSFLSHSSDINDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHAFDGLHLSGDLNKWLSIIESLEDSGGEGFLDVLDGSGLGNGGITISSGLGVESGRKGGGEVDEEFIFVHVLVSVGSDGGDKGTGEFHL
Ga0208796_112574813300027308EstuarineDLLEGLDGVLEDWLDRLHDTESSLHIVDLWLHAFDGFHLSGDLNEWLTVIESLEDSSGEGFLDVLDGSGLGNGGITISSGLGSLSGDEGGAELGKELILTHEVVLVGSNGGDKSDGEFHF
Ga0209815_126011313300027714MarineLECSFLTHTSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNGGVSISSGLGLLGRFDGGAELSKELVFSHEVEGVGRDGSNGGDGEEFHL
Ga0209192_1032468613300027752MarineDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNGGVTISSGLAGESGGEVGLEVDEEFVFVHGLELVGRDGSKGGDSEEFHVDFVKFNY
Ga0209092_1056860013300027833MarineISHDEVSSTSISFLAHSSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVNLWLHALDGLHLSGDLNEWLSVIESLEDSSGEGFLDVFDGSGLGNGGVSISSGFGSLSRDEGGGELGEEFILTHEVVLVGRDGGDKSDGEFHF
Ga0247561_11857213300028119SeawaterLEGLDGVLEDWLNGLHDTESSLHIVDLWLHAFDGFHLSSNFNEWLSIIESLEDSGGKGFLDVLDSGGLGNGGVSVSHGLGSLGRDEGGRELREELVLTHEV
Ga0256412_129160513300028137SeawaterMESAGAGRVSFLTHSSNVNDLLEGLDGVLKNWLDGLHDTKSSLHIVDLWLHSLDGLHFSGNLNKWLSIIKSLKDSSGQGFLDVLDSGGLGNGGIVVTLRLGGHGGVEVGGELGEELFFVHLGELGGGSSGDKGKEF
Ga0256412_136334113300028137SeawaterVIQGSSNGLCCSFLAHSSDIDDLLEGLDGVLEDWLDRLHDTESSLHIVDLWLHAFDGFHLSGDLNEWLSVIESLEDSSGEGFLDVLDGSGLGNGGITISSGLGSLSRDEGGAELGKEFILTHEVVLVGRDGGDKSGG
Ga0256413_129128313300028282SeawaterVSCSFLSHTSDIDNLLEGLDGVLEDWFDGLHDTKSSFHIVDLWLHAFDGLHLSGNFDEWLSVIESLQDSGGKGLLDVLDGSGLGNSGVTITSGLGSLGRGELGGELSEELIFSHEVVGVGGNGG
Ga0247597_104218713300028334SeawaterLEGLDGVLKNWLDGLHDTESSLHIVDLWLHAFNSLHLSGDFNEWLSIIESLEDSSGKGFLDVLDGSGLGNGGVVITLRLGGHGGVEVGGELDEEFVFVHLGELEGRDGGDGGEGEEF
Ga0247566_107803013300028335SeawaterLEGLDGVLEDWLDGLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSIIKSLEDSGGKSFLDVLDGSGLGNGGVSITSGFGLLSGSEGNLELSKELVLTHVVVGVGGGGGDEE
Ga0307401_1022550723300030670MarineLEGLDGVLKDWLDGLHDTESSLHIVDLWLHTFDGLHLSGDFNEWLSIIKSLEDSSGKGFLDVLDGSGLGNGGITISSGFGHLGGREGGLEVDEEFVFSHGVVLGGGNGVRPLVSHHPARKHLARA
Ga0308139_105486613300030720MarineMNNDSLICLRGWRGRCSFLSHSSDINDLLEGLNGVLEDWLNRLHDTESSLHIVDLWLHAFDGLHLSGDFNEWLSVIESLEDSSGKGFLDVLDGSGLGNGGITITSGLGLLGGDEGGLEVDEEFIFSHGVVLGGGDGGDKGEEFHLL
Ga0308138_104859613300030724MarineMLVVAEERSFLSHTSDINDLLEGLDGVLEDWLDGLHDTESSFHIVDLWLHAFDGLHLSGDFNEWLSIIESLEDSGGKSFLDVLDGGGLGNGGITVSSGLGLLGRSESNLELGKELVFSHSIESVSSGGGGEKSEFH
Ga0308138_105209513300030724MarineMWRLRGRRSWCSFLSHSSDIDDLLEGLDGVLEDWLNRLHDTKSSFHIVDLWLHAFDGLHLSGDLNEWLSVIESLEDSGGKGLLDVLDGGGLGNSGVSITSGLRLLGSSEGDLELSKELVFSHLVESIGGDGGGESEEF
Ga0308136_113480813300030728MarineMNHFREESNYNISHDEVSSTSISFLAHSSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSVIESLEDSSGKGLLDVLDGSGLGNGGITISSGLGSLGGVEGGLEVDEELVFGHGVVLG
Ga0073988_1002232713300030780MarineLSDRLSLEVKRTSWCSFLAHTSDIDDLLEGLDGVLEDWLNGLHDTKSSLHIVDLWLHTLDGLHLSGNLDEWLSVIESLEDSGSEGLLDVLDGSGLGNGGVGITSGLAGESRVEVGLEGDEEVIFVHGLELVGGDNGDKSGGEFHFKELSL
Ga0073980_1000999413300031032MarineLESGWCSFLSHTSDINDLLEGLDGVLEDWLNGLHDTKSSLHIVDLWLHTLDGLHLSSDLDEWLSIIKSLEDSGGESLLDVLNGSGLGNGGIGITSGLAGEGRVEVGLEGDKEVILVHGLELV
Ga0308130_105920313300031496MarineMCSLLSHTSDVNDLLEGLDGVLEDWLNRLHDTESSLHIVDLWLHAFDGLHLSGDFNEWLSVIESLEDSSGKGFLDVLDGSGLGNGGITITSGLGLLGGDEGGLEVDEEFIFSHGVVLGGGDGGDKGEEFHLL
Ga0307388_1121359713300031522MarineMGTSLLAHTSDIDDLLEGLDGVFENWFYGLHNTKSSLHIVNLWLHSFDGFHFSSNFNEWLSIIESLEDSSGKCFLDVLNSGGLGNSGVSITSGLRLLGVSESDLELGKELVLVHVVESVGDGDGGESSEFHLKVY
Ga0308134_112012813300031579MarineLEGLDGVLENWLDGLHDTESSLHIVDLWLHAFDGLHLSGDLNEWLSIIESLEDSSGKGFLDVLDGSGLGNGGVVITLRLGGHGGVEVGGELDEEFVFVHLGELEGRDGGDGGEGEE
Ga0302126_1015868713300031622MarineVHDWRSAGSSSFLTHTSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNGGVTISSGLAGESGGEVGLEVDEEFVFVHGLELVGRDGSKGGDSEEFHVDFVKFNY
Ga0302126_1023191023300031622MarineTKVISRRSFLSHASDVNDLLEGFDGVLKDWLDRLHNTKSSLHVVNLWLHALDSFHLSGDLNKRLSIVKSLQDSGGQGFLDVLDGGGLGNGSVSISSGLGSLCGRESVSKLGEELIIELNINGITDFIDA
Ga0307389_1104815813300031750MarineMTQGLESSQWVYMFIMESGYSFLSHSSDIDDLLEGLDGVLEDWLNRLHDSESSFHIVDLWLHSFDGLYLSGNFDEWLSIIKSLEDSSGQGFLDVLDGSGLGNGGISISSGLGLESGGEGVGERDEELIFGHMVVLGGSDGGDKAEGEFHFES
Ga0307389_1122276713300031750MarineMGTSLLAHTSNIDDLLEGLDGVLEYWFYGLHNTKSSLHIVNLWLHSFDGFHFSSNFNEWLSIIESLEDSSGKCFLDVLNSGGLGNSGVSITSGLRLLGVSESDLELGKELVLVHVVESVSDGDGGESSEFHL
Ga0315326_1030344513300031775SeawaterVYSLLSHSSDIDDLLEGLDGVLKDWLDGLHDTESSLHIVNLWLHSLDGLHLSGNLDEWLSVIESLEDSSGKSLLDVLDGGGLGNSSVSITSGLAHLGGGEGGLELREEVILTHEVVGVGRDGSNKCGGEFHL
Ga0314670_1047587713300032470SeawaterLEGLDGVLENWLNRLHDTESSLHIVDLWLHAFNGLHLSGDLNEWLSIIESLEDSSGKGFLDVLDGSGLGNGGVVITLRLGGHGGVEVGGELDEEFVFVHLGELEGRDGGDGGEGEEFHDK
Ga0314668_1040173923300032481SeawaterLEGLDGVLENWLNRLHDTESSLHIVDLWLHAFNGLHLSGDLNKWLSIIESLEDSSGKGFLDVLDGSGLGNGGVVITLRLGGHGGVEVGGELDEEFVFVHLGELEGRDGGDGGEGEEFH
Ga0314676_1073543713300032519SeawaterLEGLDGVLENWLNRLHDTESSLHIVDLWLHAFNGLHLSGDLNEWLSIIESLEDSSGKGFLDVLDGSGLGNGGVVITLRLGGHGGVEVGGELDEEFVFVHLGELEGRDGGDGGEGEEFHD
Ga0314683_1074973613300032617SeawaterLEGLDGVLENWLDGLHDTESSLHIVDLWLHAFNGLHLSGDLNEWLSIIESLEDSSGKGFLDVLDGSGLGNGGVVITLRLGGHGGVEVGGELDEEFVFVHLGELEGRDGGDGGEGEEFHDK
Ga0314678_1037359623300032666SeawaterLEGLDGVLEDWLNRLHDTESSLHIVDLWLHTFDGLHLSGDLNKWLSIIESLEDSSGKSFLDVLDGSGFSNGGITITSGFGSLGGGELGGELGEEFIFS
Ga0314687_1065048323300032707SeawaterLEGLDGVLEDWLDGLHDTESSLHIVDLWLHAFDGLHLSGDFNEWLSVIESLEDSSGKGFLDVLDGSGLGNGGITISSGLGLLGGDEGGLEVDEEFIFSHGVVLGGGDGGAEN
Ga0314669_1026788323300032708SeawaterLEGLDGVLENWLNRLHDTESSLHIVDLWLHAFNGLHLSGDLNEWLSIIESLEDSSGKGFLDVLDGSGLGNGGVVITLRLGGHGGVEVGGELDEEFVFVHLGELEGRDGQRLTMHIHCQNKAHPSSV
Ga0314681_1057235513300032711SeawaterLEGLDGVLENWLNRLHDTESSLHIVDLWLHAFDGLHLSGDLNKWLSIIESLEDSSGKGFLDVLDGSGLGNGGVVITLRLGGHGGVEVGGELDEEFVFVHLGELEGRDGGDGGEGEEFHDK
Ga0314702_133926623300032725SeawaterVLEDWLDGLHDTESSLHIVDLWLHAFDGLHLSGDFNEWLSVIESLEDSSGKGFLDVLDGSGLGNGGITISSGLGLLGGDEGGLEVDEEFIFSHGVVLGGGARFFSS
Ga0314697_1042507613300032729SeawaterLEGLDGVLENWLNRLHDTESSLHIVDLWLHAFNGLHLSGDLNKWLSIIESLEDSSGKGFLDVLDGSGLGNGGVVITLRLGGHGGVEVGGELDEEFVFVHLGELEGRDGGDGGEGEEFHDK
Ga0314711_1043852013300032732SeawaterLEGLDGVFKNWLDGLHDTESSLHIVDLWLHTLDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNGGVTISSGLAGESGGEVGLEVDEEFVFVHGLELVGRDGSKGGDSEEFHVDFVKF
Ga0314711_1062721413300032732SeawaterLEGLDGVLKNWLNRLHDTESSLHIVDLWLHAFNGLHLSGDLNKWLSIIESLEDSSGKGFLDVLDGSGLGNGGVVITLRLGGHGGVEVGGELDEEFVFVHLGELEGRDGGDGGEGEEFHDK
Ga0314707_1044201413300032743SeawaterMNHFREESNYNISHDEVSSTSISFLAHSSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVNLWLHALDGLHLSGDLNEWLSVIESLEDSSGKSFLDVLDGSGLGNGGVSISSGLGLLGGFDGGAELSKKLVFSHEVEGVGRDG
Ga0314701_1045947913300032746SeawaterLEGLDGVLEDWLDGLHDTESSLHIVNLWLHALDGLHLSGDLNEWLSVIESLEDSSGEGFLDVFDGSGLGNGGVSISSGFGSLSRDEGGGELGEEFILTHEVVLVGRDGGDKSDGEFALAGTLKPRPMLLT
Ga0314712_1047854413300032747SeawaterLEGLDGVLENWLNRLHDTESSLHIVDLWLHAFNGLHLSGDLNEWLSIIESLEDSSGKGFLDVLDGSGLGNGGVVITLRLGGHGGVEVGGELDEEFVFVHLGELEGRDGGDGGEGEEF
Ga0314712_1048853213300032747SeawaterMNHFREESDCKINHDGVASGGSSFLAHSSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVNLWLHALDGLHLSGDLNEWLSVIESLEDSSGEGFLDVFDGSGLGNGGVSISSGFGSLSRDEGGGELGEEFILTHEVVLVGRDGGDKSDGEFHF
Ga0314708_1019640213300032750SeawaterMNHFREESDCKINHDGVASGGSSFLAHSSDIDDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLAGDLDEGLAVIESLEDAGGESLLDVLDGGGLGNGGIGVTAGLGALSRLEGGLQGDKELVLVHTLVDLDLK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.