Basic Information | |
---|---|
Family ID | F010197 |
Family Type | Metagenome |
Number of Sequences | 307 |
Average Sequence Length | 41 residues |
Representative Sequence | LNLFLLPNTTHELKAFTIKHDFAQHMKKILSRQDGIFFF |
Number of Associated Samples | 157 |
Number of Associated Scaffolds | 307 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.96 % |
% of genes near scaffold ends (potentially truncated) | 84.69 % |
% of genes from short scaffolds (< 2000 bps) | 85.02 % |
Associated GOLD sequencing projects | 140 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (60.912 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (30.293 % of family members) |
Environment Ontology (ENVO) | Unclassified (76.221 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (74.593 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.81% β-sheet: 0.00% Coil/Unstructured: 61.19% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 307 Family Scaffolds |
---|---|---|
PF09424 | YqeY | 56.03 |
PF01807 | zf-CHC2 | 14.01 |
PF00988 | CPSase_sm_chain | 9.45 |
PF13662 | Toprim_4 | 5.86 |
PF08275 | Toprim_N | 5.21 |
PF04546 | Sigma70_ner | 3.26 |
PF02786 | CPSase_L_D2 | 0.98 |
PF03979 | Sigma70_r1_1 | 0.65 |
PF00459 | Inositol_P | 0.33 |
PF13365 | Trypsin_2 | 0.33 |
PF13231 | PMT_2 | 0.33 |
PF02787 | CPSase_L_D3 | 0.33 |
PF01571 | GCV_T | 0.33 |
PF00535 | Glycos_transf_2 | 0.33 |
PF00850 | Hist_deacetyl | 0.33 |
PF00534 | Glycos_transf_1 | 0.33 |
PF00140 | Sigma70_r1_2 | 0.33 |
PF05690 | ThiG | 0.33 |
PF00196 | GerE | 0.33 |
PF02511 | Thy1 | 0.33 |
COG ID | Name | Functional Category | % Frequency in 307 Family Scaffolds |
---|---|---|---|
COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 19.22 |
COG0505 | Carbamoylphosphate synthase small subunit | Amino acid transport and metabolism [E] | 18.89 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 4.23 |
COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.65 |
COG0214 | Pyridoxal 5'-phosphate synthase subunit PdxS | Coenzyme transport and metabolism [H] | 0.33 |
COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.33 |
COG2022 | Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis) | Coenzyme transport and metabolism [H] | 0.33 |
COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.33 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 60.91 % |
Unclassified | root | N/A | 39.09 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000157|LPaug08P261000mDRAFT_c1011426 | Not Available | 1402 | Open in IMG/M |
3300000179|LPjun09P16500mDRAFT_c1045707 | Not Available | 576 | Open in IMG/M |
3300000181|LPjun08P4500mDRAFT_c1044376 | Not Available | 556 | Open in IMG/M |
3300000260|LP_A_09_P20_500DRAFT_1039916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
3300001010|JGI11983J13109_101341 | Not Available | 593 | Open in IMG/M |
3300001068|JGI12207J13218_1009709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 873 | Open in IMG/M |
3300001679|TahiMoana_1062457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1048 | Open in IMG/M |
3300001780|supr46_1005408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4793 | Open in IMG/M |
3300003702|PicMicro_10022809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4423 | Open in IMG/M |
3300005399|Ga0066860_10015179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3076 | Open in IMG/M |
3300005400|Ga0066867_10273283 | Not Available | 609 | Open in IMG/M |
3300005402|Ga0066855_10283865 | Not Available | 544 | Open in IMG/M |
3300005408|Ga0066848_10004478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 4422 | Open in IMG/M |
3300005408|Ga0066848_10098209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 797 | Open in IMG/M |
3300005422|Ga0066829_10014904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2507 | Open in IMG/M |
3300005425|Ga0066859_10069942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1062 | Open in IMG/M |
3300005426|Ga0066847_10134007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 768 | Open in IMG/M |
3300005428|Ga0066863_10010679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3797 | Open in IMG/M |
3300005429|Ga0066846_10185277 | Not Available | 697 | Open in IMG/M |
3300005430|Ga0066849_10270429 | Not Available | 653 | Open in IMG/M |
3300005431|Ga0066854_10007956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HIMB1321 | 3557 | Open in IMG/M |
3300005514|Ga0066866_10189803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 724 | Open in IMG/M |
3300005514|Ga0066866_10257781 | Not Available | 602 | Open in IMG/M |
3300005514|Ga0066866_10267209 | Not Available | 589 | Open in IMG/M |
3300005514|Ga0066866_10279449 | Not Available | 573 | Open in IMG/M |
3300005514|Ga0066866_10293726 | Not Available | 556 | Open in IMG/M |
3300005594|Ga0066839_10094554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1035 | Open in IMG/M |
3300005594|Ga0066839_10285631 | Not Available | 570 | Open in IMG/M |
3300005594|Ga0066839_10304730 | Not Available | 550 | Open in IMG/M |
3300005604|Ga0066852_10295398 | Not Available | 545 | Open in IMG/M |
3300005945|Ga0066381_10253324 | Not Available | 507 | Open in IMG/M |
3300005948|Ga0066380_10138287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 729 | Open in IMG/M |
3300005951|Ga0066379_10150966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 740 | Open in IMG/M |
3300005951|Ga0066379_10311576 | Not Available | 514 | Open in IMG/M |
3300005953|Ga0066383_10051203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1299 | Open in IMG/M |
3300005953|Ga0066383_10256622 | Not Available | 515 | Open in IMG/M |
3300006002|Ga0066368_10187402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 705 | Open in IMG/M |
3300006002|Ga0066368_10340907 | Not Available | 507 | Open in IMG/M |
3300006012|Ga0066374_10028059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1539 | Open in IMG/M |
3300006012|Ga0066374_10170461 | Not Available | 634 | Open in IMG/M |
3300006093|Ga0082019_1014377 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1541 | Open in IMG/M |
3300006166|Ga0066836_10058779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2191 | Open in IMG/M |
3300006166|Ga0066836_10063124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2113 | Open in IMG/M |
3300006166|Ga0066836_10125490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1500 | Open in IMG/M |
3300006166|Ga0066836_10277941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1002 | Open in IMG/M |
3300006166|Ga0066836_10361824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 872 | Open in IMG/M |
3300006166|Ga0066836_10372223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 859 | Open in IMG/M |
3300006166|Ga0066836_10376148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 855 | Open in IMG/M |
3300006166|Ga0066836_10588690 | Not Available | 673 | Open in IMG/M |
3300006166|Ga0066836_10604662 | Not Available | 664 | Open in IMG/M |
3300006166|Ga0066836_10689300 | Not Available | 618 | Open in IMG/M |
3300006166|Ga0066836_10737777 | Not Available | 596 | Open in IMG/M |
3300006308|Ga0068470_1362105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1892 | Open in IMG/M |
3300006308|Ga0068470_1868050 | Not Available | 549 | Open in IMG/M |
3300006309|Ga0068479_1297693 | Not Available | 558 | Open in IMG/M |
3300006310|Ga0068471_1493718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1699 | Open in IMG/M |
3300006313|Ga0068472_10215955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2633 | Open in IMG/M |
3300006313|Ga0068472_10333414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1902 | Open in IMG/M |
3300006313|Ga0068472_10351775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2406 | Open in IMG/M |
3300006313|Ga0068472_10421470 | Not Available | 766 | Open in IMG/M |
3300006313|Ga0068472_10557816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 786 | Open in IMG/M |
3300006313|Ga0068472_10767245 | Not Available | 664 | Open in IMG/M |
3300006316|Ga0068473_1520047 | Not Available | 592 | Open in IMG/M |
3300006323|Ga0068497_1335390 | Not Available | 1004 | Open in IMG/M |
3300006324|Ga0068476_1109276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1044 | Open in IMG/M |
3300006325|Ga0068501_1357182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
3300006325|Ga0068501_1379116 | Not Available | 651 | Open in IMG/M |
3300006331|Ga0068488_1506770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 781 | Open in IMG/M |
3300006335|Ga0068480_1789533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 834 | Open in IMG/M |
3300006338|Ga0068482_1366943 | Not Available | 550 | Open in IMG/M |
3300006338|Ga0068482_1472392 | Not Available | 584 | Open in IMG/M |
3300006339|Ga0068481_1359131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1870 | Open in IMG/M |
3300006340|Ga0068503_10785995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
3300006340|Ga0068503_10998989 | Not Available | 602 | Open in IMG/M |
3300006341|Ga0068493_10309814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 6328 | Open in IMG/M |
3300006341|Ga0068493_10457941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1788 | Open in IMG/M |
3300006341|Ga0068493_10503007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1010 | Open in IMG/M |
3300006341|Ga0068493_10549550 | Not Available | 1060 | Open in IMG/M |
3300006341|Ga0068493_10602443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 793 | Open in IMG/M |
3300006341|Ga0068493_11138165 | Not Available | 550 | Open in IMG/M |
3300006346|Ga0099696_1265763 | Not Available | 549 | Open in IMG/M |
3300006347|Ga0099697_1140926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 988 | Open in IMG/M |
3300006347|Ga0099697_1352576 | Not Available | 1060 | Open in IMG/M |
3300006347|Ga0099697_1488757 | Not Available | 1067 | Open in IMG/M |
3300006567|Ga0099958_1353145 | Not Available | 632 | Open in IMG/M |
3300006902|Ga0066372_10049502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2043 | Open in IMG/M |
3300006902|Ga0066372_10178221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1152 | Open in IMG/M |
3300006902|Ga0066372_10240536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1005 | Open in IMG/M |
3300006902|Ga0066372_10283089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 932 | Open in IMG/M |
3300006902|Ga0066372_10683746 | Not Available | 616 | Open in IMG/M |
3300006902|Ga0066372_10751851 | Not Available | 589 | Open in IMG/M |
3300006902|Ga0066372_10808597 | Not Available | 569 | Open in IMG/M |
3300007283|Ga0066366_10497681 | Not Available | 538 | Open in IMG/M |
3300007283|Ga0066366_10562903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
3300007301|Ga0079920_1012066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1025 | Open in IMG/M |
3300007504|Ga0104999_1088393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1247 | Open in IMG/M |
3300007508|Ga0105011_1073777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1423 | Open in IMG/M |
3300007509|Ga0105012_1073414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1512 | Open in IMG/M |
3300007514|Ga0105020_1002601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 22721 | Open in IMG/M |
3300007514|Ga0105020_1160974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1601 | Open in IMG/M |
3300007514|Ga0105020_1448965 | Not Available | 681 | Open in IMG/M |
3300007515|Ga0105021_1156797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1315 | Open in IMG/M |
3300007515|Ga0105021_1305568 | Not Available | 726 | Open in IMG/M |
3300008097|Ga0111541_10163921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 922 | Open in IMG/M |
3300008097|Ga0111541_10342691 | Not Available | 643 | Open in IMG/M |
3300008227|Ga0105358_10303617 | Not Available | 657 | Open in IMG/M |
3300008253|Ga0105349_10261754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 720 | Open in IMG/M |
3300008625|Ga0115653_1123372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1251 | Open in IMG/M |
3300008735|Ga0115657_1005455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 15250 | Open in IMG/M |
3300008735|Ga0115657_1021303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5749 | Open in IMG/M |
3300008735|Ga0115657_1149915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1312 | Open in IMG/M |
3300008740|Ga0115663_1112385 | Not Available | 698 | Open in IMG/M |
3300009103|Ga0117901_1036963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3410 | Open in IMG/M |
3300009104|Ga0117902_1053485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 4839 | Open in IMG/M |
3300009104|Ga0117902_1230001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1795 | Open in IMG/M |
3300009104|Ga0117902_1240315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1741 | Open in IMG/M |
3300009104|Ga0117902_1305098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1472 | Open in IMG/M |
3300009104|Ga0117902_1319310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1426 | Open in IMG/M |
3300009104|Ga0117902_1595674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 888 | Open in IMG/M |
3300009108|Ga0117920_1091606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1266 | Open in IMG/M |
3300009126|Ga0118723_1124012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1535 | Open in IMG/M |
3300009129|Ga0118728_1235717 | Not Available | 706 | Open in IMG/M |
3300009132|Ga0118730_1338593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 720 | Open in IMG/M |
3300009173|Ga0114996_10119033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2213 | Open in IMG/M |
3300009173|Ga0114996_10561126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 853 | Open in IMG/M |
3300009173|Ga0114996_10812999 | Not Available | 676 | Open in IMG/M |
3300009173|Ga0114996_10815864 | Not Available | 674 | Open in IMG/M |
3300009370|Ga0118716_1017011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 5847 | Open in IMG/M |
3300009370|Ga0118716_1126949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1291 | Open in IMG/M |
3300009376|Ga0118722_1010640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 10086 | Open in IMG/M |
3300009376|Ga0118722_1013665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8461 | Open in IMG/M |
3300009376|Ga0118722_1022642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 5890 | Open in IMG/M |
3300009376|Ga0118722_1063590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2783 | Open in IMG/M |
3300009376|Ga0118722_1184697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1289 | Open in IMG/M |
3300009376|Ga0118722_1201569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1212 | Open in IMG/M |
3300009376|Ga0118722_1314158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 857 | Open in IMG/M |
3300009409|Ga0114993_10008652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 9217 | Open in IMG/M |
3300009409|Ga0114993_10128253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1985 | Open in IMG/M |
3300009412|Ga0114903_1151065 | Not Available | 506 | Open in IMG/M |
3300009425|Ga0114997_10523311 | Not Available | 630 | Open in IMG/M |
3300009593|Ga0115011_10876049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 750 | Open in IMG/M |
3300009703|Ga0114933_10222990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1269 | Open in IMG/M |
3300009703|Ga0114933_10418933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 876 | Open in IMG/M |
3300009703|Ga0114933_10803292 | Not Available | 600 | Open in IMG/M |
3300009703|Ga0114933_10838404 | Not Available | 585 | Open in IMG/M |
3300009703|Ga0114933_10927636 | Not Available | 552 | Open in IMG/M |
3300009706|Ga0115002_10733036 | Not Available | 695 | Open in IMG/M |
3300009786|Ga0114999_10020284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 6700 | Open in IMG/M |
3300009786|Ga0114999_10229897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1523 | Open in IMG/M |
3300009786|Ga0114999_10273700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1368 | Open in IMG/M |
3300009786|Ga0114999_10336202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1205 | Open in IMG/M |
3300009786|Ga0114999_10976970 | Not Available | 614 | Open in IMG/M |
3300010883|Ga0133547_11558328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1237 | Open in IMG/M |
3300010883|Ga0133547_12090508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1033 | Open in IMG/M |
3300020249|Ga0211635_1061197 | Not Available | 605 | Open in IMG/M |
3300020254|Ga0211669_1017049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1077 | Open in IMG/M |
3300020262|Ga0211537_1048387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 785 | Open in IMG/M |
3300020275|Ga0211562_1027829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1340 | Open in IMG/M |
3300020279|Ga0211634_1060334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 879 | Open in IMG/M |
3300020285|Ga0211602_1025430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 877 | Open in IMG/M |
3300020322|Ga0211563_1075480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 711 | Open in IMG/M |
3300020324|Ga0211630_1063251 | Not Available | 751 | Open in IMG/M |
3300020326|Ga0211561_1081338 | Not Available | 674 | Open in IMG/M |
3300020332|Ga0211502_1087843 | Not Available | 588 | Open in IMG/M |
3300020359|Ga0211610_1039023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1094 | Open in IMG/M |
3300020359|Ga0211610_1073959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 792 | Open in IMG/M |
3300020390|Ga0211555_10343432 | Not Available | 556 | Open in IMG/M |
3300020407|Ga0211575_10297084 | Not Available | 669 | Open in IMG/M |
3300020407|Ga0211575_10298917 | Not Available | 667 | Open in IMG/M |
3300020425|Ga0211549_10343723 | Not Available | 608 | Open in IMG/M |
3300020425|Ga0211549_10344648 | Not Available | 607 | Open in IMG/M |
3300020426|Ga0211536_10237788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 710 | Open in IMG/M |
3300020427|Ga0211603_10195863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 757 | Open in IMG/M |
3300020428|Ga0211521_10180389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 973 | Open in IMG/M |
3300020428|Ga0211521_10215021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 874 | Open in IMG/M |
3300020434|Ga0211670_10212433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 784 | Open in IMG/M |
3300020444|Ga0211578_10026618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2212 | Open in IMG/M |
3300020444|Ga0211578_10075646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1292 | Open in IMG/M |
3300020444|Ga0211578_10169651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 869 | Open in IMG/M |
3300020444|Ga0211578_10237310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 738 | Open in IMG/M |
3300020444|Ga0211578_10462586 | Not Available | 532 | Open in IMG/M |
3300020445|Ga0211564_10287653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 810 | Open in IMG/M |
3300020447|Ga0211691_10451832 | Not Available | 522 | Open in IMG/M |
3300020452|Ga0211545_10245104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 823 | Open in IMG/M |
3300020456|Ga0211551_10387852 | Not Available | 666 | Open in IMG/M |
3300020462|Ga0211546_10155281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1131 | Open in IMG/M |
3300020462|Ga0211546_10273026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 843 | Open in IMG/M |
3300020465|Ga0211640_10489893 | Not Available | 670 | Open in IMG/M |
3300020466|Ga0211714_10620390 | Not Available | 504 | Open in IMG/M |
3300020473|Ga0211625_10196962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1073 | Open in IMG/M |
3300020476|Ga0211715_10049714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2062 | Open in IMG/M |
3300020476|Ga0211715_10225123 | Not Available | 916 | Open in IMG/M |
3300020476|Ga0211715_10314584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HIMB1321 | 766 | Open in IMG/M |
3300020477|Ga0211585_10014497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 6935 | Open in IMG/M |
3300020477|Ga0211585_10048431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3157 | Open in IMG/M |
3300020477|Ga0211585_10082806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2239 | Open in IMG/M |
3300020477|Ga0211585_10216739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1197 | Open in IMG/M |
3300020477|Ga0211585_10222570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1176 | Open in IMG/M |
3300020477|Ga0211585_10308984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 946 | Open in IMG/M |
3300020477|Ga0211585_10350882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 869 | Open in IMG/M |
3300020478|Ga0211503_10049540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2611 | Open in IMG/M |
3300020478|Ga0211503_10698798 | Not Available | 520 | Open in IMG/M |
3300021065|Ga0206686_1123475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 768 | Open in IMG/M |
3300021084|Ga0206678_10277694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 811 | Open in IMG/M |
3300021087|Ga0206683_10306170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 811 | Open in IMG/M |
3300021087|Ga0206683_10551934 | Not Available | 562 | Open in IMG/M |
3300021791|Ga0226832_10316247 | Not Available | 640 | Open in IMG/M |
3300022225|Ga0187833_10037004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3540 | Open in IMG/M |
3300022225|Ga0187833_10063341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2498 | Open in IMG/M |
3300022225|Ga0187833_10372694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 768 | Open in IMG/M |
3300022227|Ga0187827_10006415 | All Organisms → cellular organisms → Bacteria | 13443 | Open in IMG/M |
3300022227|Ga0187827_10041111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3835 | Open in IMG/M |
3300022227|Ga0187827_10042080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3776 | Open in IMG/M |
3300025184|Ga0208832_101029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 4435 | Open in IMG/M |
3300025240|Ga0208203_1018970 | Not Available | 1178 | Open in IMG/M |
3300026073|Ga0207961_1056882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 858 | Open in IMG/M |
3300026073|Ga0207961_1125470 | Not Available | 551 | Open in IMG/M |
3300026076|Ga0208261_1010631 | Not Available | 2859 | Open in IMG/M |
3300026082|Ga0208750_1025912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1360 | Open in IMG/M |
3300026082|Ga0208750_1079651 | Not Available | 649 | Open in IMG/M |
3300026119|Ga0207966_1005512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 5212 | Open in IMG/M |
3300026206|Ga0207988_1024720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1633 | Open in IMG/M |
3300026206|Ga0207988_1076693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 792 | Open in IMG/M |
3300026206|Ga0207988_1091933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 705 | Open in IMG/M |
3300026212|Ga0208409_1136032 | Not Available | 529 | Open in IMG/M |
3300026260|Ga0208408_1066443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1136 | Open in IMG/M |
3300026269|Ga0208766_1171608 | Not Available | 543 | Open in IMG/M |
3300026321|Ga0208764_10006132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 7021 | Open in IMG/M |
3300026321|Ga0208764_10318636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 745 | Open in IMG/M |
3300027709|Ga0209228_1106932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 861 | Open in IMG/M |
3300027813|Ga0209090_10386761 | Not Available | 675 | Open in IMG/M |
3300027827|Ga0209035_10354937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 723 | Open in IMG/M |
3300027838|Ga0209089_10159219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1354 | Open in IMG/M |
3300027839|Ga0209403_10120812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1685 | Open in IMG/M |
3300027847|Ga0209402_10721756 | Not Available | 543 | Open in IMG/M |
3300027906|Ga0209404_10401929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 892 | Open in IMG/M |
3300027906|Ga0209404_10445255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 850 | Open in IMG/M |
3300027906|Ga0209404_10659057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 703 | Open in IMG/M |
3300028190|Ga0257108_1026159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1757 | Open in IMG/M |
3300028190|Ga0257108_1210144 | Not Available | 549 | Open in IMG/M |
3300028192|Ga0257107_1068404 | Not Available | 1081 | Open in IMG/M |
3300028488|Ga0257113_1083664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 999 | Open in IMG/M |
3300028489|Ga0257112_10194727 | Not Available | 709 | Open in IMG/M |
3300028535|Ga0257111_1091626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. RS40 | 966 | Open in IMG/M |
3300028535|Ga0257111_1107636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 876 | Open in IMG/M |
3300031757|Ga0315328_10323434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. RS40 | 900 | Open in IMG/M |
3300031757|Ga0315328_10377802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 824 | Open in IMG/M |
3300031775|Ga0315326_10110686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1790 | Open in IMG/M |
3300031775|Ga0315326_10319346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1015 | Open in IMG/M |
3300031775|Ga0315326_10520724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 763 | Open in IMG/M |
3300031800|Ga0310122_10454345 | Not Available | 538 | Open in IMG/M |
3300031800|Ga0310122_10463039 | Not Available | 531 | Open in IMG/M |
3300031801|Ga0310121_10235248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1099 | Open in IMG/M |
3300031801|Ga0310121_10516146 | Not Available | 659 | Open in IMG/M |
3300031803|Ga0310120_10196299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1107 | Open in IMG/M |
3300031804|Ga0310124_10627955 | Not Available | 616 | Open in IMG/M |
3300031811|Ga0310125_10423609 | Not Available | 643 | Open in IMG/M |
3300031811|Ga0310125_10498794 | Not Available | 580 | Open in IMG/M |
3300031861|Ga0315319_10468649 | Not Available | 630 | Open in IMG/M |
3300031886|Ga0315318_10055860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2122 | Open in IMG/M |
3300031886|Ga0315318_10331841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 872 | Open in IMG/M |
3300031886|Ga0315318_10424922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 760 | Open in IMG/M |
3300032006|Ga0310344_10006855 | All Organisms → cellular organisms → Bacteria | 8477 | Open in IMG/M |
3300032006|Ga0310344_10057696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3153 | Open in IMG/M |
3300032006|Ga0310344_10188236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1753 | Open in IMG/M |
3300032006|Ga0310344_10411158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1161 | Open in IMG/M |
3300032006|Ga0310344_11022388 | Not Available | 692 | Open in IMG/M |
3300032006|Ga0310344_11069749 | Not Available | 674 | Open in IMG/M |
3300032006|Ga0310344_11104533 | Not Available | 661 | Open in IMG/M |
3300032006|Ga0310344_11248492 | Not Available | 615 | Open in IMG/M |
3300032006|Ga0310344_11751959 | Not Available | 500 | Open in IMG/M |
3300032011|Ga0315316_11183226 | Not Available | 615 | Open in IMG/M |
3300032011|Ga0315316_11375914 | Not Available | 560 | Open in IMG/M |
3300032011|Ga0315316_11489220 | Not Available | 533 | Open in IMG/M |
3300032032|Ga0315327_10625065 | Not Available | 663 | Open in IMG/M |
3300032032|Ga0315327_10638386 | Not Available | 655 | Open in IMG/M |
3300032032|Ga0315327_10717252 | Not Available | 611 | Open in IMG/M |
3300032130|Ga0315333_10226667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 886 | Open in IMG/M |
3300032130|Ga0315333_10457967 | Not Available | 601 | Open in IMG/M |
3300032132|Ga0315336_1089052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1381 | Open in IMG/M |
3300032278|Ga0310345_10149997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2080 | Open in IMG/M |
3300032278|Ga0310345_10239738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1659 | Open in IMG/M |
3300032278|Ga0310345_10469542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1196 | Open in IMG/M |
3300032278|Ga0310345_10483034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1180 | Open in IMG/M |
3300032278|Ga0310345_10523376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1134 | Open in IMG/M |
3300032278|Ga0310345_10861569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 883 | Open in IMG/M |
3300032278|Ga0310345_11141240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 762 | Open in IMG/M |
3300032278|Ga0310345_11147478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 760 | Open in IMG/M |
3300032278|Ga0310345_11372339 | Not Available | 691 | Open in IMG/M |
3300032278|Ga0310345_11586698 | Not Available | 639 | Open in IMG/M |
3300032278|Ga0310345_11599488 | Not Available | 637 | Open in IMG/M |
3300032278|Ga0310345_12214821 | Not Available | 532 | Open in IMG/M |
3300032360|Ga0315334_10224807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1533 | Open in IMG/M |
3300032360|Ga0315334_10276995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1389 | Open in IMG/M |
3300032360|Ga0315334_10571797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 973 | Open in IMG/M |
3300032360|Ga0315334_11014712 | Not Available | 718 | Open in IMG/M |
3300032360|Ga0315334_11027957 | Not Available | 713 | Open in IMG/M |
3300032360|Ga0315334_11425501 | Not Available | 595 | Open in IMG/M |
3300032360|Ga0315334_11587138 | Not Available | 559 | Open in IMG/M |
3300032360|Ga0315334_11706501 | Not Available | 536 | Open in IMG/M |
3300032360|Ga0315334_11710673 | Not Available | 535 | Open in IMG/M |
3300032360|Ga0315334_11824898 | Not Available | 516 | Open in IMG/M |
3300032820|Ga0310342_100312908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1667 | Open in IMG/M |
3300032820|Ga0310342_101598025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 777 | Open in IMG/M |
3300032820|Ga0310342_101736115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 745 | Open in IMG/M |
3300034695|Ga0372840_047057 | Not Available | 1263 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 30.29% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 15.64% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 10.42% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 10.42% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 10.10% |
Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 7.82% |
Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 4.56% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 4.89% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.63% |
Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.63% |
Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 0.65% |
Water Column | Environmental → Aquatic → Marine → Coastal → Unclassified → Water Column | 0.33% |
Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.33% |
Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 0.33% |
Hydrothermal Fluid | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Fluid | 0.33% |
Marine, Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine, Hydrothermal Vent Plume | 0.33% |
Black Smokers Hydrothermal Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume | 0.33% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000157 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 1000m | Environmental | Open in IMG/M |
3300000179 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P16 500m | Environmental | Open in IMG/M |
3300000181 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P4 500m | Environmental | Open in IMG/M |
3300000260 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P20_500 | Environmental | Open in IMG/M |
3300001010 | Marine microbial communities from South of Eden, South Pacific Ocean - MP1434 | Environmental | Open in IMG/M |
3300001068 | Marine microbial communities from the Deep Atlantic Ocean - MP0372 | Environmental | Open in IMG/M |
3300001679 | Black smokers hydrothermal plume microbial communities from Tahi Moana, Lau Basin, Pacific Ocean | Environmental | Open in IMG/M |
3300001780 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Vondamm Supr46 | Environmental | Open in IMG/M |
3300003702 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Microbial Assembly | Environmental | Open in IMG/M |
3300005399 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F14-07SV275 | Environmental | Open in IMG/M |
3300005400 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 | Environmental | Open in IMG/M |
3300005402 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73 | Environmental | Open in IMG/M |
3300005408 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV72 | Environmental | Open in IMG/M |
3300005422 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV43 | Environmental | Open in IMG/M |
3300005425 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV199 | Environmental | Open in IMG/M |
3300005426 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV74 | Environmental | Open in IMG/M |
3300005428 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253 | Environmental | Open in IMG/M |
3300005429 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV76 | Environmental | Open in IMG/M |
3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
3300005431 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV75 | Environmental | Open in IMG/M |
3300005514 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 | Environmental | Open in IMG/M |
3300005594 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV82 | Environmental | Open in IMG/M |
3300005604 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63 | Environmental | Open in IMG/M |
3300005945 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_AAIW_ad_876m_LV_B | Environmental | Open in IMG/M |
3300005948 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_O2min_ad_571m_LV | Environmental | Open in IMG/M |
3300005951 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
3300005953 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_Bottom_ad_3770_LV_A | Environmental | Open in IMG/M |
3300006002 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_NADW_ad_2505m_LV_A | Environmental | Open in IMG/M |
3300006012 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_AAIW_ad_750m_LV_A | Environmental | Open in IMG/M |
3300006093 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP189 | Environmental | Open in IMG/M |
3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
3300006309 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0500m | Environmental | Open in IMG/M |
3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
3300006313 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770m | Environmental | Open in IMG/M |
3300006315 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0770m | Environmental | Open in IMG/M |
3300006316 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_1000m | Environmental | Open in IMG/M |
3300006323 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0500m | Environmental | Open in IMG/M |
3300006324 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0500m | Environmental | Open in IMG/M |
3300006325 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500m | Environmental | Open in IMG/M |
3300006331 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_1000m | Environmental | Open in IMG/M |
3300006335 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_2_0500m | Environmental | Open in IMG/M |
3300006338 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770m | Environmental | Open in IMG/M |
3300006339 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m | Environmental | Open in IMG/M |
3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
3300006341 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m | Environmental | Open in IMG/M |
3300006346 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0770m | Environmental | Open in IMG/M |
3300006347 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_1000m | Environmental | Open in IMG/M |
3300006567 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0770m | Environmental | Open in IMG/M |
3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
3300007283 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_250_ad_252m_LV_B | Environmental | Open in IMG/M |
3300007301 | Hydrothermal vent microbial communities from Teddy Bear hydrothermal vent, East Pacific Rise - large volume pump, sample 5 | Environmental | Open in IMG/M |
3300007504 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
3300007508 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
3300007509 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
3300007514 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
3300007515 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
3300008097 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (version 2) | Environmental | Open in IMG/M |
3300008227 | Methane-oxidizing microbial communities from mesocosms in the Gulf of Mexico - GOM15C Gulf of Mexico | Environmental | Open in IMG/M |
3300008253 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon | Environmental | Open in IMG/M |
3300008625 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 2.7-0.2um | Environmental | Open in IMG/M |
3300008735 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um | Environmental | Open in IMG/M |
3300008740 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
3300009103 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7um | Environmental | Open in IMG/M |
3300009104 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um | Environmental | Open in IMG/M |
3300009108 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
3300009126 | Combined Assembly of Gp0139357, Gp0139356 | Environmental | Open in IMG/M |
3300009129 | Combined Assembly of Gp0139513, Gp0139514 | Environmental | Open in IMG/M |
3300009132 | Combined Assembly of Gp0139359, Gp0139510 | Environmental | Open in IMG/M |
3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
3300009370 | Combined Assembly of Gp0127930, Gp0127931 | Environmental | Open in IMG/M |
3300009376 | Combined Assembly of Gp0137079, Gp0137080 | Environmental | Open in IMG/M |
3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
3300020249 | Marine microbial communities from Tara Oceans - TARA_B100000482 (ERX556038-ERR599056) | Environmental | Open in IMG/M |
3300020254 | Marine microbial communities from Tara Oceans - TARA_B100001013 (ERX555924-ERR599085) | Environmental | Open in IMG/M |
3300020262 | Marine microbial communities from Tara Oceans - TARA_B100000097 (ERX556100-ERR599172) | Environmental | Open in IMG/M |
3300020275 | Marine microbial communities from Tara Oceans - TARA_B100002003 (ERX555991-ERR599175) | Environmental | Open in IMG/M |
3300020279 | Marine microbial communities from Tara Oceans - TARA_B100000482 (ERX555939-ERR599017) | Environmental | Open in IMG/M |
3300020285 | Marine microbial communities from Tara Oceans - TARA_B000000460 (ERX555972-ERR599034) | Environmental | Open in IMG/M |
3300020322 | Marine microbial communities from Tara Oceans - TARA_B100002003 (ERX556138-ERR599051) | Environmental | Open in IMG/M |
3300020324 | Marine microbial communities from Tara Oceans - TARA_B100000678 (ERX555936-ERR599033) | Environmental | Open in IMG/M |
3300020326 | Marine microbial communities from Tara Oceans - TARA_B100002003 (ERX556099-ERR599004) | Environmental | Open in IMG/M |
3300020332 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX555956-ERR598975) | Environmental | Open in IMG/M |
3300020359 | Marine microbial communities from Tara Oceans - TARA_B100000686 (ERX555921-ERR599117) | Environmental | Open in IMG/M |
3300020390 | Marine microbial communities from Tara Oceans - TARA_B100002049 (ERX555953-ERR598985) | Environmental | Open in IMG/M |
3300020407 | Marine microbial communities from Tara Oceans - TARA_B100001105 (ERX556033-ERR599115) | Environmental | Open in IMG/M |
3300020425 | Marine microbial communities from Tara Oceans - TARA_B100001765 (ERX556083-ERR598964) | Environmental | Open in IMG/M |
3300020426 | Marine microbial communities from Tara Oceans - TARA_B100000378 (ERX555992-ERR599112) | Environmental | Open in IMG/M |
3300020427 | Marine microbial communities from Tara Oceans - TARA_B000000460 (ERX555922-ERR598960) | Environmental | Open in IMG/M |
3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
3300020434 | Marine microbial communities from Tara Oceans - TARA_B100001013 (ERX555944-ERR599071) | Environmental | Open in IMG/M |
3300020444 | Marine microbial communities from Tara Oceans - TARA_B100001245 (ERX556114-ERR598980) | Environmental | Open in IMG/M |
3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
3300020447 | Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159) | Environmental | Open in IMG/M |
3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
3300020456 | Marine microbial communities from Tara Oceans - TARA_B100001741 (ERX555984-ERR599123) | Environmental | Open in IMG/M |
3300020462 | Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986) | Environmental | Open in IMG/M |
3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
3300020466 | Marine microbial communities from Tara Oceans - TARA_B100001540 (ERX556059-ERR598968) | Environmental | Open in IMG/M |
3300020473 | Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948) | Environmental | Open in IMG/M |
3300020476 | Marine microbial communities from Tara Oceans - TARA_B100001750 (ERX556108-ERR598958) | Environmental | Open in IMG/M |
3300020477 | Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156) | Environmental | Open in IMG/M |
3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
3300021065 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 | Environmental | Open in IMG/M |
3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
3300021087 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 | Environmental | Open in IMG/M |
3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
3300022225 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300022227 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300025184 | Marine microbial communities from the Deep Pacific Ocean - MP2158 (SPAdes) | Environmental | Open in IMG/M |
3300025240 | Marine microbial communities from the Deep Atlantic Ocean - MP2914 (SPAdes) | Environmental | Open in IMG/M |
3300026073 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_250_ad_252m_LV_B (SPAdes) | Environmental | Open in IMG/M |
3300026076 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (SPAdes) | Environmental | Open in IMG/M |
3300026082 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_O2min_ad_340m_LV (SPAdes) | Environmental | Open in IMG/M |
3300026119 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_B (SPAdes) | Environmental | Open in IMG/M |
3300026206 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV74 (SPAdes) | Environmental | Open in IMG/M |
3300026212 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV201 (SPAdes) | Environmental | Open in IMG/M |
3300026260 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 (SPAdes) | Environmental | Open in IMG/M |
3300026269 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 (SPAdes) | Environmental | Open in IMG/M |
3300026321 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes) | Environmental | Open in IMG/M |
3300027709 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_150m (SPAdes) | Environmental | Open in IMG/M |
3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
3300027827 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
3300027839 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes) | Environmental | Open in IMG/M |
3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300028190 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000m | Environmental | Open in IMG/M |
3300028192 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500m | Environmental | Open in IMG/M |
3300028488 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1320m | Environmental | Open in IMG/M |
3300028489 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1000m | Environmental | Open in IMG/M |
3300028535 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_500m | Environmental | Open in IMG/M |
3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
3300031800 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_Bottom_1051 | Environmental | Open in IMG/M |
3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
3300031803 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_AW_983 | Environmental | Open in IMG/M |
3300031804 | Marine microbial communities from Western Arctic Ocean, Canada - CB11b_AW_Bot5 | Environmental | Open in IMG/M |
3300031811 | Marine microbial communities from Western Arctic Ocean, Canada - CB11b_Tmax_Bot8 | Environmental | Open in IMG/M |
3300031861 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 3416 | Environmental | Open in IMG/M |
3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
3300032130 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 34915 | Environmental | Open in IMG/M |
3300032132 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #5 | Environmental | Open in IMG/M |
3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
3300034695 | Seawater microbial communities from the Northeast subarctic Pacific Ocean - P26_June_2012_500m | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
LPaug08P261000mDRAFT_10114261 | 3300000157 | Marine | LFLLPNTTHELKAFTIKHDFAQHKKKILSRQDGIFFSFEEI* |
LPjun09P16500mDRAFT_10457072 | 3300000179 | Marine | MYVLNLFLLPNTTHELKAFTIKDDLAQHMKKLLSRQDGTFFF* |
LPjun08P4500mDRAFT_10443761 | 3300000181 | Marine | NLFLLPNTTHELKAFTIKHDLAQPMKKNLSRQDRIFFF* |
LP_A_09_P20_500DRAFT_10399162 | 3300000260 | Marine | LFLLPNTTHELKAFTIKHDFAQHMKKVLSRQDGIFFF* |
JGI11983J13109_1013411 | 3300001010 | Deep Ocean | LLFDGLNLFLLPNTTHKLKAFTIKHDFAQHMQKVFSRQDGILFSFEEV* |
JGI12207J13218_10097093 | 3300001068 | Deep Ocean | NLFLLPNTTHELKAFTIKHDLTQHVTNILSRKDGIFFF* |
TahiMoana_10624571 | 3300001679 | Black Smokers Hydrothermal Plume | LNLFLLPNTTHELKAFTIKHDFAQHMKKILSRQDGIFFLLKKFDE* |
supr46_10054081 | 3300001780 | Hydrothermal Vent Plume | NLFLLPNATHELKVFTIKHDLTQHVKNILSRKDGIFFF* |
PicMicro_100228094 | 3300003702 | Marine, Hydrothermal Vent Plume | YGLNLFLLPNTTHELKAFTIKHDFAQHMKNALSRKDGIFFF* |
Ga0066860_100151791 | 3300005399 | Marine | IFLRLLVIYELNLFLPPNTTHELKGFTIKYDFAQHMKKVLSR* |
Ga0066867_102732831 | 3300005400 | Marine | YELNLFLLPNTTHELKAFTIKLDLTQYVKNILSRKDGIFFF* |
Ga0066855_102838652 | 3300005402 | Marine | VMYGLNLFLLPNTTHELKGFTIKHDFAQHMKKVLSRQDGIFFLLKKFGE* |
Ga0066848_100044784 | 3300005408 | Marine | LFLLPTNTTHELKAFTIKHDFAQHMKKILSRQDGIFFSFEEI* |
Ga0066848_100982091 | 3300005408 | Marine | LPNTTHELKAFTIKHDFAQHMKKVLFRQDGIFFFEEIWLVK* |
Ga0066829_100149043 | 3300005422 | Marine | LPNATHELKAFTIKHDFAQHMKKVLSRQDGIFFLLKKFD* |
Ga0066859_100699423 | 3300005425 | Marine | VIYGLNLFLLPNTTHELKAFTIKHDFAQHKKKILSRQDGIFFLLKKFDE* |
Ga0066847_101340071 | 3300005426 | Marine | YLVMYDLNLFLLPNTTHELKGFTIKHDFAQHMKKVLSRQDGIFFLLKKFDG* |
Ga0066863_100106791 | 3300005428 | Marine | FLLPNTTHELKGFTIKHDFAQHMKKVLSRQDDFFSFEEI* |
Ga0066846_101852772 | 3300005429 | Marine | LIYGLNLFLLPNTTHELKAFTIKLDFAQDMKNVLSRNDRIFFF* |
Ga0066849_102704292 | 3300005430 | Marine | YGLNLFLLPNTTHELKAFTIKLDFAQDMKNILSRNDRIFFF* |
Ga0066854_100079564 | 3300005431 | Marine | PNTTHELKGFTIKHDFAQHMKKVLSRRDGIFFLLKKFGE* |
Ga0066866_101898031 | 3300005514 | Marine | LNLFLLTNTTHELKAFTIKHDFAQHMKKILSRQDRIFFF* |
Ga0066866_102577812 | 3300005514 | Marine | GLNLFFLPNTTHELKAFTIKHDFLQHMKMKNILSSKDRIFFF* |
Ga0066866_102672092 | 3300005514 | Marine | LFLLTNTTHELKAFTIKHDFAQDMKKVLSRQDGIFFF* |
Ga0066866_102794492 | 3300005514 | Marine | GLNLFLLPNTTHELKAFTIKYDLAQHKKNLLSRQDGIFFF* |
Ga0066866_102937262 | 3300005514 | Marine | LIYGLNLFLLPNTTHELKAFTIKLDFAQDMKNILSRNDRIFFF* |
Ga0066839_100945541 | 3300005594 | Marine | YGLNLFLLPNTTHELKAFTIKHDFAQHKKKILSRQDGIFFSFEEI* |
Ga0066839_102856312 | 3300005594 | Marine | YGLNLFLLPNTTHELKGFTIKHDFAQHMKKVLSRQDGIFFF* |
Ga0066839_103047301 | 3300005594 | Marine | PNTTHELKAFTIKHDFAQHMKKVLSRQDGIFFLLKKFDG* |
Ga0066852_102953982 | 3300005604 | Marine | LNLFLLPNTTHELKAFTIKHDFAQHMKKVLSRQDGIFFF* |
Ga0066381_102533242 | 3300005945 | Marine | LTFLSYLAIYELNLFLLPNTTHELKAFTIKLDLTQYVKNILSRKDGIFFF* |
Ga0066380_101382871 | 3300005948 | Marine | VMYGLNLFLLPNTTHELKGFTIKHDFAQHMKKVLSRQDGIFFF* |
Ga0066379_101509663 | 3300005951 | Marine | MYGLNLFLLPNTTHELKAFTIKHDFAQHMKKLLSRQDGIFFF* |
Ga0066379_103115761 | 3300005951 | Marine | RGINLFDYLAIYELNLFLLPNTTHELKAFTIKLDLTQHVKNILSRKDGIFFFEEI* |
Ga0066383_100512031 | 3300005953 | Marine | LLPNTTHELKAFTIKHDFAQHMKKILSRQDRIFFF* |
Ga0066383_102566221 | 3300005953 | Marine | YGLNLFLLPNTTHELKAFTIKHDFAQHMKKILSRQDGILFSFEEV* |
Ga0066368_101874021 | 3300006002 | Marine | TTHELKAFTIKHDFAQHMKKILSRQDGILFSFEEV* |
Ga0066368_103409072 | 3300006002 | Marine | FLLPNTTHELKAFTIKHDLTQHVKNILSRKDGIFFF* |
Ga0066374_100280591 | 3300006012 | Marine | IYGLNLFLLPNTTHELKAFTIKHDFAQHMKKLLSRQDGIFFF* |
Ga0066374_101704612 | 3300006012 | Marine | LFLLPNTTHELKAFTIKYDFAQHMKKVLSRQDGIFFLLKKFGE* |
Ga0082019_10143771 | 3300006093 | Marine | LLPNATHELKAFTIKHDFAQHMKKVLSRQDRIFFLLKKFN |
Ga0066836_100587791 | 3300006166 | Marine | LLPNTTHELKAFTTKFDFAQHMKKILSRQDGIFFF |
Ga0066836_100631241 | 3300006166 | Marine | LFLLTNTTHELKAFTIKHDFAQHMKKVLSRQDGIF |
Ga0066836_101254903 | 3300006166 | Marine | LLPNTTHELKAFTIKHDFAQDMKKNLSRQDGIFFF* |
Ga0066836_102779413 | 3300006166 | Marine | YGLNLFLLPNTTHELKAFTIKHDLAQHKKKILSRQDRIFFF* |
Ga0066836_103618243 | 3300006166 | Marine | VLNLFLLTNTTHELKAFTIKHDFAQHMKKVLSRQDGTFFF* |
Ga0066836_103722231 | 3300006166 | Marine | LPNTTHELKAFTIKHDFVQEMKKFLSREDRIFFF* |
Ga0066836_103761481 | 3300006166 | Marine | PNTTHELKAFTIKHDFAQHKKKILSRQDRIFFLLKNFGE* |
Ga0066836_105886901 | 3300006166 | Marine | VLNLFLLTNTTHELKAFTIKHDSAQDMKKVLSRQDGIFFF* |
Ga0066836_106046621 | 3300006166 | Marine | LNLFLLPNTTHELKAFTIKHDLTQYVKNILSRKDGIFFF* |
Ga0066836_106893002 | 3300006166 | Marine | FLLPNTTHELKAFTIKLDFAQHKKKILSRQDRIFFF* |
Ga0066836_107377772 | 3300006166 | Marine | YGLNLFLLPNTTHELKAFTIKLHFAQHKKIFLSRPDRIFFF* |
Ga0068470_13621053 | 3300006308 | Marine | LFLLPNTTHELKAFTIKHGFAQHMKKVLSRQDGIFFLLKKFGE* |
Ga0068470_18680502 | 3300006308 | Marine | TSLVNYELNLLLLPNTTHELKAFTIKHDLTQHVKNILSRKDGIFFF* |
Ga0068479_12976931 | 3300006309 | Marine | MHGLNLFLLPNTTHELKAFTIKHDFAQHMKKVLSRQDGIFFF* |
Ga0068471_14937184 | 3300006310 | Marine | LFLLPNTTHELKAFTIKYDFAQHMKKILSRKDGILFSFEEV* |
Ga0068472_102159551 | 3300006313 | Marine | LFLLPNTTHELKAFTIKHDFAQHMKNVLSRQDGFFSFEEIS* |
Ga0068472_103334143 | 3300006313 | Marine | MHGLNLFLLPNTTHELKAFTIKHDFAQHMKNFLSRQDRIFFF* |
Ga0068472_103517753 | 3300006313 | Marine | LFLLPNTTHELKGFTIKHDFAQQMKKVLSRQDGIFFSFEEIW* |
Ga0068472_104214701 | 3300006313 | Marine | VIYELNLFLLPNTTHELKGFTIKYDFAQHMKKILSRQDGILFSFEEV* |
Ga0068472_105578161 | 3300006313 | Marine | NLFLLPNTTHKLKAFTIKHDFAQHMKKVFSRQDRILFSFEEV* |
Ga0068472_107672452 | 3300006313 | Marine | LNLFLLPNTTHELKAFTIKHDLTQHMKNILSRKDGIFFF* |
Ga0068487_10629252 | 3300006315 | Marine | MGYNLFLLPNTTHELKAFTIKHDFAQHMKNILSRQDRIFFSFEEIY* |
Ga0068473_15200473 | 3300006316 | Marine | MYGLNLFLLPNTTHELKAFTIKHDLAQHMKNILSRQDGIFFLLKKFDE* |
Ga0068497_13353902 | 3300006323 | Marine | MYGLNLFLLPNTTHELKAFTIKLDLTQHVKNILSRKDGIFFF* |
Ga0068476_11092761 | 3300006324 | Marine | GLTFFDYLLFYVLNLLLLPNTTHELKAFTIKHDFAQHMKKILSRQDRIFFSFEEI* |
Ga0068501_13571822 | 3300006325 | Marine | MYGLNLFLLPNTTHELKGFTIKHDFAQHMKKVLSRQDGIFFLLKKFGE* |
Ga0068501_13791161 | 3300006325 | Marine | LFLLPNTTHELKAFTIKHDFAQHKKKILSRQDGIFFF* |
Ga0068488_15067702 | 3300006331 | Marine | LFLLPNTTHELKAFTIKHDFAQHMKKVLSRQDGIFFLLKKFDG* |
Ga0068480_17895333 | 3300006335 | Marine | VIYELNLFLLPNTTHELKAFTIKLDLTQYVKNILSRKDGIFFF* |
Ga0068482_13669432 | 3300006338 | Marine | MYGLNLFILPNTTHELKAFTIKHDFAQHMKKVLSRQDGIFFF*RNLF |
Ga0068482_14723922 | 3300006338 | Marine | YLAIYELNLFLLPNTTHELKAFTIKLDLTQYVKNILSRKDGIFFF* |
Ga0068481_13591313 | 3300006339 | Marine | LFLLPNTTHELKAFTIKYDFAQHVKKVLSRQDGIFFLLKKFGE* |
Ga0068503_107859952 | 3300006340 | Marine | VIYELNLFLLPNTTHELKAFTIKHDFAQHMKKILSRQDGIFFF* |
Ga0068503_109989891 | 3300006340 | Marine | DYLAMYGLNLFLLPNTTHELKAFTIKHDFAQHMKKILSL* |
Ga0068493_103098144 | 3300006341 | Marine | LFLLPNTTHELKAFTIKYDFAQHMKKALSRQDGIFFLLKKFDE* |
Ga0068493_104579413 | 3300006341 | Marine | LFLLPNTTHELKAFTIKHDLAQDMKMLLSRQDGIFFFEEN* |
Ga0068493_105030073 | 3300006341 | Marine | GLISLRHLVMYGLNLFLLPNTTHELKGFTIKYDFAQHMKKILSR* |
Ga0068493_105495502 | 3300006341 | Marine | MKQSFFDYLLFYGLNLLLLPNTTHELKAFTIKYDFAQHMKKVLSRQDGI |
Ga0068493_106024433 | 3300006341 | Marine | PNTTHELKAFTIKHDFAQHKKKILSRQDGIFFSFEEI* |
Ga0068493_111381651 | 3300006341 | Marine | LLPNTTHELKAFTIKHDFAQHKKKILSRQDGFFFF* |
Ga0099696_12657631 | 3300006346 | Marine | LLFYGLNLFLLPNTTHELRGFTIKYDFAQHMKKILSRQDGILFSFEEI* |
Ga0099697_11409261 | 3300006347 | Marine | MSLNLFLLPNTTHELKAFTIKHDLTQHVKNILSRKDGIFFF* |
Ga0099697_13525763 | 3300006347 | Marine | LFLLPNTTHELKAFTIKHDFAQPMKKILSRQDGILFSFEEI* |
Ga0099697_14887572 | 3300006347 | Marine | LFLLPNSTLKLKAFTIKHDFAQHMKKILSRQDRIFFF* |
Ga0099958_13531452 | 3300006567 | Marine | DYLVIYELNLFLLPNTTHELKAFTIKHDFAQHMKKVLSRQDGIFFLLKKFDG* |
Ga0066372_100495023 | 3300006902 | Marine | YLLIYGLNLFLLPNTTHELKAFTIKHDLAQHMKKILSRQDGIFFF* |
Ga0066372_101782213 | 3300006902 | Marine | DYLVMYGLNLFLLPNTTHELKAFTIKHDFAQHMKKILSRQDGIFFF* |
Ga0066372_102405361 | 3300006902 | Marine | LPNTTHELKAFTIKHDFAQHMKKILSRQDGIFFF* |
Ga0066372_102830891 | 3300006902 | Marine | HELKGFTIKHDFAQHMKKVLSRQDGIFFLLKKFGE* |
Ga0066372_106837462 | 3300006902 | Marine | YLVIYELNLFLLPNTTHELKAFTIKHDFVQGMKKVLYRQDGFFSFEEI* |
Ga0066372_107518511 | 3300006902 | Marine | RGINLFDYLAIYELNLFLLPNTTHELKAFTIKLDLTQYVKNILSRKDGIFFFEEI* |
Ga0066372_108085972 | 3300006902 | Marine | LLPNTTHELKGFTIKHDFAQHMKKVLSRQDGIFFLLKKFGE* |
Ga0066366_104976811 | 3300007283 | Marine | NYELNLFLLPNTTHELKAFTIKHAFVQGVKKFFYRQDRIFFF* |
Ga0066366_105629032 | 3300007283 | Marine | LFLLTNTTHELEAFTIKHDFAQHMKKKLSRQEGIFSFEEYC* |
Ga0079920_10120663 | 3300007301 | Hydrothermal Fluid | YGLNLFLLPNTTHELKAFTIKHDFAQHMQKVFSRQDGILFSFEEV* |
Ga0104999_10883933 | 3300007504 | Water Column | VLNLFLLTNTTHELKAFTIKHDFAQHMKKLLSRQDGIFFF* |
Ga0105011_10737773 | 3300007508 | Marine | SFPDYILIYGLNLFLVPNTTHELRAFTTKHEFAQEMKNILSRKDRIFFF* |
Ga0105012_10734141 | 3300007509 | Marine | LFLLPNTTHELKAFTIKHDFVQEMKKFLSREDRIF |
Ga0105020_10026017 | 3300007514 | Marine | MYGLNLFLLPNTTHELKAFTIKHDFAQDMKKILSRQDGIFFF* |
Ga0105020_11609741 | 3300007514 | Marine | LFLLPNTTHELKAFTIKHDFAQHMKKILSRQDGIFFF |
Ga0105020_14489651 | 3300007514 | Marine | NLFLLPNTTHELKAFTIKLDLTQHMKNILSRKDGIFFF* |
Ga0105021_11567971 | 3300007515 | Marine | LLTNTTHELKAFTIKHGFAQDMKKILSRQDRIFFF* |
Ga0105021_13055681 | 3300007515 | Marine | LLLLPNTTHELKAFTIKYDFAQHMKKILSRQDGIL |
Ga0111541_101639211 | 3300008097 | Marine | LLTNTTHELKAFTIKHDFAQHMKKLLSRQDGIFFF* |
Ga0111541_103426912 | 3300008097 | Marine | LNLFLLPNTTHELKAFTIKHDFAQHMKKYLYRQDRIFFF* |
Ga0105358_103036171 | 3300008227 | Methane Seep Mesocosm | LFLLPNTTHELKAFTIKHDFAQHKKKILSRQDGIFF |
Ga0105349_102617543 | 3300008253 | Methane Seep Mesocosm | YGLNLFLLPNTTHELKAFTIKHDFAQHMKKVLYRQDGIFFLLKKFDE* |
Ga0115653_11233721 | 3300008625 | Marine | FDALNLFLLTNTTHELKAFTIKHDFAQHMKKLLSRQDGIFFF* |
Ga0115657_100545517 | 3300008735 | Marine | NLFLLTNTTHELKAFTIKHDFAQHMKKVLSRQDGIFFF* |
Ga0115657_10213031 | 3300008735 | Marine | LNLFLLPNTTHELKAFTIKHDFAQHMKKILSRQDGIFFF* |
Ga0115657_11499153 | 3300008735 | Marine | LFLLTNTTHELKAFTIKHDFAQHMKKVLSRQDGIFFF* |
Ga0115663_11123851 | 3300008740 | Marine | IYGLNLFLLPNTTHELKAFTTKFDFAQHMKKILSRQDGIFFF* |
Ga0117901_10369631 | 3300009103 | Marine | LPNTTHELKAFTIKLDLTQHVKNILSRKDGIFFF* |
Ga0117902_10534851 | 3300009104 | Marine | LNLFLLTNTTHELKAFTIKHDFAQHMKKILSRQDGIFFF* |
Ga0117902_12300011 | 3300009104 | Marine | NLFLLPNTTHELKAFTIKHDFAQHMKKVLFSQDGIFFF* |
Ga0117902_12403151 | 3300009104 | Marine | LFLLTNTTHELKAFTIKHDFAQHMKKILSRQDGIFFF |
Ga0117902_13050981 | 3300009104 | Marine | LFLLPNTTHELKAFTIKYDFAQHMKKILSRQDGIFFF* |
Ga0117902_13193101 | 3300009104 | Marine | FLLTNTTHELKAFTIKHDFAQHMKKVLSRQDGIFFF* |
Ga0117902_15956741 | 3300009104 | Marine | MYGLNLFLLPNTTHELKAFTIKHDFAQDMKKLLSRQDGIFFF* |
Ga0117920_10916061 | 3300009108 | Marine | NLFLLPNTTHELKAFTIKHDLTQHMKNILSRKDGIFFF* |
Ga0118723_11240121 | 3300009126 | Marine | AMYRLNFFLLPNTTHELKAFTIKCDLAQHKKKILSRQDGIFFF* |
Ga0118728_12357171 | 3300009129 | Marine | LFLLTNTTHELKAFTIKHDFAQHMKKVLSRQDGIFF |
Ga0118730_13385931 | 3300009132 | Marine | GLNLFLLPNTTHELKAFTIKHDFAQDMKKILSRQDGIFFF* |
Ga0114996_101190331 | 3300009173 | Marine | SYEDYLLMYGLNLFLPPNTTHELKAFTIKQDFAQHMKNFLSRQDRAFFF* |
Ga0114996_105611261 | 3300009173 | Marine | YGLNLFLLPNTTHELKAFTIKYDFVQPMKKFLSRQDRIFFF* |
Ga0114996_108129991 | 3300009173 | Marine | DYLLMYGLNLFLPPNTTHELKAFTIKHGFAQYMKNFLSRQDRTFFF* |
Ga0114996_108158642 | 3300009173 | Marine | FLLPNTTHELKAFTIKHDFAQHMKNFLSRQDRIFFF* |
Ga0118716_10170111 | 3300009370 | Marine | DVLNLFLLTNTTHELKAFTIKHDFAQHMKKVLSRQDGIFFF* |
Ga0118716_11269491 | 3300009370 | Marine | IHGLNLFLLPNTTHELKAFTIKHDLTQHMKNILSRKDGIFFF* |
Ga0118722_10106401 | 3300009376 | Marine | FLLPNTTHELKAFTIKHDFAQHMKKILSRQDGIFFF* |
Ga0118722_10136659 | 3300009376 | Marine | LLPNTTHELKAFTIKHDFAQHMKKILSRQDGIFFF* |
Ga0118722_10226421 | 3300009376 | Marine | LLPNTTHELKAFTIKHDLAQHKKKILSRQDRTFFF* |
Ga0118722_10635904 | 3300009376 | Marine | LFLLTNTTHELKAFTIKHDFAQHMKKLLSRQDGIFFF* |
Ga0118722_11846973 | 3300009376 | Marine | YGLNLFLLPNTTHELKAFTIKHDFVQEMKKILSRKDRIFFF* |
Ga0118722_12015693 | 3300009376 | Marine | LNLFLLPNTTHELKAFTIKHAFVQGVKKFLYRKDRIFFF* |
Ga0118722_13141581 | 3300009376 | Marine | LFLLPNTTHELKAFTIKHDFAQDVKKVLYRQDRIFFF* |
Ga0114993_100086521 | 3300009409 | Marine | SFEDYLLMYGLNLFLPPNTTHELKAFTIKYDFAQDMKFFLYSQCEFFLLKKFL* |
Ga0114993_101282531 | 3300009409 | Marine | NLFLLPNTTHELKAFTIKLDLAQHKKKILSRQDRIFFFCRN* |
Ga0114903_11510652 | 3300009412 | Deep Ocean | LLYDGLNLFLLPNTTHKLKAFTIKHDFAQLMKKIFSRQDGILFSFEEV* |
Ga0114997_105233111 | 3300009425 | Marine | NLFLLPNTTHELKAFTIKRDFAQYMKIFLSRQDRTFFF* |
Ga0115011_108760491 | 3300009593 | Marine | LNLFLPPNTTHELKAFTIKSYFAQHKKKILSRQDRIFFF* |
Ga0114933_102229903 | 3300009703 | Deep Subsurface | FDVLNLFLLTNTTHELKAFTIKHDFAQDMKKVLSRQDGIFFF* |
Ga0114933_104189333 | 3300009703 | Deep Subsurface | LLLTNTTHELKAFTTKHDLAQHMKKILSRQDQDRVFFLLKKFQ* |
Ga0114933_108032922 | 3300009703 | Deep Subsurface | NLFLLTNTTHELKAFTIKHGFAQHMKKILSRQDRIFFF* |
Ga0114933_108384042 | 3300009703 | Deep Subsurface | LNLFLLPNTTHELKAFTIKLDFAQHKKKILSRQDRIFFF* |
Ga0114933_109276361 | 3300009703 | Deep Subsurface | NLFLLPNTTHELKAFTIKHDCAQHKKKILSRQDGIFFLLKKFDE* |
Ga0115002_107330362 | 3300009706 | Marine | YGLNLFLLPNTTHELKVFTIKDDFAQHVYKKFLSRQDRTFFFEEVC* |
Ga0114999_100202848 | 3300009786 | Marine | PNTTHELKAFTIKYDFAQDMKFFLYSQCEFFLLKKFL* |
Ga0114999_102298971 | 3300009786 | Marine | DYLVNCELNLFLLPNTTLELKAFTIKHAFSQGMKYFLYR* |
Ga0114999_102737003 | 3300009786 | Marine | LNLFLLPNTTHELKAFTIKHDFAQHMKSFLSPQDRIFFF* |
Ga0114999_103362023 | 3300009786 | Marine | FFYGLNLFLLPNTTHELKRFTIKLDFAQDMKKILSRQDRTFFF* |
Ga0114999_109769701 | 3300009786 | Marine | NLFLSPNTTHELKAFTIKHDLAQYMKKILSRQDGIFFF* |
Ga0133547_115583283 | 3300010883 | Marine | YGLNLFLPPNTTHELKAFTIKHDFAQYKKKYLSR* |
Ga0133547_120905081 | 3300010883 | Marine | LIDELNLFLPPNTTHELKAFTIKHDFAQGMKNFLYSQGRIFSFEEN* |
Ga0211635_10611973 | 3300020249 | Marine | LFLLPNTTHELTAFTIKHDFAQDMKKILYSQDRFFLLKKFDE |
Ga0211669_10170491 | 3300020254 | Marine | NTTHELKAFTIKHDFAQHKKKILSRQDRIFFLLKKFDE |
Ga0211537_10483873 | 3300020262 | Marine | FLLPNTTHELKAFTIKHDFAQHMKKALSRQDRFFFF |
Ga0211562_10278291 | 3300020275 | Marine | VIYGLNLFLLPNTTHELKAFTIKHDFAQHKKKILSRQDGIFFSFEEI |
Ga0211634_10603343 | 3300020279 | Marine | NTTHELTAFTIKHDFAQDMKKILYSQDRFFLLKKFDE |
Ga0211602_10254303 | 3300020285 | Marine | HELKAFTIKHDFAQHMKKILSRQDGIFFLLKKFDE |
Ga0211563_10754801 | 3300020322 | Marine | LLPNTTHKLKAFTIKHDFAQHMKKVFSRQDGILFSFEEV |
Ga0211630_10632511 | 3300020324 | Marine | LFLLPNTTHELKAFTIKHDFAQHKKKILSRQDGIFFSFEEI |
Ga0211561_10813381 | 3300020326 | Marine | FDGLNLFLLPNTTHKLKAFTIKHDFAQHMKKVFSRQDGILFSFEEV |
Ga0211502_10878432 | 3300020332 | Marine | LLPNTTHELKAFTIKHDFAQHMKKPLSRQDGIFFF |
Ga0211610_10390231 | 3300020359 | Marine | DYLVMYGLNLFLLPNTTHELKAFTIKHDFAQHMKNILSRQDGIFFF |
Ga0211610_10739591 | 3300020359 | Marine | LSLFLLPNTTHELKAFTTKQDFAQDKKKNLSRQDGNFFF |
Ga0211555_103434321 | 3300020390 | Marine | ELNLFLLPNTTHELKAFTIKLDLTQYVKNILSRKDGIFFF |
Ga0211575_102970841 | 3300020407 | Marine | NLFLLPNTTHELKAFTIKYDFAQHMKKDLSRQDGIFFF |
Ga0211575_102989172 | 3300020407 | Marine | LFLLPNTTHELKAFTIKHDLTQHMKNILSRKDGIFFF |
Ga0211549_103437231 | 3300020425 | Marine | YLAIYELNLFLLPNTTHELKAFTIKLDLTQHVKNILSRKDGIFFF |
Ga0211549_103446482 | 3300020425 | Marine | YLAIYELNLFLLPNTTHELKAFTIKLDLTQYVKNILSRKDGIFFF |
Ga0211536_102377883 | 3300020426 | Marine | NTTHELKGFTIKHDFAQHMKKVLSRRDGIFFLLKKFGE |
Ga0211603_101958631 | 3300020427 | Marine | PNTTHELKAFTIKHDFAQHKKKILSRQDGIFFLLKKFDE |
Ga0211521_101803893 | 3300020428 | Marine | YGLNLFLPPNTTHELKAFTIKYDFAQDMKIFLYSQCEFFLLKKFL |
Ga0211521_102150213 | 3300020428 | Marine | NLFLLPNTTHELKAFTIKLDFAQHKKKILSRQDRIFFF |
Ga0211670_102124331 | 3300020434 | Marine | FLLPNTTHELKAFTIKHDFAQHMKKVLSRQDGIFFF |
Ga0211578_100266181 | 3300020444 | Marine | MYGLNLFLLPNTTHELKAFTIKHDLAQPMKKNLSRQDRIFFF |
Ga0211578_100756463 | 3300020444 | Marine | VMYGLNLFLLPNTTHELKAFTIKHDFAQHMKKVLSRQDGIFFF |
Ga0211578_101696513 | 3300020444 | Marine | LFLLPNTTHELKAFTIKHDFAQHMKMLLSRQDGIFFF |
Ga0211578_102373101 | 3300020444 | Marine | VMYGLNLFLPPNTTHELKAFTIKHDLAQPMKKLLSRQDGIFFF |
Ga0211578_104625862 | 3300020444 | Marine | LVNYELNLFLLPNTTHELKAFTIKHAFVQGVKKFLYR |
Ga0211564_102876531 | 3300020445 | Marine | IYGLNLFLLPNTTHELKAFTINLDFAQHKKKILSRQDRIFFF |
Ga0211691_104518321 | 3300020447 | Marine | VMYGLNLFLLPNTTHELKAFTIKHDFAQHKKKILSRQDGIFFF |
Ga0211545_102451043 | 3300020452 | Marine | LRYGLNLFLLPNTTHELKAFTIKLDLAQHKKKFLSRQDRIFFF |
Ga0211551_103878522 | 3300020456 | Marine | FLLTNTTHELKAFTIKHDFAQHMKKILSRQDGIFFF |
Ga0211546_101552811 | 3300020462 | Marine | NLFLPPNTTHELKAFTIKYDFAQDMKIFLYSQCEFFLLKKFL |
Ga0211546_102730261 | 3300020462 | Marine | AKYELNLFLLPNTTHELKAFTIKHAFVQGVKKFFYRQDRIFFF |
Ga0211640_104898931 | 3300020465 | Marine | LLFDALNLFLLTNTTHELKAFTIKHGFAQHMKKILSRQDRIFFF |
Ga0211714_106203901 | 3300020466 | Marine | NYELNLFLLPNTTHELKAFTIKHAFVQGVKKFFYRQDRIFFF |
Ga0211625_101969623 | 3300020473 | Marine | FLLTNTTHELKAFTIKHDFAQHMKKLLSRQDGIFFF |
Ga0211715_100497141 | 3300020476 | Marine | LNLFLLTNTTHELKAFTIKHDFAQHKKKILSRQDRIFFLLKKLVQ |
Ga0211715_102251231 | 3300020476 | Marine | LLLLPNTTHELKAFTIKYDFAQHMKKILSRQDGILFSFEEVWRLK |
Ga0211715_103145843 | 3300020476 | Marine | LLPNTTHELKAFTIKHDFAQHMKMNLSRQDRIFFF |
Ga0211585_100144977 | 3300020477 | Marine | LNLFLLPNTTHELKAFTIKHAFVQGVKKFFYRQDRIFFF |
Ga0211585_100484311 | 3300020477 | Marine | LNLFLLPNTTHELKAFTIKHAFVQGMKKFLYRQDRIFFF |
Ga0211585_100828061 | 3300020477 | Marine | FDALNLFLLTNTTHELKAFTIKHDFAQDMKKILSRKDRIFFF |
Ga0211585_102167393 | 3300020477 | Marine | LFLLPNTTHELKAFTIKHDFAQHMKNVLSRQDGIFFF |
Ga0211585_102225701 | 3300020477 | Marine | TTHELKAFTIKHDFVQGMKKILSRGDRIFFLLKKFI |
Ga0211585_103089841 | 3300020477 | Marine | NLFFLPNTTHELKAFTIKHDFLQHMKMKNILSSKDRIFFF |
Ga0211585_103508823 | 3300020477 | Marine | ALNLFLLTNTTHELKAFTIKHDFAQHMKKILSRQDGIFFF |
Ga0211503_100495404 | 3300020478 | Marine | FLLPNTTHELKAFTIKHDFAQHMKKILSRQDGIFFF |
Ga0211503_106987981 | 3300020478 | Marine | SLHGLNLFLLPNTTHELKAFTIKHDLTQHMKNILSRKDGIFFF |
Ga0206686_11234753 | 3300021065 | Seawater | MYVLNLFLLPNTTHELKAFTIKDDLAQHMKKLLSRQDGIFFF |
Ga0206678_102776943 | 3300021084 | Seawater | NLFLLPNTTHELKAFTIKLDLTQYVKNILSRKDGIFFF |
Ga0206683_103061701 | 3300021087 | Seawater | GLNLFLLPNTTHELKAFTIKHDFAQHMKKLLSRQDGIFFF |
Ga0206683_105519342 | 3300021087 | Seawater | NLFLLPNTTHELKAFTIKHDFAQHMKKVLSRQDGIFFF |
Ga0226832_103162473 | 3300021791 | Hydrothermal Vent Fluids | IYELNLLLLPNTTHELKAFTIKYDFAQHMKKVLSRQDGIFFLLKKFDE |
Ga0187833_100370041 | 3300022225 | Seawater | LVKYDLNLFLLPNTTHELKGFTIKHDFAQHMKKVLSRQDGIFFF |
Ga0187833_100633411 | 3300022225 | Seawater | LFLLPNTTHELKAFTIKHDFAQHKKKILSRQDGIFFLLKKFN |
Ga0187833_103726943 | 3300022225 | Seawater | FLLPTNTTHELKAFTIKHDFAQHMKKILFRQDGIFFSFEEI |
Ga0187827_100064152 | 3300022227 | Seawater | LFLLPTNTTHELKAFTIKHDFAQHMKKILSRQDGIFFSFEEI |
Ga0187827_100411114 | 3300022227 | Seawater | DYLVMYDLNLFLLPNTTHELKGFTIKHDFAQHMKKVLSRQDRFFFF |
Ga0187827_100420801 | 3300022227 | Seawater | DYLVMYDLNLFLLPNTTHELKGFTIKHDFAQHMKKVLSRQDRIFFLLKKFNE |
Ga0208832_1010294 | 3300025184 | Deep Ocean | LLPNTTHKLKAFTIKHDFAQHMQKVFSRQDGILFSFEEV |
Ga0208203_10189701 | 3300025240 | Deep Ocean | LFLLPNTTHELKGFTIKHDFAQHMKKVLSRQDGIF |
Ga0207961_10568823 | 3300026073 | Marine | LLFDALNLFLLTNTTHELKAFTIKHDFAQHMKKVLSRQDGIFFF |
Ga0207961_11254701 | 3300026073 | Marine | LLFDALNLFLLTNTTHELKAFTIKHDFAQHMKKILSRQDGIFFF |
Ga0208261_10106311 | 3300026076 | Marine | NLFLLPNTTHELKAFTIKHDFAQDMKKVLSRQDGIFFF |
Ga0208750_10259124 | 3300026082 | Marine | LFLLPNTTHELKAFTIKHDFAQHKKKILSRQDGIFFLLKKFDE |
Ga0208750_10796511 | 3300026082 | Marine | DYLANYELNLLLLPNTTHELKAFTIKHAFVQGVKKFLYR |
Ga0207966_10055121 | 3300026119 | Marine | VIDELNLFLLPNTTHELKAFTIKYDFAQHMKKVLSRQDGIFFLLKKFDE |
Ga0207988_10247201 | 3300026206 | Marine | NLFLLPNTTHELKGFTIKHDFAQHMKKVLSRQDGIFFLLKKFDG |
Ga0207988_10766933 | 3300026206 | Marine | FLLPNTTHELKAFTIKHDFAQHMKKILSRQDGAFFF |
Ga0207988_10919333 | 3300026206 | Marine | NLFLLPNTTHELKGFTIKHDFAQHMKKVLSRQDRFFFF |
Ga0208409_11360322 | 3300026212 | Marine | LFLLPNTTHELKGFTIKHDFAQHMKKVLSRQDGIFFF |
Ga0208408_10664431 | 3300026260 | Marine | LLLLPNTTHELKAFTIKHDFAQDMKKILSRQDGIFFF |
Ga0208766_11716081 | 3300026269 | Marine | TYGLNLFLPPNTTHELKAFTIKQDFLQHMKIILSRKNGIFFF |
Ga0208764_100061323 | 3300026321 | Marine | LFLLTNTTHELKAFTIKHDFAQHMKKVLSRQDGIFFLLKKLDE |
Ga0208764_103186363 | 3300026321 | Marine | LNLFLLPNTTHELKAFTIKHDLAQHMKKVLSRQDGIFFF |
Ga0209228_11069323 | 3300027709 | Marine | NLFLLTNTTHELKAFTIKHDFAQHMKKVLSRQDGIFFSFEEV |
Ga0209090_103867611 | 3300027813 | Marine | TTHELKVFTIKDDFAQHVYKKFLSRQDRTFFFEEVC |
Ga0209035_103549371 | 3300027827 | Marine | FLPPNTTHELKAFTINYDFAQDMKIFLYSQCEFFLLKKFL |
Ga0209089_101592193 | 3300027838 | Marine | GLNLFLLPNTTHELKRFTIKLDFAQHMKRDFISSR |
Ga0209403_101208123 | 3300027839 | Marine | NSFLLTNTTHELKVFTIKQDFSQHVYKKFLSRQSRNFSFVEIC |
Ga0209402_107217561 | 3300027847 | Marine | FYGLNLLLVPNTTHELKAFTIKHHFAQDKKNILSPNSNFFF |
Ga0209404_104019291 | 3300027906 | Marine | YGLNLFLLPNTTHELKAFTIKLDFAQDMKNVLSRNDRIFFF |
Ga0209404_104452551 | 3300027906 | Marine | DYILIYGLNLLLVPNTTHELRAFTTKHEFAQEMKNILSRKDRIFFF |
Ga0209404_106590571 | 3300027906 | Marine | LLTNTTHELKAFTIKHDFAQHKKKFLSRQDRIYFF |
Ga0257108_10261593 | 3300028190 | Marine | LVIYELNLFLLPNTTHELKAFTIKHDLTQHMKNILSRKDGIFFF |
Ga0257108_12101442 | 3300028190 | Marine | DYLAIYGLNLFLLPNTTHELKAFTIKHDFAQHKKKILSRQDGIFFLLKKFDE |
Ga0257107_10684041 | 3300028192 | Marine | MYGLNLFLPPNTTHELKAFTIKHDLAQPMKKLLSRQDGIFFF |
Ga0257113_10836641 | 3300028488 | Marine | NLFLLPNTTHELKGFTIKHDFAQHMKKVLSRQDGIFFLLKKFGE |
Ga0257112_101947271 | 3300028489 | Marine | LFLLPNTTHELKAFTIKYDFAQHMKKVLSRQDGIFFLLKKFGE |
Ga0257111_10916261 | 3300028535 | Marine | LNLFLLPNTTHELKAFTTKFDFAQHMKTILSRQDGIFFF |
Ga0257111_11076361 | 3300028535 | Marine | FLLPNTTHELKAFTIKYDFAQHMKKDLSRQDRIFFF |
Ga0315328_103234343 | 3300031757 | Seawater | NLFLLPNATHELKAFTIKYDFAQHMKKNLSRQDGIFFF |
Ga0315328_103778023 | 3300031757 | Seawater | DYLLMYGLNLFLLPNTTHELKAFTIKPDFVQGMKIFLSREDRIFFF |
Ga0315326_101106861 | 3300031775 | Seawater | MYGLNLFLLPNTTHELKAFTIKHDFAQDMKKFLSRQDRIFFF |
Ga0315326_103193461 | 3300031775 | Seawater | LNLFLLPNTTHELKAFTIKHDFAQDMKKFLSRQDRIFFF |
Ga0315326_105207243 | 3300031775 | Seawater | SDYLVMYGLNLFFLPNTTHELKAFTIKHDFAQHMKKLLSRQDGIFFF |
Ga0310122_104543451 | 3300031800 | Marine | LFLLPNTTHELKAFTIKHDFAQHKKKILSRQDGIFFSFEE |
Ga0310122_104630392 | 3300031800 | Marine | LLPNTTHKLKAFTIKHDFAQHMKKVFSRQDGIFFSFEEV |
Ga0310121_102352483 | 3300031801 | Marine | DYLVMYGLNLFLLPNTTHELKGFTIKHDFAQHRKKVLSR |
Ga0310121_105161462 | 3300031801 | Marine | LAIYELNLFLLPNTTHELKAFTIKYDFAQHMKKDLSRQDRIFFF |
Ga0310120_101962993 | 3300031803 | Marine | AMYGLNLFLPPNTTHELKAFTIKHDFAQHMKKLLSR |
Ga0310124_106279552 | 3300031804 | Marine | EIYELNLFLLPNTTHELKAFTIKYDFAQHMKKVLSRQDGIFFF |
Ga0310125_104236092 | 3300031811 | Marine | PNTTHELKAFTIKHDFAQHKKKILSRQDGIFFSFEEI |
Ga0310125_104987942 | 3300031811 | Marine | YELNLFLLPNTTHELKAFTTKHDLAQHKKKILSRQDRIFFF |
Ga0315319_104686492 | 3300031861 | Seawater | NLFLLPNTTHELKAFTIKHDFAQHMKKILSRQDGIFFLLKKFDG |
Ga0315318_100558603 | 3300031886 | Seawater | DYLANYELNLLLLPNTTHELKAFTIKHDFAQHMKNILSRQDGIFFF |
Ga0315318_103318411 | 3300031886 | Seawater | MYGLNLFLLPNTTHELKGFTIKHDFAQHMKKVLSRQDGIFFLLKKFGE |
Ga0315318_104249221 | 3300031886 | Seawater | ELNLFLLPNTTHELKAFTIKHDFVQGVKKVLYRWDRIFFLLNKFDE |
Ga0310344_100068551 | 3300032006 | Seawater | YLVKYELNLFLTPNTTHELKAFTIKHDLAQHIKKILSR |
Ga0310344_100576961 | 3300032006 | Seawater | MYGYNLFLLPNTTHELKAFTIKHDFAQHMKKILSRQDGIFFF |
Ga0310344_101882361 | 3300032006 | Seawater | LFDALNLFLLTNTTHELKAFTIKHDFAQHMKKVLSRQDGIFFF |
Ga0310344_104111581 | 3300032006 | Seawater | LANYELNLFLLPNTTHELKAFTIKHDFVQGVKKVLYRWDRIFFLLKKFDE |
Ga0310344_110223881 | 3300032006 | Seawater | LFLLTNTTHELKAFTIKHDFAQHMKKLLSRQDGIFFF |
Ga0310344_110697491 | 3300032006 | Seawater | YLLIYELNLLLLPNTTHELKAFTIKLDLAQHMKKVLSRQDGIFFF |
Ga0310344_111045331 | 3300032006 | Seawater | YLFFDVLNLLLLTNTTHELKAFTIKHDFAQHMKKLLSRQDGIFFF |
Ga0310344_112484922 | 3300032006 | Seawater | GLNLFLLPNTTHELKAFTIKHDFAQDMKKNLSRQDGIFFF |
Ga0310344_117519591 | 3300032006 | Seawater | LFDALNLFLLPNTTHELKAFTIKHDFAQHMKKILSRQDGIFFF |
Ga0315316_111832262 | 3300032011 | Seawater | KYGLNLFLPPNTTHELKAFTIKDDISQHMNMKNILSRQDRIFFF |
Ga0315316_113759142 | 3300032011 | Seawater | LLPNTTHELKAFTIKHDFVQEMKKFLSREDRIFFF |
Ga0315316_114892202 | 3300032011 | Seawater | LPNTTHELKAFTIKHAFVQGVKIFLYRLYRVFSFEEICSVK |
Ga0315327_106250651 | 3300032032 | Seawater | LFLLPNTTHELKAFTIKHDFVQEMKIFLSREDRIFFF |
Ga0315327_106383862 | 3300032032 | Seawater | YLVMYGLNLFLPPNTTHELEVSTIKHDFVQHMKKLLSRQDRIFFF |
Ga0315327_107172521 | 3300032032 | Seawater | VLNLFLLPNTTHELKAFTIKDDLAQHMKKLLSRQDGTFFF |
Ga0315333_102266671 | 3300032130 | Seawater | ALNLFLLTNTTHELKAFTIKHDFAQHMKKLLSRQDGIFFF |
Ga0315333_104579672 | 3300032130 | Seawater | DYLAIYELNLFLLPNTTHELKAFTIKLDLTQHVKNILSRKDGIFFF |
Ga0315336_10890522 | 3300032132 | Seawater | LFLLPNTTHELKAFTIKHDFAQHMKKVLSRQEEFFSFEEI |
Ga0310345_101499971 | 3300032278 | Seawater | LLIYGLNLFLLPNTTHELKAFTIKHDLAQHMKKVLSRQDGIFFF |
Ga0310345_102397383 | 3300032278 | Seawater | LLLLPNTTHELKAFTIKYDFAQHMKKVLSRQDGII |
Ga0310345_104695423 | 3300032278 | Seawater | NYELNLFLLPNTTHELKAFTIKHAFVQGVKKFLYR |
Ga0310345_104830343 | 3300032278 | Seawater | LIYGLNLFLLPNTTHELKAFTIKLDFAQDMKKILFRQDRFFSFEEI |
Ga0310345_105233761 | 3300032278 | Seawater | GLNLFLLPNTTHELKAFTIKHDFAQHMKKVLSRQDGVFSFEEI |
Ga0310345_108615691 | 3300032278 | Seawater | YNLFLLPNTTHELKAFTIKHDFAQHMKKVLSRQDRIFFF |
Ga0310345_111412401 | 3300032278 | Seawater | QDYSLMYGLNLFLLPNTTHELKAFTIKHDLAQPMKKNLSRQDRIFFF |
Ga0310345_111474783 | 3300032278 | Seawater | LNLFLLPNTTHELKAFTIKHDFAQHMKKILSRQDGIFFF |
Ga0310345_113723393 | 3300032278 | Seawater | FLLPNTTHELKAFTIKHDFAQHMKKFINRQDGFFLF |
Ga0310345_115866981 | 3300032278 | Seawater | LFLLPNTTHELKAFTIKLDLTQYVKNILSRKDGIFFF |
Ga0310345_115994881 | 3300032278 | Seawater | LFLLTNTTHELKAFTIKHDFAQHMKKVLSRQDGIFFF |
Ga0310345_122148212 | 3300032278 | Seawater | NLFLLPNTTHELKAFTIKHDLAQHKKKILSRQDRTFFF |
Ga0315334_102248073 | 3300032360 | Seawater | NLFLLPNTTHELKAFTIKHDFAQHMKKILSRQDRIFFF |
Ga0315334_102769953 | 3300032360 | Seawater | GLNLFLLPNTTHELKAFTIKHDFAQHMKKVLSRQDIIFFF |
Ga0315334_105717973 | 3300032360 | Seawater | LFLLPNTTHELKAFTIKYDFAQDMKKILYSQDGFFSFEEL |
Ga0315334_110147121 | 3300032360 | Seawater | DYILIYGLNLFLLPNTTHELKAFTIKHDFVQARKRILSRKDRIFFF |
Ga0315334_110279571 | 3300032360 | Seawater | MYGLNLFFLPNTTHELKAFTIKHDFAQQMKMILSRKDGFFSFEEN |
Ga0315334_114255012 | 3300032360 | Seawater | LLPNTTHELKAFTIKHDFVQQRKNVLSRQDGIFFF |
Ga0315334_115871382 | 3300032360 | Seawater | LAIYELNLFLLPNTTHELKAFTIKYDFAQHMKKDLSR |
Ga0315334_117065011 | 3300032360 | Seawater | LNLFLLPNTTHELKAFTIKHGFAQHMKKVLSRQDGIFFF |
Ga0315334_117106731 | 3300032360 | Seawater | LFFLPNTTHELKAFTIKHDFAQHMKKLLSRQDGIFFF |
Ga0315334_118248981 | 3300032360 | Seawater | LPNTTHELKAFTIKYDFAQHMKKILSRKDGILFSFEEV |
Ga0310342_1003129083 | 3300032820 | Seawater | LNLFLLPNTTHELKGFTIKHDFAQHMKKVLSRRDGIFFLLKKFGE |
Ga0310342_1015980253 | 3300032820 | Seawater | NLFLLPNTTHELKAFTIKHDFAQHKKKILSRQDRIFFF |
Ga0310342_1017361151 | 3300032820 | Seawater | LFLPPNTTHELKAFTIKHDFAQHMKNILSRQDGIFFF |
Ga0372840_047057_1052_1180 | 3300034695 | Seawater | MYGLNLFLLPNTTHELKAFTIKLDFAQDKKKILSRQDRIFFF |
⦗Top⦘ |