| Basic Information | |
|---|---|
| Family ID | F009809 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 312 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGDNNIEDL |
| Number of Associated Samples | 209 |
| Number of Associated Scaffolds | 312 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 57.88 % |
| % of genes near scaffold ends (potentially truncated) | 24.68 % |
| % of genes from short scaffolds (< 2000 bps) | 99.68 % |
| Associated GOLD sequencing projects | 195 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (90.064 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.526 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.038 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (42.949 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.58% β-sheet: 0.00% Coil/Unstructured: 59.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 312 Family Scaffolds |
|---|---|---|
| PF00244 | 14-3-3 | 84.62 |
| PF01058 | Oxidored_q6 | 0.32 |
| PF07159 | CYRIA-B_Rac1-bd | 0.32 |
| COG ID | Name | Functional Category | % Frequency in 312 Family Scaffolds |
|---|---|---|---|
| COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 0.32 |
| COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 0.32 |
| COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 0.32 |
| COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 0.32 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.06 % |
| Unclassified | root | N/A | 9.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002039|LBB32012_10074122 | All Organisms → cellular organisms → Eukaryota | 990 | Open in IMG/M |
| 3300002161|JGI24766J26685_10108313 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Eurotiomycetes → Eurotiomycetidae → Eurotiales → Aspergillaceae → Aspergillus → Aspergillus subgen. Nidulantes → Aspergillus nidulans | 589 | Open in IMG/M |
| 3300002186|JGI24539J26755_10230405 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 535 | Open in IMG/M |
| 3300004112|Ga0065166_10156608 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 873 | Open in IMG/M |
| 3300004463|Ga0063356_102284909 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 825 | Open in IMG/M |
| 3300004463|Ga0063356_104051974 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 631 | Open in IMG/M |
| 3300004769|Ga0007748_10003010 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 831 | Open in IMG/M |
| 3300004769|Ga0007748_11668034 | All Organisms → cellular organisms → Eukaryota | 1036 | Open in IMG/M |
| 3300004795|Ga0007756_11539861 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 716 | Open in IMG/M |
| 3300004807|Ga0007809_10111491 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 827 | Open in IMG/M |
| 3300005418|Ga0068881_1341998 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 709 | Open in IMG/M |
| 3300005418|Ga0068881_1416055 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 897 | Open in IMG/M |
| 3300005662|Ga0078894_10732836 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 870 | Open in IMG/M |
| 3300005662|Ga0078894_11587748 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 540 | Open in IMG/M |
| 3300006107|Ga0007836_1134419 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila | 529 | Open in IMG/M |
| 3300006107|Ga0007836_1139487 | Not Available | 518 | Open in IMG/M |
| 3300006415|Ga0099654_10066233 | All Organisms → cellular organisms → Eukaryota | 799 | Open in IMG/M |
| 3300006803|Ga0075467_10220419 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1044 | Open in IMG/M |
| 3300006803|Ga0075467_10662139 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 532 | Open in IMG/M |
| 3300006805|Ga0075464_11070062 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila | 508 | Open in IMG/M |
| 3300007230|Ga0075179_1636172 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 798 | Open in IMG/M |
| 3300007230|Ga0075179_1637674 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 688 | Open in IMG/M |
| 3300007319|Ga0102691_1427590 | All Organisms → cellular organisms → Eukaryota | 699 | Open in IMG/M |
| 3300007516|Ga0105050_10383472 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 845 | Open in IMG/M |
| 3300007558|Ga0102822_1047951 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1014 | Open in IMG/M |
| 3300007665|Ga0102908_1122955 | Not Available | 532 | Open in IMG/M |
| 3300007725|Ga0102951_1080661 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 931 | Open in IMG/M |
| 3300007725|Ga0102951_1244489 | All Organisms → cellular organisms → Eukaryota | 511 | Open in IMG/M |
| 3300007955|Ga0105740_1105990 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia | 501 | Open in IMG/M |
| 3300008929|Ga0103732_1035254 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 750 | Open in IMG/M |
| 3300008932|Ga0103735_1073780 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 518 | Open in IMG/M |
| 3300008958|Ga0104259_1008557 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 918 | Open in IMG/M |
| 3300008993|Ga0104258_1045122 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 825 | Open in IMG/M |
| 3300008996|Ga0102831_1285935 | Not Available | 544 | Open in IMG/M |
| 3300009003|Ga0102813_1270006 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Myxozoa → Myxosporea → Bivalvulida → Platysporina → Myxobolidae → Myxobolus → Myxobolus squamalis | 526 | Open in IMG/M |
| 3300009003|Ga0102813_1295854 | Not Available | 501 | Open in IMG/M |
| 3300009068|Ga0114973_10613154 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae → Euplotes → Euplotes harpa | 557 | Open in IMG/M |
| 3300009071|Ga0115566_10790739 | Not Available | 522 | Open in IMG/M |
| 3300009080|Ga0102815_10852503 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 520 | Open in IMG/M |
| 3300009080|Ga0102815_10874884 | Not Available | 514 | Open in IMG/M |
| 3300009151|Ga0114962_10292393 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 913 | Open in IMG/M |
| 3300009155|Ga0114968_10768606 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae → Euplotes → Euplotes harpa | 502 | Open in IMG/M |
| 3300009172|Ga0114995_10253877 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 971 | Open in IMG/M |
| 3300009272|Ga0103877_1006677 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 659 | Open in IMG/M |
| 3300009411|Ga0115017_1286453 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 535 | Open in IMG/M |
| 3300009411|Ga0115017_1438587 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 604 | Open in IMG/M |
| 3300009432|Ga0115005_11679187 | Not Available | 522 | Open in IMG/M |
| 3300009441|Ga0115007_10356665 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 953 | Open in IMG/M |
| 3300009441|Ga0115007_10393166 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 906 | Open in IMG/M |
| 3300009441|Ga0115007_10546643 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 767 | Open in IMG/M |
| 3300009441|Ga0115007_10674168 | All Organisms → cellular organisms → Eukaryota | 692 | Open in IMG/M |
| 3300009445|Ga0115553_1368922 | Not Available | 548 | Open in IMG/M |
| 3300009543|Ga0115099_10780231 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 764 | Open in IMG/M |
| 3300009599|Ga0115103_1180317 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 876 | Open in IMG/M |
| 3300009677|Ga0115104_11266316 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 715 | Open in IMG/M |
| 3300009679|Ga0115105_11273263 | All Organisms → cellular organisms → Eukaryota | 506 | Open in IMG/M |
| 3300009785|Ga0115001_10492612 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 757 | Open in IMG/M |
| 3300010307|Ga0129319_1002466 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 714 | Open in IMG/M |
| 3300010396|Ga0134126_12663992 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 543 | Open in IMG/M |
| 3300010883|Ga0133547_12057740 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1043 | Open in IMG/M |
| 3300010981|Ga0138316_10792165 | All Organisms → cellular organisms → Eukaryota | 984 | Open in IMG/M |
| 3300010981|Ga0138316_11352840 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 762 | Open in IMG/M |
| 3300010987|Ga0138324_10448794 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 635 | Open in IMG/M |
| 3300010987|Ga0138324_10548088 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 576 | Open in IMG/M |
| 3300010987|Ga0138324_10626088 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 539 | Open in IMG/M |
| 3300012212|Ga0150985_120237059 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 718 | Open in IMG/M |
| 3300012471|Ga0129334_1028993 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 789 | Open in IMG/M |
| 3300012711|Ga0157607_1179934 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 726 | Open in IMG/M |
| 3300012714|Ga0157601_1089406 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 624 | Open in IMG/M |
| 3300012724|Ga0157611_1084574 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 690 | Open in IMG/M |
| 3300012733|Ga0157606_1106985 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 698 | Open in IMG/M |
| 3300012767|Ga0138267_1236823 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 824 | Open in IMG/M |
| 3300012778|Ga0138269_1032874 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 724 | Open in IMG/M |
| 3300012952|Ga0163180_11418804 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 577 | Open in IMG/M |
| 3300013006|Ga0164294_10858191 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 611 | Open in IMG/M |
| 3300014493|Ga0182016_10336761 | All Organisms → cellular organisms → Eukaryota | 911 | Open in IMG/M |
| 3300017238|Ga0186197_114338 | All Organisms → cellular organisms → Eukaryota | 733 | Open in IMG/M |
| 3300017262|Ga0186220_114055 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 779 | Open in IMG/M |
| 3300017262|Ga0186220_114655 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 738 | Open in IMG/M |
| 3300017788|Ga0169931_11032276 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 506 | Open in IMG/M |
| 3300018413|Ga0181560_10187421 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1017 | Open in IMG/M |
| 3300018423|Ga0181593_11022526 | Not Available | 566 | Open in IMG/M |
| 3300018666|Ga0193159_1038117 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 624 | Open in IMG/M |
| 3300018676|Ga0193137_1050589 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 597 | Open in IMG/M |
| 3300018684|Ga0192983_1025729 | All Organisms → cellular organisms → Eukaryota | 798 | Open in IMG/M |
| 3300018710|Ga0192984_1046395 | All Organisms → cellular organisms → Eukaryota | 861 | Open in IMG/M |
| 3300018730|Ga0192967_1049480 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 704 | Open in IMG/M |
| 3300018763|Ga0192827_1030111 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 928 | Open in IMG/M |
| 3300018819|Ga0193497_1045230 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 821 | Open in IMG/M |
| 3300018871|Ga0192978_1038166 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 904 | Open in IMG/M |
| 3300018871|Ga0192978_1053547 | All Organisms → cellular organisms → Eukaryota | 755 | Open in IMG/M |
| 3300018871|Ga0192978_1102610 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 514 | Open in IMG/M |
| 3300018874|Ga0192977_1058945 | All Organisms → cellular organisms → Eukaryota | 780 | Open in IMG/M |
| 3300018880|Ga0193337_1034603 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 625 | Open in IMG/M |
| 3300018881|Ga0192908_10029680 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 608 | Open in IMG/M |
| 3300018883|Ga0193276_1123791 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 518 | Open in IMG/M |
| 3300018899|Ga0193090_1109226 | All Organisms → cellular organisms → Eukaryota | 627 | Open in IMG/M |
| 3300018928|Ga0193260_10062943 | Not Available | 803 | Open in IMG/M |
| 3300018928|Ga0193260_10089178 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 669 | Open in IMG/M |
| 3300018928|Ga0193260_10148842 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 504 | Open in IMG/M |
| 3300018968|Ga0192894_10107173 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 857 | Open in IMG/M |
| 3300018968|Ga0192894_10213405 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 641 | Open in IMG/M |
| 3300018979|Ga0193540_10096545 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 815 | Open in IMG/M |
| 3300018980|Ga0192961_10101352 | All Organisms → cellular organisms → Eukaryota | 872 | Open in IMG/M |
| 3300018980|Ga0192961_10140399 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 736 | Open in IMG/M |
| 3300018989|Ga0193030_10308941 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 510 | Open in IMG/M |
| 3300019021|Ga0192982_10187120 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 735 | Open in IMG/M |
| 3300019031|Ga0193516_10204097 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 655 | Open in IMG/M |
| 3300019032|Ga0192869_10224030 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta | 807 | Open in IMG/M |
| 3300019032|Ga0192869_10259858 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 753 | Open in IMG/M |
| 3300019033|Ga0193037_10310212 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 555 | Open in IMG/M |
| 3300019033|Ga0193037_10376157 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 502 | Open in IMG/M |
| 3300019037|Ga0192886_10247387 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 583 | Open in IMG/M |
| 3300019037|Ga0192886_10308697 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 526 | Open in IMG/M |
| 3300019040|Ga0192857_10169334 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 681 | Open in IMG/M |
| 3300019045|Ga0193336_10504274 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 582 | Open in IMG/M |
| 3300019048|Ga0192981_10176168 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 841 | Open in IMG/M |
| 3300019048|Ga0192981_10184681 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 818 | Open in IMG/M |
| 3300019048|Ga0192981_10239315 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 698 | Open in IMG/M |
| 3300019048|Ga0192981_10299033 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 601 | Open in IMG/M |
| 3300019051|Ga0192826_10257349 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 642 | Open in IMG/M |
| 3300019051|Ga0192826_10265746 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 630 | Open in IMG/M |
| 3300019112|Ga0193106_1022441 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 685 | Open in IMG/M |
| 3300019117|Ga0193054_1025186 | Not Available | 871 | Open in IMG/M |
| 3300019117|Ga0193054_1036152 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 742 | Open in IMG/M |
| 3300019123|Ga0192980_1055927 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 748 | Open in IMG/M |
| 3300019270|Ga0181512_1035534 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 731 | Open in IMG/M |
| 3300019270|Ga0181512_1164794 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 795 | Open in IMG/M |
| 3300020146|Ga0196977_1052098 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 973 | Open in IMG/M |
| 3300020147|Ga0196976_1043216 | All Organisms → cellular organisms → Eukaryota | 985 | Open in IMG/M |
| 3300020183|Ga0194115_10121251 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1415 | Open in IMG/M |
| 3300020183|Ga0194115_10174508 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1090 | Open in IMG/M |
| 3300020205|Ga0211731_11325793 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1326 | Open in IMG/M |
| 3300020205|Ga0211731_11673951 | All Organisms → cellular organisms → Eukaryota | 960 | Open in IMG/M |
| 3300021067|Ga0196978_1041652 | All Organisms → cellular organisms → Eukaryota | 856 | Open in IMG/M |
| 3300021169|Ga0206687_1471833 | All Organisms → cellular organisms → Eukaryota | 847 | Open in IMG/M |
| 3300021169|Ga0206687_1529057 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 703 | Open in IMG/M |
| 3300021305|Ga0210296_1026861 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 580 | Open in IMG/M |
| 3300021342|Ga0206691_1793331 | Not Available | 832 | Open in IMG/M |
| 3300021350|Ga0206692_1599329 | All Organisms → cellular organisms → Eukaryota | 784 | Open in IMG/M |
| 3300021350|Ga0206692_1703128 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 882 | Open in IMG/M |
| 3300021353|Ga0206693_1481186 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 701 | Open in IMG/M |
| 3300021359|Ga0206689_10579444 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 944 | Open in IMG/M |
| 3300021424|Ga0194117_10419457 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 610 | Open in IMG/M |
| 3300021792|Ga0226836_10381465 | Not Available | 807 | Open in IMG/M |
| 3300021872|Ga0063132_105251 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 798 | Open in IMG/M |
| 3300021890|Ga0063090_1053138 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 748 | Open in IMG/M |
| 3300021910|Ga0063100_1022523 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 726 | Open in IMG/M |
| 3300021910|Ga0063100_1040809 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 781 | Open in IMG/M |
| 3300021912|Ga0063133_1035269 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 767 | Open in IMG/M |
| 3300021924|Ga0063085_1056310 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 826 | Open in IMG/M |
| 3300021960|Ga0222715_10633628 | Not Available | 547 | Open in IMG/M |
| 3300021960|Ga0222715_10718782 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 501 | Open in IMG/M |
| 3300022529|Ga0242668_1044418 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 773 | Open in IMG/M |
| (restricted) 3300023208|Ga0233424_10233212 | Not Available | 730 | Open in IMG/M |
| 3300024343|Ga0244777_10944810 | Not Available | 501 | Open in IMG/M |
| 3300024346|Ga0244775_11372887 | Not Available | 544 | Open in IMG/M |
| 3300025381|Ga0208871_1053300 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 537 | Open in IMG/M |
| 3300025890|Ga0209631_10483013 | Not Available | 555 | Open in IMG/M |
| 3300025933|Ga0207706_11169564 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 640 | Open in IMG/M |
| 3300027249|Ga0208175_1034133 | Not Available | 532 | Open in IMG/M |
| 3300027249|Ga0208175_1035271 | Not Available | 523 | Open in IMG/M |
| 3300027720|Ga0209617_10307824 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 591 | Open in IMG/M |
| 3300027736|Ga0209190_1127384 | All Organisms → cellular organisms → Eukaryota | 1134 | Open in IMG/M |
| 3300027777|Ga0209829_10380628 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 552 | Open in IMG/M |
| 3300027786|Ga0209812_10177342 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 990 | Open in IMG/M |
| 3300027786|Ga0209812_10379260 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae | 612 | Open in IMG/M |
| 3300027793|Ga0209972_10382477 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 601 | Open in IMG/M |
| 3300027805|Ga0209229_10378528 | Not Available | 616 | Open in IMG/M |
| 3300027805|Ga0209229_10419218 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 579 | Open in IMG/M |
| 3300027810|Ga0209302_10483268 | Not Available | 551 | Open in IMG/M |
| 3300028575|Ga0304731_10451067 | All Organisms → cellular organisms → Eukaryota | 984 | Open in IMG/M |
| 3300028575|Ga0304731_10469651 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 698 | Open in IMG/M |
| 3300028575|Ga0304731_10644066 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 703 | Open in IMG/M |
| 3300028575|Ga0304731_10979399 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 762 | Open in IMG/M |
| 3300028776|Ga0302303_10120677 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 945 | Open in IMG/M |
| 3300029908|Ga0311341_10660231 | All Organisms → cellular organisms → Eukaryota → Sar | 585 | Open in IMG/M |
| 3300029908|Ga0311341_10701198 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 564 | Open in IMG/M |
| 3300029910|Ga0311369_10729633 | All Organisms → cellular organisms → Eukaryota | 810 | Open in IMG/M |
| 3300030399|Ga0311353_11077710 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 669 | Open in IMG/M |
| 3300030528|Ga0210277_10504913 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 671 | Open in IMG/M |
| 3300030528|Ga0210277_10933443 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 614 | Open in IMG/M |
| 3300030528|Ga0210277_10947728 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 735 | Open in IMG/M |
| 3300030531|Ga0210274_1129992 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 795 | Open in IMG/M |
| 3300030532|Ga0210290_1603667 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 603 | Open in IMG/M |
| 3300030537|Ga0247642_1020725 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 629 | Open in IMG/M |
| 3300030540|Ga0247649_1071553 | Not Available | 557 | Open in IMG/M |
| 3300030545|Ga0210271_10399608 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 816 | Open in IMG/M |
| 3300030546|Ga0247646_1086338 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 745 | Open in IMG/M |
| 3300030548|Ga0210252_10279908 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 720 | Open in IMG/M |
| 3300030549|Ga0210257_10296753 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 656 | Open in IMG/M |
| 3300030549|Ga0210257_10355857 | All Organisms → cellular organisms → Eukaryota | 647 | Open in IMG/M |
| 3300030549|Ga0210257_10920603 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 717 | Open in IMG/M |
| 3300030551|Ga0247638_1059349 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 765 | Open in IMG/M |
| 3300030551|Ga0247638_1110338 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea | 629 | Open in IMG/M |
| 3300030553|Ga0247645_1037986 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 840 | Open in IMG/M |
| 3300030553|Ga0247645_1047475 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 796 | Open in IMG/M |
| 3300030553|Ga0247645_1068043 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 728 | Open in IMG/M |
| 3300030564|Ga0210256_10211081 | All Organisms → cellular organisms → Eukaryota | 712 | Open in IMG/M |
| 3300030564|Ga0210256_10557735 | All Organisms → cellular organisms → Eukaryota | 762 | Open in IMG/M |
| 3300030564|Ga0210256_10664562 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 756 | Open in IMG/M |
| 3300030564|Ga0210256_11035808 | All Organisms → cellular organisms → Eukaryota | 794 | Open in IMG/M |
| 3300030565|Ga0247635_1075273 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 792 | Open in IMG/M |
| 3300030572|Ga0210258_10075114 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 695 | Open in IMG/M |
| 3300030572|Ga0210258_10343445 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 725 | Open in IMG/M |
| 3300030572|Ga0210258_10753906 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 656 | Open in IMG/M |
| 3300030573|Ga0210272_1287201 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 525 | Open in IMG/M |
| 3300030573|Ga0210272_1293375 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 521 | Open in IMG/M |
| 3300030578|Ga0210275_10116168 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 753 | Open in IMG/M |
| 3300030578|Ga0210275_10139625 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 714 | Open in IMG/M |
| 3300030578|Ga0210275_10210420 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 630 | Open in IMG/M |
| 3300030578|Ga0210275_10405691 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 501 | Open in IMG/M |
| 3300030579|Ga0247633_10047341 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 819 | Open in IMG/M |
| 3300030585|Ga0247639_1102677 | All Organisms → cellular organisms → Eukaryota | 741 | Open in IMG/M |
| 3300030592|Ga0247612_1050917 | All Organisms → cellular organisms → Eukaryota | 827 | Open in IMG/M |
| 3300030593|Ga0210263_1115349 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 625 | Open in IMG/M |
| 3300030594|Ga0210280_1117746 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 599 | Open in IMG/M |
| 3300030595|Ga0210276_10597854 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 740 | Open in IMG/M |
| 3300030599|Ga0247630_1072897 | All Organisms → cellular organisms → Eukaryota | 723 | Open in IMG/M |
| 3300030599|Ga0247630_1122029 | All Organisms → cellular organisms → Eukaryota | 623 | Open in IMG/M |
| 3300030599|Ga0247630_1216544 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 517 | Open in IMG/M |
| 3300030601|Ga0247650_1066525 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 641 | Open in IMG/M |
| 3300030608|Ga0247651_10258812 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 561 | Open in IMG/M |
| 3300030609|Ga0247634_10264464 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 665 | Open in IMG/M |
| 3300030609|Ga0247634_10391557 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 582 | Open in IMG/M |
| 3300030621|Ga0247655_10094561 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 738 | Open in IMG/M |
| 3300030625|Ga0210259_11194191 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 716 | Open in IMG/M |
| 3300030625|Ga0210259_11952128 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 752 | Open in IMG/M |
| 3300030626|Ga0210291_10641387 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 750 | Open in IMG/M |
| 3300030626|Ga0210291_11363684 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 705 | Open in IMG/M |
| 3300030626|Ga0210291_11766808 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 552 | Open in IMG/M |
| 3300030626|Ga0210291_11914369 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 700 | Open in IMG/M |
| 3300030628|Ga0247629_10379359 | Not Available | 535 | Open in IMG/M |
| 3300030630|Ga0210282_10096205 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 789 | Open in IMG/M |
| 3300030634|Ga0247636_10224188 | All Organisms → cellular organisms → Eukaryota | 608 | Open in IMG/M |
| 3300030634|Ga0247636_10298491 | Not Available | 546 | Open in IMG/M |
| 3300030671|Ga0307403_10350028 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 791 | Open in IMG/M |
| 3300030722|Ga0308137_1090019 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 544 | Open in IMG/M |
| 3300030738|Ga0265462_11556603 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 619 | Open in IMG/M |
| 3300030740|Ga0265460_11697514 | All Organisms → cellular organisms → Eukaryota | 642 | Open in IMG/M |
| 3300030741|Ga0265459_11077449 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 857 | Open in IMG/M |
| 3300030741|Ga0265459_11515662 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota | 767 | Open in IMG/M |
| 3300030741|Ga0265459_11674999 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 740 | Open in IMG/M |
| 3300030741|Ga0265459_12871955 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 600 | Open in IMG/M |
| 3300030741|Ga0265459_13003596 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 589 | Open in IMG/M |
| 3300030743|Ga0265461_11246364 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 773 | Open in IMG/M |
| 3300030743|Ga0265461_13857561 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 510 | Open in IMG/M |
| 3300030758|Ga0138305_1196086 | All Organisms → cellular organisms → Eukaryota | 629 | Open in IMG/M |
| 3300030774|Ga0074007_10729302 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 562 | Open in IMG/M |
| 3300030775|Ga0074021_1000002 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 681 | Open in IMG/M |
| 3300030775|Ga0074021_1410811 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 936 | Open in IMG/M |
| 3300030800|Ga0074032_10799181 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 558 | Open in IMG/M |
| 3300030840|Ga0074020_10034650 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 753 | Open in IMG/M |
| 3300030840|Ga0074020_10079854 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 621 | Open in IMG/M |
| 3300030840|Ga0074020_11036339 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 600 | Open in IMG/M |
| 3300030907|Ga0074013_10734783 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 576 | Open in IMG/M |
| 3300030907|Ga0074013_11968181 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 700 | Open in IMG/M |
| 3300030911|Ga0102763_10615624 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 746 | Open in IMG/M |
| 3300030911|Ga0102763_11017229 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 775 | Open in IMG/M |
| 3300030923|Ga0138296_1572537 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 742 | Open in IMG/M |
| 3300030923|Ga0138296_1632568 | All Organisms → cellular organisms → Eukaryota | 751 | Open in IMG/M |
| 3300030938|Ga0138299_10788001 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 592 | Open in IMG/M |
| 3300030962|Ga0138297_1158595 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 554 | Open in IMG/M |
| 3300030979|Ga0068589_11396961 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 606 | Open in IMG/M |
| 3300031029|Ga0074012_10582624 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 586 | Open in IMG/M |
| 3300031032|Ga0073980_11241386 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 548 | Open in IMG/M |
| 3300031034|Ga0074041_10052778 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 510 | Open in IMG/M |
| 3300031057|Ga0170834_101406699 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 707 | Open in IMG/M |
| 3300031057|Ga0170834_105507334 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 725 | Open in IMG/M |
| 3300031062|Ga0073989_13540847 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 727 | Open in IMG/M |
| 3300031122|Ga0170822_11060007 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 727 | Open in IMG/M |
| 3300031211|Ga0307974_1098070 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1109 | Open in IMG/M |
| 3300031212|Ga0307959_1144251 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 582 | Open in IMG/M |
| 3300031231|Ga0170824_102737226 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 738 | Open in IMG/M |
| 3300031231|Ga0170824_114730250 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 803 | Open in IMG/M |
| 3300031231|Ga0170824_120055704 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 543 | Open in IMG/M |
| 3300031411|Ga0102761_12305648 | All Organisms → cellular organisms → Eukaryota | 829 | Open in IMG/M |
| 3300031446|Ga0170820_10637797 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 770 | Open in IMG/M |
| 3300031446|Ga0170820_11970332 | Not Available | 771 | Open in IMG/M |
| 3300031446|Ga0170820_12253612 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 822 | Open in IMG/M |
| 3300031446|Ga0170820_15267182 | Not Available | 515 | Open in IMG/M |
| 3300031446|Ga0170820_15307133 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 725 | Open in IMG/M |
| 3300031446|Ga0170820_15323095 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 761 | Open in IMG/M |
| 3300031446|Ga0170820_17121155 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 529 | Open in IMG/M |
| 3300031469|Ga0170819_13315985 | Not Available | 585 | Open in IMG/M |
| 3300031469|Ga0170819_14109980 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea | 696 | Open in IMG/M |
| 3300031469|Ga0170819_14151996 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 548 | Open in IMG/M |
| 3300031469|Ga0170819_15259820 | Not Available | 756 | Open in IMG/M |
| 3300031474|Ga0170818_115459529 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia | 631 | Open in IMG/M |
| 3300031524|Ga0302320_11435104 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 684 | Open in IMG/M |
| 3300031569|Ga0307489_10268026 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1090 | Open in IMG/M |
| 3300031569|Ga0307489_10912865 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 624 | Open in IMG/M |
| 3300031570|Ga0308144_1042380 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 561 | Open in IMG/M |
| 3300031580|Ga0308132_1081945 | All Organisms → cellular organisms → Eukaryota | 664 | Open in IMG/M |
| 3300031734|Ga0307397_10297805 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 731 | Open in IMG/M |
| 3300031788|Ga0302319_11009201 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 792 | Open in IMG/M |
| 3300031788|Ga0302319_11904861 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 509 | Open in IMG/M |
| 3300032092|Ga0315905_10667171 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 928 | Open in IMG/M |
| 3300032092|Ga0315905_10873039 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | 773 | Open in IMG/M |
| 3300032739|Ga0315741_10843718 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 804 | Open in IMG/M |
| 3300032739|Ga0315741_10974182 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 753 | Open in IMG/M |
| 3300032739|Ga0315741_11064413 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila | 722 | Open in IMG/M |
| 3300032739|Ga0315741_11836144 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 535 | Open in IMG/M |
| 3300032756|Ga0315742_11281226 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 761 | Open in IMG/M |
| 3300032756|Ga0315742_11340535 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 749 | Open in IMG/M |
| 3300032756|Ga0315742_11473946 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 724 | Open in IMG/M |
| 3300032756|Ga0315742_13552256 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 503 | Open in IMG/M |
| 3300034021|Ga0335004_0308394 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 932 | Open in IMG/M |
| 3300034022|Ga0335005_0261858 | Not Available | 1044 | Open in IMG/M |
| 3300034071|Ga0335028_0680551 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 541 | Open in IMG/M |
| 3300034167|Ga0335017_0652651 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 539 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.53% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 15.38% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 10.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 8.33% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.53% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.53% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 3.21% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.56% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.92% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.60% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.60% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 1.28% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.96% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.96% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.96% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.96% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.96% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.32% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater | 0.32% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.32% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.32% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.32% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.32% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.32% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.32% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.32% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.32% |
| Delisea Pulchra | Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra | 0.32% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.32% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.32% |
| Surface Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water | 0.32% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 0.32% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.64% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.64% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.64% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.64% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.64% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.64% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.64% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.64% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.64% |
| Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 0.64% |
| Ice Edge, Mcmurdo Sound, Antarctica | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002039 | Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_LB_B3 | Host-Associated | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002186 | Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Metagenome | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004795 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300005418 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel3S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006107 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Oct07 | Environmental | Open in IMG/M |
| 3300006415 | Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake community | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007230 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007319 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007558 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 | Environmental | Open in IMG/M |
| 3300007665 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3 | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300007955 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0um | Environmental | Open in IMG/M |
| 3300008929 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1A | Environmental | Open in IMG/M |
| 3300008932 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2A | Environmental | Open in IMG/M |
| 3300008958 | Marine microbial communities from eastern North Pacific Ocean - P1 particle-associated | Environmental | Open in IMG/M |
| 3300008993 | Marine microbial communities from eastern North Pacific Ocean - P1 free-living | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009272 | Eukaryotic communities of water from the North Atlantic ocean - ACM45 | Environmental | Open in IMG/M |
| 3300009411 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
| 3300009543 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009679 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010307 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300010981 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4) | Environmental | Open in IMG/M |
| 3300010987 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012471 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012711 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012724 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012767 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012778 | Freshwater microbial communities from Lake Croche, Canada - C_130208_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300017238 | Metatranscriptome of marine eukaryotic communities from unknown location in Brackish water medium, at 19 C, 5 psu salinity and 389 ?mol photons light - Pseudokeronopsis sp. Brazil (MMETSP1396) | Host-Associated | Open in IMG/M |
| 3300017262 | Metatranscriptome of marine eukaryotic communities from Tyrrhenian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 291 ?mol photons light - Pseudokeronopsis sp. OXSARD2 (MMETSP0211) | Host-Associated | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018666 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000398 (ERX1782307-ERR1712184) | Environmental | Open in IMG/M |
| 3300018676 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782202-ERR1711913) | Environmental | Open in IMG/M |
| 3300018684 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160) | Environmental | Open in IMG/M |
| 3300018710 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809766-ERR1740136) | Environmental | Open in IMG/M |
| 3300018730 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028) | Environmental | Open in IMG/M |
| 3300018763 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868) | Environmental | Open in IMG/M |
| 3300018819 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002940 (ERX1789719-ERR1719288) | Environmental | Open in IMG/M |
| 3300018871 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345) | Environmental | Open in IMG/M |
| 3300018874 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115) | Environmental | Open in IMG/M |
| 3300018880 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782455-ERR1712124) | Environmental | Open in IMG/M |
| 3300018881 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782151-ERR1712094) | Environmental | Open in IMG/M |
| 3300018883 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001582 (ERX1789446-ERR1719492) | Environmental | Open in IMG/M |
| 3300018899 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133) | Environmental | Open in IMG/M |
| 3300018928 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386) | Environmental | Open in IMG/M |
| 3300018968 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096) | Environmental | Open in IMG/M |
| 3300018979 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037) | Environmental | Open in IMG/M |
| 3300018980 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127) | Environmental | Open in IMG/M |
| 3300018989 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934) | Environmental | Open in IMG/M |
| 3300019021 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957) | Environmental | Open in IMG/M |
| 3300019031 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939) | Environmental | Open in IMG/M |
| 3300019032 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216) | Environmental | Open in IMG/M |
| 3300019033 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080) | Environmental | Open in IMG/M |
| 3300019037 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183) | Environmental | Open in IMG/M |
| 3300019040 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154) | Environmental | Open in IMG/M |
| 3300019045 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224) | Environmental | Open in IMG/M |
| 3300019048 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166) | Environmental | Open in IMG/M |
| 3300019051 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227) | Environmental | Open in IMG/M |
| 3300019112 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000836 (ERX1782266-ERR1711948) | Environmental | Open in IMG/M |
| 3300019117 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912) | Environmental | Open in IMG/M |
| 3300019123 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195) | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020146 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13C | Environmental | Open in IMG/M |
| 3300020147 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5-13C | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021067 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20-13C | Environmental | Open in IMG/M |
| 3300021169 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021305 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021342 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021350 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021353 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021359 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021792 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Illium_FS922 150_kmer | Environmental | Open in IMG/M |
| 3300021872 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021890 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021910 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021912 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021924 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023208 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025381 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027249 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027786 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027810 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028575 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030528 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030531 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030532 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE108SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030537 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030540 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030545 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030546 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb11 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030548 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030549 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030551 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030553 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb10 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030564 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030565 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb12 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030572 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR103SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030573 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO036SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030578 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030579 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb10 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030585 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb4 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030592 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030593 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE024SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030594 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030595 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO083SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030599 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030601 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030608 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb4 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030609 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb11 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030621 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db8 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030625 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030626 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030628 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb6 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030630 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO115SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030634 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030671 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030722 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030758 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030774 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030775 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 9 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030800 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030840 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 8 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030907 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood TCEFB (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030911 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 2A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030923 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030938 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030962 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030979 | Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031029 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood TCEFA (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031032 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031034 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031062 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031211 | Saline water microbial communities from Organic Lake, Antarctica - #784 | Environmental | Open in IMG/M |
| 3300031212 | Saline water microbial communities from Organic Lake, Antarctica - #494 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031411 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031570 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_547_5m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031580 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031734 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032739 | Forest Soil Metatranscriptomics Site 2 LB Combined Assembly | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LBB32012_100741221 | 3300002039 | Delisea Pulchra | LGEEDFRDAKSIIELLKENLTLWKEEEEGGQGDDA* |
| JGI24766J26685_101083131 | 3300002161 | Freshwater And Sediment | DDVDEETFRDAKSIIELLKENLTLWKEEEGNADNNIEDL* |
| JGI24539J26755_102304052 | 3300002186 | Marine | DKIDELEEDDFRDAKSIIELLKENLTLWKEEEEGDNQIDDL* |
| Ga0065166_101566083 | 3300004112 | Freshwater Lake | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGADNNIEDL* |
| Ga0063356_1022849091 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDL* |
| Ga0063356_1040519741 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LDKIDDLGEDDFRDAKSIIELLKENITLWKEEEEGEGQNIEDL* |
| Ga0007748_100030102 | 3300004769 | Freshwater Lake | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGDNNIEDL* |
| Ga0007748_116680343 | 3300004769 | Freshwater Lake | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGNADNNIEDL* |
| Ga0007756_115398613 | 3300004795 | Freshwater Lake | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNIE |
| Ga0007809_101114912 | 3300004807 | Freshwater | MRLGEQALADALEKIDDVDEETFRDAKSIIELLKENLSLWKEEED* |
| Ga0068881_13419981 | 3300005418 | Freshwater Lake | MNKIDEVDEETFRDAKSIIELLKENLTLWKEEEGENNIEDL* |
| Ga0068881_14160551 | 3300005418 | Freshwater Lake | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGENNIEDL* |
| Ga0078894_107328362 | 3300005662 | Freshwater Lake | LEEDDFRDAKSIIELLKENLTLWKEEEDGEDNQIDDL* |
| Ga0078894_115877482 | 3300005662 | Freshwater Lake | LDKIDEISEEDFRDAKSIIELLKENLSLWKEEEGGQNIEDL* |
| Ga0007836_11344191 | 3300006107 | Freshwater | LDKIDELEEDDFRDAKSIIELLKENLTLWKEEEDGADNQIDDL* |
| Ga0007836_11394872 | 3300006107 | Freshwater | EDDFRDAKSIIELLKENLTLWKEEEEGDNQIDDL* |
| Ga0099654_100662332 | 3300006415 | Lake | VDEETFRDAKSIIELLKENLSLWKEEEADNAVEDL* |
| Ga0075467_102204191 | 3300006803 | Aqueous | IDELEEDDFRDAKSIIELLKENLTLWKEEDEEQNQIDDL*MPPVN* |
| Ga0075467_106621392 | 3300006803 | Aqueous | IDELEEDDFRDAKSIIELLKENLTLWKEEDEEQNQIDDL*TPLVN* |
| Ga0075464_110700621 | 3300006805 | Aqueous | LEEDDFRDAKSIIELLKENLTLWKEEEEGDNQIDDL* |
| Ga0075179_16361724 | 3300007230 | Wastewater Effluent | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNQIEDL* |
| Ga0075179_16376741 | 3300007230 | Wastewater Effluent | LNEEDFRDAKSIIELLKENLTLWKDEEEGGDNNIEDL* |
| Ga0102691_14275903 | 3300007319 | Freshwater Lake | MNKIDEVDEETFRDAKSIIELLKENLTLWKEEEGENNIE |
| Ga0105050_103834721 | 3300007516 | Freshwater | MNKIDEVDEETFRDAKSIIELLKENLTLWKEEEGDNNIEDL* |
| Ga0102822_10479511 | 3300007558 | Estuarine | LSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNNVEDL* |
| Ga0102908_11229552 | 3300007665 | Estuarine | SDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL* |
| Ga0102951_10806612 | 3300007725 | Water | LSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEENQVDDL* |
| Ga0102951_12444892 | 3300007725 | Water | LSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVDDL* |
| Ga0105740_11059901 | 3300007955 | Estuary Water | EALDKIDELEEDDFRDAKSIIELLKENLTLWKEEEEDGGNEIDDL* |
| Ga0103732_10352542 | 3300008929 | Ice Edge, Mcmurdo Sound, Antarctica | LGEKALADALDKIDDVDEETFRDAKSIIELLKENLSLWKEE* |
| Ga0103735_10737801 | 3300008932 | Ice Edge, Mcmurdo Sound, Antarctica | LGEKALADALDKIDDVDEETFRDAKSIIELLKENLSLW |
| Ga0104259_10085574 | 3300008958 | Ocean Water | LEEDDFRDAKSIIELLKENLTLWKEEDDENAIDDL* |
| Ga0104258_10451221 | 3300008993 | Ocean Water | LSEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGDNAVEDL* |
| Ga0102831_12859351 | 3300008996 | Estuarine | ALSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL* |
| Ga0102813_12700061 | 3300009003 | Estuarine | LSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEE* |
| Ga0102813_12958541 | 3300009003 | Estuarine | TALSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEDQNAVEDL* |
| Ga0114973_106131541 | 3300009068 | Freshwater Lake | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEDGGADNNIEDL* |
| Ga0115566_107907391 | 3300009071 | Pelagic Marine | LTDALEKIDDVDEEVFRDAKSIIELLKENLSLWKEDDVDNVEDL* |
| Ga0102815_108525031 | 3300009080 | Estuarine | VEDEFRDAKSIIELLKENLTLWKDEEQDGNEIDDL* |
| Ga0102815_108748841 | 3300009080 | Estuarine | SDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNNVEDL* |
| Ga0114962_102923933 | 3300009151 | Freshwater Lake | LEKIDDVDEETFRDAKSIIELLKENLSLWKEEED* |
| Ga0114968_107686061 | 3300009155 | Freshwater Lake | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGNDNNIEDL* |
| Ga0114995_102538771 | 3300009172 | Marine | LEKIDDVDEDTFRDAKSIIELLKENLSLWKEEEGDNIEDL* |
| Ga0103877_10066771 | 3300009272 | Surface Ocean Water | LEEDDFRDAKSIIELLKENLTLWKEEEEGGDDAVEDMQ* |
| Ga0115017_12864532 | 3300009411 | Soil | LQNALEKIDDCDEETFRDAKSIIELLKENLSLWKEEEEGAGNDVEDM* |
| Ga0115017_14385871 | 3300009411 | Soil | LDKIDDIAEDDFRDAKSIIELLKENLTLWKEEEEGADNNIEDL* |
| Ga0115005_116791872 | 3300009432 | Marine | DEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL* |
| Ga0115007_103566651 | 3300009441 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGGNDVEDL* |
| Ga0115007_103931662 | 3300009441 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEDGNNNVEDL* |
| Ga0115007_105466433 | 3300009441 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEGEGVEDL* |
| Ga0115007_106741682 | 3300009441 | Marine | MNKIDEVNEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDL* |
| Ga0115553_13689222 | 3300009445 | Pelagic Marine | GEAALSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL* |
| Ga0115099_107802311 | 3300009543 | Marine | LTDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL* |
| Ga0115103_11803173 | 3300009599 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDEGDNAVEDL* |
| Ga0115104_112663162 | 3300009677 | Marine | LSEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEGDNAVEDL* |
| Ga0115105_112732631 | 3300009679 | Marine | MGEKSLSDALDKIDDVDEETFRDAKSIIELLKENLSLWKEEEGNDVEDL* |
| Ga0115001_104926123 | 3300009785 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEGAGQD* |
| Ga0129319_10024662 | 3300010307 | Aqueous | LDKIDEIEEDDFRDAKSIIGLLKENLTLWKEEEDGDNNIDDL* |
| Ga0134126_126639921 | 3300010396 | Terrestrial Soil | DKIDELNEDDFRDAKSIIELLKENLTLWKEEEEGGQNIEDL* |
| Ga0133547_120577402 | 3300010883 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNNVEDL* |
| Ga0138316_107921653 | 3300010981 | Marine | VDEETFRDAKSIIELLKENLSLWKEEEGDNAVEDL* |
| Ga0138316_113528402 | 3300010981 | Marine | LAEDDFRDAKSIIELLKENLTLWKEEEEGGDNNIDDL* |
| Ga0138324_104487942 | 3300010987 | Marine | LSEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEGDNAVE |
| Ga0138324_105480883 | 3300010987 | Marine | LDKIDELEEDDFRDAKSIIELLKENLTLWKEEEGDNNIDDL* |
| Ga0138324_106260882 | 3300010987 | Marine | LQDVIDELEEDDFRDAKSIIELLKENLTLWKEEDEEQNQIDDL* |
| Ga0150985_1202370591 | 3300012212 | Avena Fatua Rhizosphere | LDKIDDLGEEDFRDAKSIIELLKENLTLWKEEEEGGDNNIDDL* |
| Ga0129334_10289932 | 3300012471 | Aqueous | LDKIDELEEDDFRDAKSIIELLKENLTLWKEEEEDGGNEIEDF* |
| Ga0157607_11799342 | 3300012711 | Freshwater | LDKIDELEEDDFRDAKSIIELLKENLTLWKEEEDGDNNIDDL* |
| Ga0157601_10894062 | 3300012714 | Freshwater | LDKIDELEEDDFRDAKSIIELLKENLTLWKEEEDG |
| Ga0157611_10845742 | 3300012724 | Freshwater | LDKIDELEEDDFRDAKSIIELLKENLTLWKEEEDGD |
| Ga0157606_11069852 | 3300012733 | Freshwater | LDKIDELEEDDFRDAKSIIELLKENLTLWKEEEDGDNNIDD |
| Ga0138267_12368231 | 3300012767 | Polar Marine | MGEQALTDALDKIDDADEDEFREAKSIIELLKENLSLWKESD* |
| Ga0138269_10328742 | 3300012778 | Freshwater Lake | LEEDDFRDAKSIIELLKENLTLWKEEEDGEDNQIDD |
| Ga0163180_114188042 | 3300012952 | Seawater | LDKIDELEEDDFRDAKSIIELLKENLTLWKEEEEGGEGQEIDDL* |
| Ga0164294_108581912 | 3300013006 | Freshwater | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEDNDNNIEDL* |
| Ga0182016_103367612 | 3300014493 | Bog | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDQNIEDL* |
| Ga0186197_1143383 | 3300017238 | Host-Associated | LGEIALNNALEKIDECDEETFRDAKNIIELLKENLSLWKEEGEDEKE |
| Ga0186220_1140552 | 3300017262 | Host-Associated | LEKIDDCDEETFRDAKSIIELLKENLSLWKEDEEDNKGEDN |
| Ga0186220_1146551 | 3300017262 | Host-Associated | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEENQNADDQ |
| Ga0169931_110322761 | 3300017788 | Freshwater | QEALDKIDELEEDDFRDAKSIIELLKENLTLWKEEEEDGGNYLNDM |
| Ga0181560_101874212 | 3300018413 | Salt Marsh | LSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVDDL |
| Ga0181593_110225261 | 3300018423 | Salt Marsh | LSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL |
| Ga0193159_10381172 | 3300018666 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEENEGVEDL |
| Ga0193137_10505892 | 3300018676 | Marine | LDKIDELEEDDFRDAKSIIELLKENLTLWKEEEEGGDGQEIDDL |
| Ga0192983_10257291 | 3300018684 | Marine | LADASLTDALDKIDELEEDAFRDAKSIIELLKENLTLWKEEEGDNIDDL |
| Ga0192984_10463953 | 3300018710 | Marine | LEEDDFRDAKSIIELLKENLTLWKEEDDENAIDDL |
| Ga0192967_10494801 | 3300018730 | Marine | MALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL |
| Ga0192827_10301111 | 3300018763 | Marine | LGESALSEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGDNAVEDL |
| Ga0193497_10452302 | 3300018819 | Marine | LDKIDELEEDDFRDAKSIIELLKENLTLWKEEEEGGEGQEIDDL |
| Ga0192978_10381661 | 3300018871 | Marine | LSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNNVEDL |
| Ga0192978_10535473 | 3300018871 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEGNNDVEDL |
| Ga0192978_11026102 | 3300018871 | Marine | LEEDDFRDAKSIIELLKENLTLWKEEDDDNAIDDL |
| Ga0192977_10589453 | 3300018874 | Marine | LGEQALGDALEKIDDVDEETFREAKSIIELLKENLSIWKESEEQNIEDL |
| Ga0193337_10346031 | 3300018880 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEENDNAVEDL |
| Ga0192908_100296803 | 3300018881 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGDNAVEDL |
| Ga0193276_11237911 | 3300018883 | Marine | LQSALDKIDELEEDDFRDAKSIIELLKENLTLWKEEEDDDNAIDDL |
| Ga0193090_11092263 | 3300018899 | Marine | LADASLTDALDKIDELEEDAFRDAKSIIELLKENLTLWKEEEGD |
| Ga0193260_100629431 | 3300018928 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGANDVEDLXERXL |
| Ga0193260_100891783 | 3300018928 | Marine | LADESLQQALDKIDELGEDDFRDAKSIIELLKENLTLWKEEEEGGDN |
| Ga0193260_101488421 | 3300018928 | Marine | MGKIDDVDEEMFRDAKSIIELLKENLTLWKEEDGGDNNIEDM |
| Ga0192894_101071731 | 3300018968 | Marine | LELGEKALSDALEKIDDVDEETFRDAKSIIELLKENISLWKEEDDPEDL |
| Ga0192894_102134052 | 3300018968 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENISLWKEEEGGVEDLXINLNFI |
| Ga0193540_100965453 | 3300018979 | Marine | LQEALDKIDELEEEDFRDAKSIIELLKENLTLWKEEEDNADVDQIDAI |
| Ga0192961_101013521 | 3300018980 | Marine | LEEDDFRDAKSIIELLKENLTLWKEEENGNEIDDI |
| Ga0192961_101403993 | 3300018980 | Marine | LSNALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDDQNAVQDL |
| Ga0193030_103089411 | 3300018989 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEGDGNAVEDL |
| Ga0192982_101871202 | 3300019021 | Marine | MGEQALTDALDKIDDADEDEFREAKSIIELLKENLSLWKESD |
| Ga0193516_102040972 | 3300019031 | Marine | MTTKKLVSWGESALSEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEGDNAVEDLXV |
| Ga0192869_102240301 | 3300019032 | Marine | LTKALENIDDVDEETFRDAKSIIELLKENLSLWKEEDGDNAVEDL |
| Ga0192869_102598581 | 3300019032 | Marine | LDKIDELGEDDFRDAKSIIELLKENLTLWGEEEEDGNQIDDLXI |
| Ga0193037_103102122 | 3300019033 | Marine | LTEALEHIDDVDEETFRDAKSIIELLKENLSLWKEEDGDNAVEDL |
| Ga0193037_103761571 | 3300019033 | Marine | LSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDDNNAVEDL |
| Ga0192886_102473871 | 3300019037 | Marine | LTEALEKIDDVDEETFRDAKSIVELLKENLSLWKEEEGDNAVDDL |
| Ga0192886_103086971 | 3300019037 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGGNDVEDL |
| Ga0192857_101693341 | 3300019040 | Marine | VKLADQALQDALDKIDELEEDDFRDAKSIIELLKENLTLLKEEQDDDNAIDDL |
| Ga0193336_105042741 | 3300019045 | Marine | LEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGDGNNVEDL |
| Ga0192981_101761682 | 3300019048 | Marine | LEEDEFRDAKSIIELLKENLTLWKEDDEENNIDDL |
| Ga0192981_101846813 | 3300019048 | Marine | LEEDDFRDAKSIIELLKENLTLWKEEEEGDNNIDDL |
| Ga0192981_102393152 | 3300019048 | Marine | LSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEE |
| Ga0192981_102990332 | 3300019048 | Marine | LGEQALGDALEKIDDVDEETFREAKSIIELLKENLSIWKESEEQNI |
| Ga0192826_102573491 | 3300019051 | Marine | LTDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEGGDDQ |
| Ga0192826_102657462 | 3300019051 | Marine | LGEEALSEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDENAVEDL |
| Ga0193106_10224412 | 3300019112 | Marine | LQEALDKIDELEEDDFRDAKSIIELLKENLTLWKEEEDNADVDQIDAI |
| Ga0193054_10251862 | 3300019117 | Marine | MTLGETALQEALDKIDECDEETFRDAKSIIELLKENLSLWKEEDEGQEVDDL |
| Ga0193054_10361522 | 3300019117 | Marine | LGEQALSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEE |
| Ga0192980_10559272 | 3300019123 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLSTWKEEDGDVEDL |
| Ga0181512_10355342 | 3300019270 | Peatland | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDL |
| Ga0181512_11647941 | 3300019270 | Peatland | LGEEDFRDAKSIIELLKENITLWKEEEEGGDNNIEDL |
| Ga0196977_10520981 | 3300020146 | Soil | MSKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDL |
| Ga0196976_10432161 | 3300020147 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDLXVFFT |
| Ga0194115_101212511 | 3300020183 | Freshwater Lake | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGNADNNIEDL |
| Ga0194115_101745083 | 3300020183 | Freshwater Lake | MNKIDEVDEETFRDAKSIIELLKENLTLWKEEEGENNIEDL |
| Ga0211731_113257931 | 3300020205 | Freshwater | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGDNNIEDL |
| Ga0211731_116739513 | 3300020205 | Freshwater | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGNDNNIEDL |
| Ga0196978_10416521 | 3300021067 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDLXVFF |
| Ga0206687_14718331 | 3300021169 | Seawater | LTDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL |
| Ga0206687_15290572 | 3300021169 | Seawater | LSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEE |
| Ga0210296_10268611 | 3300021305 | Estuarine | LSEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGDNAVEDL |
| Ga0206691_17933313 | 3300021342 | Seawater | VDEETFRDAKSIIELLKENLSLWKEEEGGDNNVEDL |
| Ga0206692_15993293 | 3300021350 | Seawater | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGENAVEDL |
| Ga0206692_17031283 | 3300021350 | Seawater | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDEGDNAVEDL |
| Ga0206693_14811863 | 3300021353 | Seawater | LEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGANDVEDL |
| Ga0206689_105794441 | 3300021359 | Seawater | LSDALEKIDDVDDETSRDAKSIIELLKENLSLWKEEEEQNAVEDL |
| Ga0194117_104194572 | 3300021424 | Freshwater Lake | MLASSPKKIDELEEDDFRDAKSIIELLKENLTLWKEEEEGGDNQIDDL |
| Ga0226836_103814651 | 3300021792 | Hydrothermal Vent Fluids | LNKFRYQEDDDVDEETFRDAKSIIELLKENLSLWKEEEADNKVEDL |
| Ga0063132_1052513 | 3300021872 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEGDNGVEDL |
| Ga0063090_10531383 | 3300021890 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEGDNAVEDL |
| Ga0063100_10225232 | 3300021910 | Marine | MNKIDEVDEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDL |
| Ga0063100_10408092 | 3300021910 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEDGNNNVEDL |
| Ga0063133_10352691 | 3300021912 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL |
| Ga0063085_10563103 | 3300021924 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLXLWKEEDEGDNAVEDL |
| Ga0222715_106336281 | 3300021960 | Estuarine Water | ELGEAALSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNNVEDL |
| Ga0222715_107187821 | 3300021960 | Estuarine Water | LSNALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEDQNNVEDL |
| Ga0242668_10444181 | 3300022529 | Soil | LGEEDFRDAKSIIELLKENLTLWKEEEEGGDNNIEDL |
| (restricted) Ga0233424_102332121 | 3300023208 | Freshwater | ALSDALDKLDDCDEETFRDAQSIIELLRENLGLWKDEERDM |
| Ga0244777_109448101 | 3300024343 | Estuarine | DDVDEDTFRDAKSIIELLKENLTLWKEEDGDNNIEDL |
| Ga0244775_113728872 | 3300024346 | Estuarine | DALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL |
| Ga0208871_10533001 | 3300025381 | Freshwater | TALQDAMNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGADNNIEDL |
| Ga0209631_104830131 | 3300025890 | Pelagic Marine | LSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDLXAXNLSP |
| Ga0207706_111695641 | 3300025933 | Corn Rhizosphere | CDEETFRDAKSIIELLKENLSLWKEEEDENKEVEDL |
| Ga0208175_10341331 | 3300027249 | Estuarine | SDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL |
| Ga0208175_10352712 | 3300027249 | Estuarine | DVDEETFRDAKSIIELLKENLSLWKEEEEQNAVEDL |
| Ga0209617_103078241 | 3300027720 | Freshwater And Sediment | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGDN |
| Ga0209190_11273841 | 3300027736 | Freshwater Lake | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGADNNIEDL |
| Ga0209829_103806282 | 3300027777 | Freshwater Lake | LEEDDFRDAKSIIELLKENLTLWKEEEDGEDNQIDDL |
| Ga0209812_101773423 | 3300027786 | Wastewater Effluent | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNQIEDL |
| Ga0209812_103792601 | 3300027786 | Wastewater Effluent | LEKIDDLGEDDFRDAKSIIELLKENLTLWKEEEEGADNNIEDL |
| Ga0209972_103824771 | 3300027793 | Freshwater Lake | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGENNIEDL |
| Ga0209229_103785281 | 3300027805 | Freshwater And Sediment | KIDDVDEETFRDAKSIIELLKENLTLWKEEEGDNNIEDL |
| Ga0209229_104192181 | 3300027805 | Freshwater And Sediment | EETFRDAKSIIELLKENLTLWKEEEGNADNNIEDLXRE |
| Ga0209302_104832681 | 3300027810 | Marine | ELGEDDFRDAKSIIELLKENLTLWKEEAEEGNDNEVDDI |
| Ga0304731_104510673 | 3300028575 | Marine | VDEETFRDAKSIIELLKENLSLWKEEEGDNAVEDL |
| Ga0304731_104696512 | 3300028575 | Marine | LGEQALSEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDADNA |
| Ga0304731_106440662 | 3300028575 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDG |
| Ga0304731_109793992 | 3300028575 | Marine | LAEDDFRDAKSIIELLKENLTLWKEEEEGGDNNIDDL |
| Ga0302303_101206771 | 3300028776 | Palsa | LGEEDFRDAKSIIELLKENLTLWKEEEEGGEQNIEDL |
| Ga0311341_106602312 | 3300029908 | Bog | MNKIDDVDEETFRDAKSIIELLKENLTLWKEDEGADNHIEDL |
| Ga0311341_107011982 | 3300029908 | Bog | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNAIEDL |
| Ga0311369_107296331 | 3300029910 | Palsa | MSKIDDVDEEVFRDAKSIIELLKENLTLWKDEDAGGDNA |
| Ga0311353_110777102 | 3300030399 | Palsa | LGEEDFRDAKSIIELLKENLTLWKEEEEGGEQNIED |
| Ga0210277_105049132 | 3300030528 | Soil | LEKIDDCDEETFRDAKSIIELLKENLSLWKEDDEEKNDIEDL |
| Ga0210277_109334431 | 3300030528 | Soil | LEKIDDCDEETFRDAKSIIELLKENLSLWKEEDEDNKGDIEDL |
| Ga0210277_109477281 | 3300030528 | Soil | LGEEDFRDAKSIIELLKENITLWKEEEDGADNNIEDL |
| Ga0210274_11299921 | 3300030531 | Soil | LGEEEFRDAKSIIELLKENLTLWKEEEEGAGNEIQDL |
| Ga0210290_16036671 | 3300030532 | Soil | LDKIDDLNEEDFRDAKSIIELLKENLTLWKDEEEGGDNNIEDL |
| Ga0247642_10207251 | 3300030537 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKDEEGGGDNNIDDL |
| Ga0247649_10715532 | 3300030540 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKDEEGGDNAIEDL |
| Ga0210271_103996082 | 3300030545 | Soil | LGEEDFRDAKSIIELLKENITLWKEEEDGADNAIEDL |
| Ga0247646_10863382 | 3300030546 | Soil | LDKIDELGEEDFRDAKSIIELLKENLTLWKEEEEGGDNAIEDL |
| Ga0210252_102799082 | 3300030548 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEDAGEGGLEDL |
| Ga0210257_102967531 | 3300030549 | Soil | MNLCRPLDKIDDLNEEDFRDAKSIIELLKENLTLWKDEEEGGDNNIEDL |
| Ga0210257_103558571 | 3300030549 | Soil | MSKIDEVDEETFRDAKSIIELLKENLTLWKEEDGDAKNEIDDLXSICIP |
| Ga0210257_109206032 | 3300030549 | Soil | LAEESLQAALDKIDDIGEDDFRDAKSIIELLKENITLWKEDEEEGGKNIDDL |
| Ga0247638_10593491 | 3300030551 | Soil | MNRIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDL |
| Ga0247638_11103383 | 3300030551 | Soil | LDKIDDIAEDDFRDAKSIIELLKENLTLWKEEEEGAD |
| Ga0247645_10379862 | 3300030553 | Soil | LNEEDFRDAKSIIELLKENLTLWKDEEEGGDNNIEDL |
| Ga0247645_10474751 | 3300030553 | Soil | MNKIEEIGEDMFRDAKSIIELLKENLTLWKEEEGGDNNIEDL |
| Ga0247645_10680432 | 3300030553 | Soil | LNEDDFRDAKSIIELLKENITLWKEEDEGGDNNVEDL |
| Ga0210256_102110813 | 3300030564 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKDEEGGE |
| Ga0210256_105577351 | 3300030564 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNAIEDLXSXSS |
| Ga0210256_106645621 | 3300030564 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNVEDM |
| Ga0210256_110358081 | 3300030564 | Soil | LAEVALQDAMNKIDDVDEEAFRDAKSIIELLKENLTLWKEEENGDNNIEDM |
| Ga0247635_10752732 | 3300030565 | Soil | LEKIDELDEETFRDAKSIIELLKENLTLWKDEEEGG |
| Ga0210258_100751141 | 3300030572 | Soil | LAEESLQAALDKIDDIGEDDFRDAKSIIELLKENITLWKEDEDEGGKN |
| Ga0210258_103434451 | 3300030572 | Soil | LEKIDDCDEETFRDAKSIIELLKENLSLWKEDEDAGKNEIDDL |
| Ga0210258_107539062 | 3300030572 | Soil | LDKIDELGEEDFRDAKSIIELLKENLTLWKEEEEGADNNIEDL |
| Ga0210272_12872011 | 3300030573 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGEGGENN |
| Ga0210272_12933751 | 3300030573 | Soil | LGEEDFRDAKSIIELLKQNITLWKEEEDGADNNIEDL |
| Ga0210275_101161681 | 3300030578 | Soil | MSKIDEVDEETFRDAKSIIELLKENLTLWKEEDGGDKDIEDL |
| Ga0210275_101396251 | 3300030578 | Soil | LQAALDKIDELGEDDFRDAKSIIELLKENLTLWKEEEEGGDNNIEDL |
| Ga0210275_102104202 | 3300030578 | Soil | LAEESLQAALDKIDDIGEDDFRDAKSIIELLKENITLWKEDDEQADNNIEDL |
| Ga0210275_104056912 | 3300030578 | Soil | LLADESLQAALDKIDDLGEDDFRDAKSIIELLKENLTLWKEEEDGADNAIEEL |
| Ga0247633_100473412 | 3300030579 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNAIEDLXVGSL |
| Ga0247639_11026773 | 3300030585 | Soil | LGEEDFRDAKSIIELLKENLTLWKEEEEDGTADDA |
| Ga0247612_10509171 | 3300030592 | Soil | LGEDDFRDAKSIIELLKENLTLWKEEEEGGDNNIEDL |
| Ga0210263_11153491 | 3300030593 | Soil | LDKIDELGEEDFRDAKSIIELLKENLTLWKEEEEGGEAIEDL |
| Ga0210280_11177461 | 3300030594 | Soil | LDKLDDCDEEMFRDAQSIIELLRENLALWKEEDEGNNNNEI |
| Ga0210276_105978542 | 3300030595 | Soil | LEKIDDCDEETFRDAKSIIELLKENLSLWKEDDEDKNDIEDL |
| Ga0247630_10728973 | 3300030599 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNAIEDLXSXVS |
| Ga0247630_11220293 | 3300030599 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGD |
| Ga0247630_12165442 | 3300030599 | Soil | LNKIDDCDEETFRDAKSIIELLKENLSLWKEEDEGKNEI |
| Ga0247650_10665252 | 3300030601 | Soil | LDKIDELGEEDFRDAKSIIELLKENLTLWKDEEEGGGDNIEDL |
| Ga0247651_102588121 | 3300030608 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGADNNIEDL |
| Ga0247634_102644641 | 3300030609 | Soil | LNEDDFRDAKSIIELLKENITLWKEEDESGDNNVEDL |
| Ga0247634_103915572 | 3300030609 | Soil | LGEEDFRDAKSIIELLMENLTLWKEEEEGGQGDDA |
| Ga0247655_100945612 | 3300030621 | Soil | MNKIDEIGEDMFRDAKSIIELLKENLTLWKEEEGGDNNIEDLXVSICQKYP |
| Ga0210259_111941913 | 3300030625 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGENNIEDMXFSLFA |
| Ga0210259_119521283 | 3300030625 | Soil | MSKIDDVDEDTFRDAKSIIELLKENLTLWQDDGDGAEGAIEDL |
| Ga0210291_106413871 | 3300030626 | Soil | MSKIDEVDEETFRDAKSIIELLKENLTLWKEEEADGKNDIADL |
| Ga0210291_113636841 | 3300030626 | Soil | LDEETFRDAKSIIELLKENLTLWKEEEEGGQNIEDL |
| Ga0210291_117668082 | 3300030626 | Soil | LDKIDDLGEDDFRDAKSIIELLKENLTLWKEEEEGGDNNIEDF |
| Ga0210291_119143691 | 3300030626 | Soil | LDKIDDIGEDDFRDAKSIIELLKENLTLWKEEEEGGDNNI |
| Ga0247629_103793591 | 3300030628 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDLXTLFSP |
| Ga0210282_100962052 | 3300030630 | Soil | MNKIDEVDEETFRDAKSIIELLKENLTLWKEEPEKGGNEVDDM |
| Ga0247636_102241881 | 3300030634 | Soil | LADEALQAALDKIDDLGEEDFRDAKSIIELLKENLTLWKEEEGG |
| Ga0247636_102984911 | 3300030634 | Soil | IDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNKRNGRR |
| Ga0307403_103500282 | 3300030671 | Marine | LGEQALGDALEKIDDVDEETFRDAKSIIELLKENLSIWKESEEQNIEDL |
| Ga0308137_10900191 | 3300030722 | Marine | LTEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEDGENGVEDL |
| Ga0265462_115566032 | 3300030738 | Soil | LDKIDDLGEEDFRDAKSIIELLKENITLWKEDDENGGTNNIEDL |
| Ga0265460_116975143 | 3300030740 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKDEECGDQNIEDL |
| Ga0265459_110774493 | 3300030741 | Soil | LAEESLQAALDKIDDIGEDDFRDAKSIIELLKENITLWKEDEEEGGKNIDD |
| Ga0265459_115156623 | 3300030741 | Soil | MSKIDEVDEETFRDAKSIIELLKENLTLWKEEDGDAKNEIDDL |
| Ga0265459_116749991 | 3300030741 | Soil | MSKIDEVDEETFRDAKSIIELLKENLTLWKEEVEGKNDVDDM |
| Ga0265459_128719552 | 3300030741 | Soil | LDEETFKDAKSIIELLKENLTLWKEEEEGGHNEDEN |
| Ga0265459_130035961 | 3300030741 | Soil | VLADETLQKALEKIDELTEEDFRDAKSIIELLKENHSLWKEEENAGDNPVEEL |
| Ga0265461_112463642 | 3300030743 | Soil | MDDCDEDTFRDAKSISELLKENLSLWKEEEDEGKNVEDL |
| Ga0265461_138575611 | 3300030743 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNAIEDLXSXRA |
| Ga0138305_11960861 | 3300030758 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKDEEGGDNAIEDLXAY |
| Ga0074007_107293021 | 3300030774 | Soil | LADEALQAALDKIDDIAEEDFRDAKSIIELLKENLSLWKEEEEGGDNNIDDLNL |
| Ga0074021_10000022 | 3300030775 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDLXAGP |
| Ga0074021_14108111 | 3300030775 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEDGGDNNIEDLXSLFVLC |
| Ga0074032_107991811 | 3300030800 | Soil | MSKIDEVDEETFRDAKSIIELLKENLTLWKEEVEGKNDVDDMXXEGDCE |
| Ga0074020_100346501 | 3300030840 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNEI |
| Ga0074020_100798543 | 3300030840 | Soil | LEKIDDCDEETFRDAKSIIELLKENLSLWKEEEDENKNDIEDL |
| Ga0074020_110363391 | 3300030840 | Soil | LDKIDDIGEEDFRDAKSIIELLKENLTLWKEEEEGGQNIEDL |
| Ga0074013_107347832 | 3300030907 | Soil | LDKIDDLGEDDFRDAKSIIELLKENLTLWKEEEEGGDNNIEDL |
| Ga0074013_119681811 | 3300030907 | Soil | LQDALDKLDDCDEETFRDAQSIIELLRENLALWKEEDEG |
| Ga0102763_106156241 | 3300030911 | Soil | LDKIDDLGEEDFRDAKSIIELLKENITLWKEEEEGGDNNIEDL |
| Ga0102763_110172291 | 3300030911 | Soil | LEKIDDCDEETFRDAKSIIELLKENLSLWKEEEEGGKNDIEDL |
| Ga0138296_15725371 | 3300030923 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGADNDIQDL |
| Ga0138296_16325681 | 3300030923 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKDEEGGDQNIEDL |
| Ga0138296_16551693 | 3300030923 | Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKDEEGGDNAIEDLXAYVRRNSYFLIL |
| Ga0138299_107880012 | 3300030938 | Soil | LQNALEKIDDCDEETFRDAKSIIELLKENLSLWKEEEEGAGNDVEDM |
| Ga0138297_11585952 | 3300030962 | Soil | LDKIDDLNEEDFRDAKSIIELLKENLTLWKEEEEGADGNNIDDL |
| Ga0068589_113969611 | 3300030979 | Soil | LGDKALQDALDKLDDCNEETFRDAQSIIELLRENLALWKEEDEGNQNAIEDL |
| Ga0074012_105826241 | 3300031029 | Soil | LEKIDELDEETFRDAKSIIELLKENLTLWKEEEEGGQNIEDL |
| Ga0073980_112413861 | 3300031032 | Marine | LEKIDDVDEETFRDAKSIIELLKENLSLWKEEEGDNAVEDL |
| Ga0074041_100527782 | 3300031034 | Soil | LGEEEFRDAKSIIELLKENLTLWKEEEEGGANEIQDL |
| Ga0170834_1014066991 | 3300031057 | Forest Soil | LQGALDKIDELDEETFRDAKSIIELLKENLTLWKEEEEGGQNIEDL |
| Ga0170834_1055073342 | 3300031057 | Forest Soil | MNKIDEVDEETFRDAKSIIELLKENLTLWKEEAEGGKEVDDL |
| Ga0073989_135408473 | 3300031062 | Marine | LGESALSEALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEGDNAVEDL |
| Ga0170822_110600072 | 3300031122 | Forest Soil | LEKIDDCDEETFRDAKSIIELLKENLSLWKEDDEE |
| Ga0307974_10980701 | 3300031211 | Saline Water | LADALAKLDDVDEETFRESQSIIELLKENLTLWKEEGGDNNVDDL |
| Ga0307959_11442512 | 3300031212 | Saline Water | LADALAKLDDVDEETFRESQSIIELLKENLTLWKEEGGDNNVD |
| Ga0170824_1027372262 | 3300031231 | Forest Soil | LADESLQQALDKIDELGEEDFRDAKSIIELLKENLTLWKEEEEVGDNAIEDL |
| Ga0170824_1147302502 | 3300031231 | Forest Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKDDEGGDNNAIEDL |
| Ga0170824_1200557042 | 3300031231 | Forest Soil | LDKLDDCDEEMFRDAQSIIELLRENLALWKEEDEGNNNAIEDL |
| Ga0102761_123056481 | 3300031411 | Soil | LDKIDDLGEEDFRDAKSIIELLKENLTLWKEEEEGGDNNIDDL |
| Ga0170820_106377972 | 3300031446 | Forest Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKDEAGDGD |
| Ga0170820_119703323 | 3300031446 | Forest Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKDEDNND |
| Ga0170820_122536122 | 3300031446 | Forest Soil | LGEEDFRDAKSIIELLKENITLWKEEEDGADNQIEDL |
| Ga0170820_152671821 | 3300031446 | Forest Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKDEVEGGD |
| Ga0170820_153071331 | 3300031446 | Forest Soil | LAEESLQAALDKIDDLGEDDFRDAKSIIELLKENITLWKEDEAEGEQPIEEL |
| Ga0170820_153230952 | 3300031446 | Forest Soil | LGEDDFRDAKSIIELLKENITLWKEEEEGETNNNIEDL |
| Ga0170820_171211551 | 3300031446 | Forest Soil | MNKIDEVDEETFRDAKSIIELLKENLTLWKEEVEGGDGKDVDDL |
| Ga0170819_133159851 | 3300031469 | Forest Soil | MSKIDEVDEETFRDAKSIIELLKENKTLWKEEDGEGKNEIDDL |
| Ga0170819_141099803 | 3300031469 | Forest Soil | LDKIDDIAEDDFRDAKSIIELLKENLTLWKEEEEGADNNIEDL |
| Ga0170819_141519961 | 3300031469 | Forest Soil | MNKIDDVEEETFRDAKSIIELLKENLTLWKEEEGGDNNIEDL |
| Ga0170819_152598201 | 3300031469 | Forest Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKDEEGGDNAIEDLXAYVVISYC |
| Ga0170818_1154595293 | 3300031474 | Forest Soil | LERIDDCDEETFRDAKSIIELLKENLSLWKEDEGEKEVEDM |
| Ga0302320_114351042 | 3300031524 | Bog | MNKIDEVDEETFRDAKSIIELLKENLTLWKEEEGDNNIEDL |
| Ga0307489_102680261 | 3300031569 | Sackhole Brine | VDEETFRDAKSIIELLKENLSLWKEEEDQNAVEDL |
| Ga0307489_109128651 | 3300031569 | Sackhole Brine | LSEALINIDDVDEVTFKDSKSIIELLKENLSLWKEEKLNDEEN |
| Ga0308144_10423801 | 3300031570 | Marine | LEKIDDVDEDTFRDAKSIIELLKENLSLWKEEEGDNIEDL |
| Ga0308132_10819451 | 3300031580 | Marine | MGEKALSDALDKIDDVDEETFRDAKSIIELLKENISLWKEEEGNDDNDVEDL |
| Ga0307397_102978052 | 3300031734 | Marine | LSDALEKIDDVDEETFRDAKSIIELLKENLSLWKEEEEQNEVQDL |
| Ga0302319_110092012 | 3300031788 | Bog | MNKIDDVDEETFRDAKSIIELLKENLTLWKEEEGGDNNVDDL |
| Ga0302319_119048611 | 3300031788 | Bog | LDKLDDCDEETFRDAQSIIELLRENLALWKEEDEGN |
| Ga0315905_106671712 | 3300032092 | Freshwater | LDKIDELEEDDFRDAKSIIELLKENLTLWKEEEEDGGNEIEDF |
| Ga0315905_108730391 | 3300032092 | Freshwater | LDKIDELEEDDFRDAKSIIELLKENLTLWKEEEDGDNNIDDL |
| Ga0315741_108437182 | 3300032739 | Forest Soil | LEKIDDCDEETFRDAKSIIELLKENLSLWKEDDDDKNDIEDL |
| Ga0315741_109741824 | 3300032739 | Forest Soil | LDKIDELGEDDFRDAKSIIELLKENLTLWKEEEEGGDNNIEDL |
| Ga0315741_110644133 | 3300032739 | Forest Soil | LEKIDDCDEETFRDAKSIIELLKENLSLWKEEEDEGKNDIEDL |
| Ga0315741_118361441 | 3300032739 | Forest Soil | MNKIDDVDEETFRDAKSIIELLKENLTLWKEDEGGDNNIEDL |
| Ga0315742_112812261 | 3300032756 | Forest Soil | LEKIDDCDEETFRDAKSIIELLKENLSLWKEEEDDNKNEIEDL |
| Ga0315742_113405351 | 3300032756 | Forest Soil | MSKIEEVDEETFRDAKSIIELLKENLTLWKEEEADGKNDIEDL |
| Ga0315742_114739461 | 3300032756 | Forest Soil | LAEESLQAALDKIDDIGEDDFRDAKSIIELLKENITLWKEDEDEGGKNIDDL |
| Ga0315742_135522561 | 3300032756 | Forest Soil | LEKIDDCDEETFRDAKSIIELLKENLSLWKEEEDENKNEIEDL |
| Ga0335004_0308394_131_238 | 3300034021 | Freshwater | VDEETFRDAKSIIELLKENLSLWKEEEADNAVEDL |
| Ga0335005_0261858_805_915 | 3300034022 | Freshwater | VDEETFRDAKSIIELLKENLSLWKEEEDKNNADEDL |
| Ga0335028_0680551_397_540 | 3300034071 | Freshwater | ALQDALDKIDELEEDDFRDAKSIIELLKENLTLWKEEEEGDNQIDDL |
| Ga0335017_0652651_2_133 | 3300034167 | Freshwater | ALDKIDELEEDDFRDAKSIIELLKENLTLWKEEEEGDNQIDDL |
| ⦗Top⦘ |